4GKKC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 33
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4gkkC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4gkkC02
4JI1C 3EERA 1N34C 3R9WA 1USPB 1ZB9A 3GKUA 4YHHC 3J81D 2E8CA 4NXMC 1HNZC 2ZM6C 1XMOC 1L2FA 4LF7C 2UUAC 4DCTA 3T1HC 1IBKC 4DR3C 4DR6C 4JI8C 4DR7C 1N32C 4JI6C 1I94C 4JI4C 2ATWA 5FLXD 1EGAA 2UUCC 2PT7G 4KHPC 4DV7C 3LUSA 3J7AD 1ML8A 4DV0C 4DV4C 2JMPA 4MH4A 2E8FA 4X65C 4MTNA 1IBLC 1PA4A 4DR1C 2ASBA 1FJGC 1N2FA 1WF3A 2XR1A 2F4VC 2BJOA 4JI3C 1LQLA 2CY1A 4GKKC 4JV5C 4OX9C 4K0KC 5LMUC 4X62C 2UXDC 1J5EC 4X64C 4NOZA 1USPA 4YY3C 1XNQC 4AQYC 1VLAA 2E8EA 2E7GA 4LF9C 4JI5C 2VQFC 5LMNC 5IWAC 1UKKA 2HHHC 4DUYC 4LF8C 1QWIA 3T1YC 4B3SC 1HH2P 3IEUA 1MKYA 4DR2C 4LFAC 4DUZC 4LFBC 4DV3C 2DYJA 4DCUA 3OTOC 4JI2C 2ONFA 3CJEA 2HJGA 5A2QD 2UU9C 3J80D 1N33C 3R9XA 3AF5A 3IEVA 2D7VA 4B3RC 1JOSA 4DCSA 4B3TC 4B3MC 4JI7C 1KKGA 2OPLA 1ZB8A 3JAMD 4DV1C 1HNWC 2KZFA 4BSZA 1K0RA 4DV6C 4LF6C 1IBMC 4JYAC 4X66C 4XX2A 3I07A 4LF4C 2UUBC 2CXCA 4DCVA 4DV2C 1HNXC 4GKJC 5IT9D 2QL8A 1XMQC 2PN2A 1XNRC 2UXCC 4DR5C 1HR0C 2E5LC 4NXNC 2UXBC 1N36C 4JI0C 2YCBA 4DR4C 1WH9A 2EGTA 4DV5C 1NYEA 2OPLB 2VQEC 3AF6A 4LF5C 5BR8C 4LFCC
chains in the Genus database with same CATH superfamily
1ZB9A 3CQ2A 3IPLA 3EQ6A 5BSUA 4NXMC 3FCEA 2NCLA 3T1HC 4DR6C 1P4EA 1RY2A 1I94C 2UUCC 3GPCA 4KHPC 4DV7C 3LUSA 1ML8A 2YX1A 3A4IA 3NI2A 5KYTA 4X65C 5GTDA 1FJGC 4DR1C 4RMNA 4EATA 2F4VC 4JI3C 1LCIA 4K0KC 4RM2A 5LMUC 2UXDC 4IR7A 2P2JA 1VEHA 1XNQC 4AQYC 4JM1A 5K85A 1VLAA 4WS9A 4LF9C 1MXAA 5IWAC 2D1TA 2HHHC 4DUYC 4LF8C 3GR0A 1HH2P 4BC7A 3IEUA 1MKYA 2QW0X 2Z51A 3CQ3A 3OTOC 5CZVA 1QM4A 2HJGA 3CJEA 5JRHA 3B7WA 1N33C 2P20A 3UX2A 3AF5A 3DLPX 4B3TC 1MDBA 4PZPA 2P2MA 1ZB8A 2KZFA 4I9FA 4D4GA 3C5EA 1IBMC 4JYAC 4X66C 4XX2A 1XRAA 2UUBC 2OO4A 1HNXC 3UEBA 2QL8A 5AE2A 3G7SA 4JI0C 3PROC 2WP0C 3A26A 2YCBA 2QVYX 4IZ6A 2EGTA 1NYEA 3LNVA 3VNQA 1V60A 3AF6A 4PHTA 4RLQA 3N54B 3R44A 3TUFA 3GR1A 5AE1A 3EERA 1N34C 3R9WA 3PESA 1M6XA 3AY0A 4YHHC 4GS5A 1HNZC 2ZM6C 1XMOC 1L2FA 4TPSB 1MD9A 4ZJZA 1BA3A 3CW9A 4GXQA 3LNOA 4DR3C 4L7IA 2JNVA 1TH5A 2MM9A 5BUSA 2BH1X 5A1GA 5CZXA 3UOWA 1YJ7A 4G36A 4ODJA 4DV0C 4MH4A 2E8FA 1IBLC 1PA4A 1O90A 2ASBA 1N2FA 1WF3A 1FUGA 2XR1A 2ZZNA 2CY1A 2Y4NA 3UX3A 2Y4OA 1USPA 4YY3C 2E8EA 3S82A 2E7GA 5A19A 2P02A 4JI5C 5LMNC 1RG9A 3RG2A 3ETCA 3T1YC 2D1QA 3O2EA 1XRCA 1ULTA 4LFAC 2DPLA 4DCUA 2DYJA 1MXCA 4JI2C 2ONFA 5A1IA 2ZZMA 5IFIA 2M5HA 2PG1E 2D1RA 2D7VA 4B3RC 1JOSA 4DCSA 1WCJA 3KXWA 2PROA 3JAMD 4DV1C 2P2FA 4LF6C 4R1MA 4GXRA 3NPDA 3CQ1A 1O92A 4DCVA 4DV2C 4GKJC 2PN2A 2M5OA 1HR0C 2UXBC 1WH9A 2P2QA 5T8TA 2MCQA 2VQEC 4U5YD 2D1SA 5BSMA 1MXBA 5BR8C 4LFCC 3L95X 1USPB 1V26A 2E8CA 3IMLA 4G1IA 1IBKC 1IB8A 2AYAA 4JI6C 4JI4C 2ATWA 5FLXD 2PT7G 4RM3A 4R0MA 4MTNA 5BSVA 1XRBA 2OBVA 5ADZA 1LQLA 5K8FA 1PU1A 1NY8A 3E7WA 3VNSA 2YWCA 3LGXA 5AE3A 4NOZA 3NYQA 4PUHA 2V7BA 3NYRA 1YGTA 1UKKA 3K6RA 1QWIA 2MMAB 1XHJA 5LCIA 4DR2C 1T5HX 4RVOA 4D57A 2VZEA 4DV3C 2D27A 4NDNA 5A2QD 4ISBA 3N2QA 3R9XA 4LE5A 3IEVA 5T8SA 4D56A 4PROC 4B3MC 5BSWA 5DV9A 4G37A 2Y27A 2OPLA 1HNWC 3H2TA 4BSZA 1K0RA 4DV6C 1PG4A 5BUQA 3I07A 3DAYA 3DHVA 1AMUA 1XMQC 1PG3A 2VSQA 2UXCC 2D28C 4NXNC 4PUIA 5BSTA 4K0BA 3I08A 4FUQA 2ZTBA 4LFBC 4JI1C 4FUTA 4KTTA 3GKUA 3J81D 1V25A 4L2ZA 3A25A 2WD9A 4LF7C 2UUAC 5BSRA 4DCTA 2P2BA 5KEIA 4JI8C 4DR7C 1N32C 3E7XA 1P4EC 1XDXA 1EGAA 3J7AD 3ETOA 4BC9A 4HPVA 4DV4C 2JMPA 1T5DX 1O93A 2KDNA 4BCAA 2BJOA 4GKKC 4JV5C 4PUGA 4OX9C 4ZLPA 4X62C 4D4IA 1J5EC 1MDFA 3FM7A 2QVXX 3UZ0A 1GPMA 1FLOA 4X64C 4KTVA 4L4QA 4R1LA 1XS3A 3VNRA 2VQFC 3TQIA 3CW8X 1M6XC 4B3SC 4FTFA 3SO4A 2CU6A 3TDEA 4RVNA 4DUZC 1O9TA 3A9UA 4WV3A 2UU9C 3J80D 4OYCA 2DHMA 3FCCA 5E7QA 4JI7C 1KKGA 4DG9A 4RLFA 4I9GA 2YWBA 4BBYA 4LF4C 2CXCA 5IT9D 3PBKA 3A9VA 1XNRC 4OXIA 4DR5C 3LAXA 5H9UA 2E5LC 1P7LA 1N36C 4DG8A 3TR3A 5BURA 4DR4C 4DV5C 2KZ0A 2E0GA 2OPLB 2QVZX 4LF5C 5KYVA 1UWDA 3L8CA 3RV2A
chains in the Genus database with same CATH topology
1ZB9A 3IPLA 3EQ6A 5BSUA 4NXMC 3FCEA 3T1HC 4DR6C 1RY2A 1I94C 2UUCC 3GPCA 4KHPC 4DV7C 3LUSA 1ML8A 3A4IA 3NI2A 5KYTA 4X65C 5GTDA 1FJGC 4DR1C 4RMNA 4EATA 2F4VC 4JI3C 1LCIA 4K0KC 4RM2A 5LMUC 2UXDC 4IR7A 2P2JA 1XNQC 4AQYC 4JM1A 5K85A 1VLAA 4WS9A 4LF9C 1MXAA 5IWAC 2D1TA 2HHHC 4DUYC 4LF8C 3GR0A 1HH2P 4BC7A 3IEUA 1MKYA 2QW0X 3OTOC 5CZVA 1QM4A 2HJGA 3CJEA 5JRHA 3B7WA 1N33C 2P20A 3AF5A 3DLPX 4B3TC 1MDBA 4PZPA 2P2MA 1ZB8A 2KZFA 4I9FA 4D4GA 3C5EA 1IBMC 4JYAC 4X66C 4XX2A 1XRAA 2UUBC 2OO4A 1HNXC 2QL8A 5AE2A 3G7SA 4JI0C 3PROC 2WP0C 2YCBA 2QVYX 4IZ6A 2EGTA 1NYEA 3LNVA 3VNQA 3AF6A 4PHTA 4RLQA 3N54B 3R44A 3TUFA 3GR1A 5AE1A 3EERA 1N34C 3R9WA 3PESA 4YHHC 4GS5A 1HNZC 2ZM6C 1XMOC 1L2FA 4TPSB 1MD9A 4ZJZA 1BA3A 3CW9A 4GXQA 4DR3C 4L7IA 5BUSA 2BH1X 5A1GA 5CZXA 3UOWA 1YJ7A 4G36A 4ODJA 4DV0C 4MH4A 2E8FA 1IBLC 1PA4A 1O90A 2ASBA 1N2FA 1WF3A 1FUGA 2XR1A 2CY1A 2Y4NA 2Y4OA 1USPA 4YY3C 2E8EA 3S82A 2E7GA 5A19A 2P02A 4JI5C 5LMNC 1RG9A 3RG2A 3ETCA 3T1YC 2D1QA 1XRCA 1ULTA 4LFAC 2DPLA 2DYJA 4DCUA 1MXCA 4JI2C 2ONFA 5A1IA 5IFIA 2D1RA 2D7VA 4B3RC 1JOSA 4DCSA 3KXWA 2PROA 3JAMD 4DV1C 2P2FA 4LF6C 4R1MA 4GXRA 3NPDA 1O92A 4DCVA 4DV2C 4GKJC 2PN2A 1HR0C 2UXBC 1WH9A 2P2QA 5T8TA 2VQEC 4U5YD 2D1SA 5BSMA 1MXBA 5BR8C 4LFCC 3L95X 1USPB 1V26A 2E8CA 3IMLA 4G1IA 1IBKC 2AYAA 4JI6C 4JI4C 2ATWA 5FLXD 2PT7G 4RM3A 4R0MA 4MTNA 5BSVA 1XRBA 2OBVA 5ADZA 1LQLA 5K8FA 3E7WA 3VNSA 2YWCA 3LGXA 5AE3A 4NOZA 3NYQA 2V7BA 3NYRA 1UKKA 1QWIA 4DR2C 1T5HX 4RVOA 4D57A 2VZEA 4DV3C 2D27A 4NDNA 5A2QD 4ISBA 3N2QA 3R9XA 4LE5A 3IEVA 5T8SA 4D56A 4PROC 4B3MC 5BSWA 5DV9A 4G37A 2Y27A 2OPLA 1HNWC 3H2TA 4BSZA 1K0RA 4DV6C 1PG4A 5BUQA 3I07A 3DAYA 3DHVA 1AMUA 1XMQC 1PG3A 2VSQA 2UXCC 2D28C 4NXNC 5BSTA 4K0BA 3I08A 4FUQA 4LFBC 4JI1C 4FUTA 4KTTA 3GKUA 3J81D 1V25A 4L2ZA 2WD9A 4LF7C 2UUAC 5BSRA 4DCTA 2P2BA 5KEIA 4JI8C 4DR7C 1N32C 3E7XA 1EGAA 3J7AD 3ETOA 4BC9A 4HPVA 4DV4C 2JMPA 1T5DX 1O93A 4BCAA 2BJOA 4GKKC 4JV5C 4OX9C 4ZLPA 4X62C 4D4IA 1J5EC 1MDFA 2QVXX 3UZ0A 1GPMA 4X64C 4KTVA 4L4QA 4R1LA 3VNRA 2VQFC 3TQIA 3CW8X 4B3SC 4FTFA 3SO4A 3TDEA 4RVNA 4DUZC 1O9TA 3A9UA 4WV3A 2UU9C 3J80D 4OYCA 3FCCA 5E7QA 4JI7C 1KKGA 4DG9A 4RLFA 4I9GA 2YWBA 4BBYA 4LF4C 2CXCA 5IT9D 3PBKA 3A9VA 1XNRC 4OXIA 4DR5C 3LAXA 5H9UA 2E5LC 1P7LA 1N36C 4DG8A 5BURA 4DR4C 4DV5C 2E0GA 2OPLB 2QVZX 4LF5C 5KYVA 3L8CA 3RV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 C;  3EER A;  1N34 C;  3R9W A;  1USP B;  1ZB9 A;  3GKU A;  4YHH C;  3J81 D;  2E8C A;  4NXM C;  1HNZ C;  2ZM6 C;  1XMO C;  1L2F A;  4LF7 C;  2UUA C;  4DCT A;  3T1H C;  1IBK C;  4DR3 C;  4DR6 C;  4JI8 C;  4DR7 C;  1N32 C;  4JI6 C;  1I94 C;  4JI4 C;  2ATW A;  5FLX D;  1EGA A;  2UUC C;  2PT7 G;  4KHP C;  4DV7 C;  3LUS A;  3J7A D;  1ML8 A;  4DV0 C;  4DV4 C;  2JMP A;  4MH4 A;  2E8F A;  4X65 C;  4MTN A;  1IBL C;  1PA4 A;  4DR1 C;  2ASB A;  1FJG C;  1N2F A;  1WF3 A;  2XR1 A;  2F4V C;  2BJO A;  4JI3 C;  1LQL A;  2CY1 A;  4GKK C;  4JV5 C;  4OX9 C;  4K0K C;  5LMU C;  4X62 C;  2UXD C;  1J5E C;  4X64 C;  4NOZ A;  1USP A;  4YY3 C;  1XNQ C;  4AQY C;  1VLA A;  2E8E A;  2E7G A;  4LF9 C;  4JI5 C;  2VQF C;  5LMN C;  5IWA C;  1UKK A;  2HHH C;  4DUY C;  4LF8 C;  1QWI A;  3T1Y C;  4B3S C;  1HH2 P;  3IEU A;  1MKY A;  4DR2 C;  4LFA C;  4DUZ C;  4LFB C;  4DV3 C;  2DYJ A;  4DCU A;  3OTO C;  4JI2 C;  2ONF A;  3CJE A;  2HJG A;  5A2Q D;  2UU9 C;  3J80 D;  1N33 C;  3R9X A;  3AF5 A;  3IEV A;  2D7V A;  4B3R C;  1JOS A;  4DCS A;  4B3T C;  4B3M C;  4JI7 C;  1KKG A;  2OPL A;  1ZB8 A;  3JAM D;  4DV1 C;  1HNW C;  2KZF A;  4BSZ A;  1K0R A;  4DV6 C;  4LF6 C;  1IBM C;  4JYA C;  4X66 C;  4XX2 A;  3I07 A;  4LF4 C;  2UUB C;  2CXC A;  4DCV A;  4DV2 C;  1HNX C;  4GKJ C;  5IT9 D;  2QL8 A;  1XMQ C;  2PN2 A;  1XNR C;  2UXC C;  4DR5 C;  1HR0 C;  2E5L C;  4NXN C;  2UXB C;  1N36 C;  4JI0 C;  2YCB A;  4DR4 C;  1WH9 A;  2EGT A;  4DV5 C;  1NYE A;  2OPL B;  2VQE C;  3AF6 A;  4LF5 C;  5BR8 C;  4LFC C; 
#chains in the Genus database with same CATH topology
 1ZB9 A;  3CQ2 A;  3IPL A;  3EQ6 A;  5BSU A;  4NXM C;  3FCE A;  2NCL A;  3T1H C;  4DR6 C;  1P4E A;  1RY2 A;  1I94 C;  2UUC C;  3GPC A;  4KHP C;  4DV7 C;  3LUS A;  1ML8 A;  2YX1 A;  3A4I A;  3NI2 A;  5KYT A;  4X65 C;  5GTD A;  1FJG C;  4DR1 C;  4RMN A;  4EAT A;  2F4V C;  4JI3 C;  1LCI A;  4K0K C;  4RM2 A;  5LMU C;  2UXD C;  4IR7 A;  2P2J A;  1VEH A;  1XNQ C;  4AQY C;  4JM1 A;  5K85 A;  1VLA A;  4WS9 A;  4LF9 C;  1MXA A;  5IWA C;  2D1T A;  2HHH C;  4DUY C;  4LF8 C;  3GR0 A;  1HH2 P;  4BC7 A;  3IEU A;  1MKY A;  2QW0 X;  2Z51 A;  3CQ3 A;  3OTO C;  5CZV A;  1QM4 A;  2HJG A;  3CJE A;  5JRH A;  3B7W A;  1N33 C;  2P20 A;  3UX2 A;  3AF5 A;  3DLP X;  4B3T C;  1MDB A;  4PZP A;  2P2M A;  1ZB8 A;  2KZF A;  4I9F A;  4D4G A;  3C5E A;  1IBM C;  4JYA C;  4X66 C;  4XX2 A;  1XRA A;  2UUB C;  2OO4 A;  1HNX C;  3UEB A;  2QL8 A;  5AE2 A;  3G7S A;  4JI0 C;  3PRO C;  2WP0 C;  3A26 A;  2YCB A;  2QVY X;  4IZ6 A;  2EGT A;  1NYE A;  3LNV A;  3VNQ A;  1V60 A;  3AF6 A;  4PHT A;  4RLQ A;  3N54 B;  3R44 A;  3TUF A;  3GR1 A;  5AE1 A;  3EER A;  1N34 C;  3R9W A;  3PES A;  1M6X A;  3AY0 A;  4YHH C;  4GS5 A;  1HNZ C;  2ZM6 C;  1XMO C;  1L2F A;  4TPS B;  1MD9 A;  4ZJZ A;  1BA3 A;  3CW9 A;  4GXQ A;  3LNO A;  4DR3 C;  4L7I A;  2JNV A;  1TH5 A;  2MM9 A;  5BUS A;  2BH1 X;  5A1G A;  5CZX A;  3UOW A;  1YJ7 A;  4G36 A;  4ODJ A;  4DV0 C;  4MH4 A;  2E8F A;  1IBL C;  1PA4 A;  1O90 A;  2ASB A;  1N2F A;  1WF3 A;  1FUG A;  2XR1 A;  2ZZN A;  2CY1 A;  2Y4N A;  3UX3 A;  2Y4O A;  1USP A;  4YY3 C;  2E8E A;  3S82 A;  2E7G A;  5A19 A;  2P02 A;  4JI5 C;  5LMN C;  1RG9 A;  3RG2 A;  3ETC A;  3T1Y C;  2D1Q A;  3O2E A;  1XRC A;  1ULT A;  4LFA C;  2DPL A;  4DCU A;  2DYJ A;  1MXC A;  4JI2 C;  2ONF A;  5A1I A;  2ZZM A;  5IFI A;  2M5H A;  2PG1 E;  2D1R A;  2D7V A;  4B3R C;  1JOS A;  4DCS A;  1WCJ A;  3KXW A;  2PRO A;  3JAM D;  4DV1 C;  2P2F A;  4LF6 C;  4R1M A;  4GXR A;  3NPD A;  3CQ1 A;  1O92 A;  4DCV A;  4DV2 C;  4GKJ C;  2PN2 A;  2M5O A;  1HR0 C;  2UXB C;  1WH9 A;  2P2Q A;  5T8T A;  2MCQ A;  2VQE C;  4U5Y D;  2D1S A;  5BSM A;  1MXB A;  5BR8 C;  4LFC C;  3L95 X;  1USP B;  1V26 A;  2E8C A;  3IML A;  4G1I A;  1IBK C;  1IB8 A;  2AYA A;  4JI6 C;  4JI4 C;  2ATW A;  5FLX D;  2PT7 G;  4RM3 A;  4R0M A;  4MTN A;  5BSV A;  1XRB A;  2OBV A;  5ADZ A;  1LQL A;  5K8F A;  1PU1 A;  1NY8 A;  3E7W A;  3VNS A;  2YWC A;  3LGX A;  5AE3 A;  4NOZ A;  3NYQ A;  4PUH A;  2V7B A;  3NYR A;  1YGT A;  1UKK A;  3K6R A;  1QWI A;  2MMA B;  1XHJ A;  5LCI A;  4DR2 C;  1T5H X;  4RVO A;  4D57 A;  2VZE A;  4DV3 C;  2D27 A;  4NDN A;  5A2Q D;  4ISB A;  3N2Q A;  3R9X A;  4LE5 A;  3IEV A;  5T8S A;  4D56 A;  4PRO C;  4B3M C;  5BSW A;  5DV9 A;  4G37 A;  2Y27 A;  2OPL A;  1HNW C;  3H2T A;  4BSZ A;  1K0R A;  4DV6 C;  1PG4 A;  5BUQ A;  3I07 A;  3DAY A;  3DHV A;  1AMU A;  1XMQ C;  1PG3 A;  2VSQ A;  2UXC C;  2D28 C;  4NXN C;  4PUI A;  5BST A;  4K0B A;  3I08 A;  4FUQ A;  2ZTB A;  4LFB C;  4JI1 C;  4FUT A;  4KTT A;  3GKU A;  3J81 D;  1V25 A;  4L2Z A;  3A25 A;  2WD9 A;  4LF7 C;  2UUA C;  5BSR A;  4DCT A;  2P2B A;  5KEI A;  4JI8 C;  4DR7 C;  1N32 C;  3E7X A;  1P4E C;  1XDX A;  1EGA A;  3J7A D;  3ETO A;  4BC9 A;  4HPV A;  4DV4 C;  2JMP A;  1T5D X;  1O93 A;  2KDN A;  4BCA A;  2BJO A;  4GKK C;  4JV5 C;  4PUG A;  4OX9 C;  4ZLP A;  4X62 C;  4D4I A;  1J5E C;  1MDF A;  3FM7 A;  2QVX X;  3UZ0 A;  1GPM A;  1FLO A;  4X64 C;  4KTV A;  4L4Q A;  4R1L A;  1XS3 A;  3VNR A;  2VQF C;  3TQI A;  3CW8 X;  1M6X C;  4B3S C;  4FTF A;  3SO4 A;  2CU6 A;  3TDE A;  4RVN A;  4DUZ C;  1O9T A;  3A9U A;  4WV3 A;  2UU9 C;  3J80 D;  4OYC A;  2DHM A;  3FCC A;  5E7Q A;  4JI7 C;  1KKG A;  4DG9 A;  4RLF A;  4I9G A;  2YWB A;  4BBY A;  4LF4 C;  2CXC A;  5IT9 D;  3PBK A;  3A9V A;  1XNR C;  4OXI A;  4DR5 C;  3LAX A;  5H9U A;  2E5L C;  1P7L A;  1N36 C;  4DG8 A;  3TR3 A;  5BUR A;  4DR4 C;  4DV5 C;  2KZ0 A;  2E0G A;  2OPL B;  2QVZ X;  4LF5 C;  5KYV A;  1UWD A;  3L8C A;  3RV2 A; 
#chains in the Genus database with same CATH homology
 1ZB9 A;  3IPL A;  3EQ6 A;  5BSU A;  4NXM C;  3FCE A;  3T1H C;  4DR6 C;  1RY2 A;  1I94 C;  2UUC C;  3GPC A;  4KHP C;  4DV7 C;  3LUS A;  1ML8 A;  3A4I A;  3NI2 A;  5KYT A;  4X65 C;  5GTD A;  1FJG C;  4DR1 C;  4RMN A;  4EAT A;  2F4V C;  4JI3 C;  1LCI A;  4K0K C;  4RM2 A;  5LMU C;  2UXD C;  4IR7 A;  2P2J A;  1XNQ C;  4AQY C;  4JM1 A;  5K85 A;  1VLA A;  4WS9 A;  4LF9 C;  1MXA A;  5IWA C;  2D1T A;  2HHH C;  4DUY C;  4LF8 C;  3GR0 A;  1HH2 P;  4BC7 A;  3IEU A;  1MKY A;  2QW0 X;  3OTO C;  5CZV A;  1QM4 A;  2HJG A;  3CJE A;  5JRH A;  3B7W A;  1N33 C;  2P20 A;  3AF5 A;  3DLP X;  4B3T C;  1MDB A;  4PZP A;  2P2M A;  1ZB8 A;  2KZF A;  4I9F A;  4D4G A;  3C5E A;  1IBM C;  4JYA C;  4X66 C;  4XX2 A;  1XRA A;  2UUB C;  2OO4 A;  1HNX C;  2QL8 A;  5AE2 A;  3G7S A;  4JI0 C;  3PRO C;  2WP0 C;  2YCB A;  2QVY X;  4IZ6 A;  2EGT A;  1NYE A;  3LNV A;  3VNQ A;  3AF6 A;  4PHT A;  4RLQ A;  3N54 B;  3R44 A;  3TUF A;  3GR1 A;  5AE1 A;  3EER A;  1N34 C;  3R9W A;  3PES A;  4YHH C;  4GS5 A;  1HNZ C;  2ZM6 C;  1XMO C;  1L2F A;  4TPS B;  1MD9 A;  4ZJZ A;  1BA3 A;  3CW9 A;  4GXQ A;  4DR3 C;  4L7I A;  5BUS A;  2BH1 X;  5A1G A;  5CZX A;  3UOW A;  1YJ7 A;  4G36 A;  4ODJ A;  4DV0 C;  4MH4 A;  2E8F A;  1IBL C;  1PA4 A;  1O90 A;  2ASB A;  1N2F A;  1WF3 A;  1FUG A;  2XR1 A;  2CY1 A;  2Y4N A;  2Y4O A;  1USP A;  4YY3 C;  2E8E A;  3S82 A;  2E7G A;  5A19 A;  2P02 A;  4JI5 C;  5LMN C;  1RG9 A;  3RG2 A;  3ETC A;  3T1Y C;  2D1Q A;  1XRC A;  1ULT A;  4LFA C;  2DPL A;  2DYJ A;  4DCU A;  1MXC A;  4JI2 C;  2ONF A;  5A1I A;  5IFI A;  2D1R A;  2D7V A;  4B3R C;  1JOS A;  4DCS A;  3KXW A;  2PRO A;  3JAM D;  4DV1 C;  2P2F A;  4LF6 C;  4R1M A;  4GXR A;  3NPD A;  1O92 A;  4DCV A;  4DV2 C;  4GKJ C;  2PN2 A;  1HR0 C;  2UXB C;  1WH9 A;  2P2Q A;  5T8T A;  2VQE C;  4U5Y D;  2D1S A;  5BSM A;  1MXB A;  5BR8 C;  4LFC C;  3L95 X;  1USP B;  1V26 A;  2E8C A;  3IML A;  4G1I A;  1IBK C;  2AYA A;  4JI6 C;  4JI4 C;  2ATW A;  5FLX D;  2PT7 G;  4RM3 A;  4R0M A;  4MTN A;  5BSV A;  1XRB A;  2OBV A;  5ADZ A;  1LQL A;  5K8F A;  3E7W A;  3VNS A;  2YWC A;  3LGX A;  5AE3 A;  4NOZ A;  3NYQ A;  2V7B A;  3NYR A;  1UKK A;  1QWI A;  4DR2 C;  1T5H X;  4RVO A;  4D57 A;  2VZE A;  4DV3 C;  2D27 A;  4NDN A;  5A2Q D;  4ISB A;  3N2Q A;  3R9X A;  4LE5 A;  3IEV A;  5T8S A;  4D56 A;  4PRO C;  4B3M C;  5BSW A;  5DV9 A;  4G37 A;  2Y27 A;  2OPL A;  1HNW C;  3H2T A;  4BSZ A;  1K0R A;  4DV6 C;  1PG4 A;  5BUQ A;  3I07 A;  3DAY A;  3DHV A;  1AMU A;  1XMQ C;  1PG3 A;  2VSQ A;  2UXC C;  2D28 C;  4NXN C;  5BST A;  4K0B A;  3I08 A;  4FUQ A;  4LFB C;  4JI1 C;  4FUT A;  4KTT A;  3GKU A;  3J81 D;  1V25 A;  4L2Z A;  2WD9 A;  4LF7 C;  2UUA C;  5BSR A;  4DCT A;  2P2B A;  5KEI A;  4JI8 C;  4DR7 C;  1N32 C;  3E7X A;  1EGA A;  3J7A D;  3ETO A;  4BC9 A;  4HPV A;  4DV4 C;  2JMP A;  1T5D X;  1O93 A;  4BCA A;  2BJO A;  4GKK C;  4JV5 C;  4OX9 C;  4ZLP A;  4X62 C;  4D4I A;  1J5E C;  1MDF A;  2QVX X;  3UZ0 A;  1GPM A;  4X64 C;  4KTV A;  4L4Q A;  4R1L A;  3VNR A;  2VQF C;  3TQI A;  3CW8 X;  4B3S C;  4FTF A;  3SO4 A;  3TDE A;  4RVN A;  4DUZ C;  1O9T A;  3A9U A;  4WV3 A;  2UU9 C;  3J80 D;  4OYC A;  3FCC A;  5E7Q A;  4JI7 C;  1KKG A;  4DG9 A;  4RLF A;  4I9G A;  2YWB A;  4BBY A;  4LF4 C;  2CXC A;  5IT9 D;  3PBK A;  3A9V A;  1XNR C;  4OXI A;  4DR5 C;  3LAX A;  5H9U A;  2E5L C;  1P7L A;  1N36 C;  4DG8 A;  5BUR A;  4DR4 C;  4DV5 C;  2E0G A;  2OPL B;  2QVZ X;  4LF5 C;  5KYV A;  3L8C A;  3RV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...