4GKKC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 33
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4gkkC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4gkkC02
1ZB8A 3GKUA 3I07A 2ATWA 2HHHC 4B3TC 4DV7C 3J7AD 4NOZA 1L2FA 1VLAA 1USPA 1ZB9A 4JI4C 4LF4C 1IBKC 2KZFA 4B3RC 1JOSA 2UUBC 4BSZA 4LFCC 4DCUA 4DR6C 1ML8A 4MTNA 4DV0C 4X62C 1J5EC 2QL8A 1EGAA 4DR7C 4DV6C 1PA4A 4JI7C 4NXNC 5BR8C 4YY3C 4X66C 1XMQC 2DYJA 4LF5C 1N32C 2EGTA 1N33C 4DR2C 3R9WA 3IEVA 2PT7G 4B3MC 4DUYC 4DCTA 4DV4C 4LF8C 2HJGA 4LFBC 1K0RA 1XMOC 2F4VC 1N2FA 4LFAC 4K0KC 3JAMD 2E8EA 4JI3C 2OPLB 1UKKA 4DR1C 2JMPA 4MH4A 2E8CA 3AF5A 4GKKC 2UU9C 5A2QD 1IBLC 3EERA 4JYAC 3J81D 3CJEA 4LF7C 2E8FA 4DV2C 2CXCA 2BJOA 1MKYA 4DR3C 3OTOC 1WF3A 4JI5C 4NXMC 2OPLA 4DCVA 2CY1A 3T1HC 2ASBA 3LUSA 4GKJC 4JI8C 4LF6C 2E5LC 1HH2P 4DUZC 5LMNC 1XNQC 1N34C 4XX2A 2VQEC 1QWIA 3IEUA 2ONFA 2UUAC 2VQFC 4DV3C 1I94C 4LF9C 1HNZC 3R9XA 2YCBA 3J80D 3AF6A 1FJGC 2UXCC 1IBMC 1WH9A 2UUCC 5IWAC 1XNRC 4JI6C 2XR1A 1HNWC 4JI2C 4X64C 2UXDC 1NYEA 2PN2A 5IT9D 4X65C 4YHHC 5LMUC 1LQLA 2E7GA 1HNXC 3T1YC 4AQYC 4OX9C 1USPB 5FLXD 4DV1C 1KKGA 4KHPC 4DV5C 1HR0C 1N36C 4JI1C 4DR5C 2ZM6C 4DR4C 2UXBC 4B3SC 2D7VA 4DCSA 4JI0C 4JV5C
chains in the Genus database with same CATH superfamily
1M6XC 2HHHC 4DV7C 1TH5A 3DLPX 3TDEA 3H2TA 3PBKA 1P7LA 4G1IA 1RG9A 4BSZA 4DCUA 3E7XA 4ODJA 4DV0C 2QL8A 4DV6C 4GXQA 3GR1A 4NXNC 4R0MA 3GPCA 1XMQC 1N33C 5BSVA 5KEIA 2D1TA 1MXAA 2HJGA 2OBVA 3IPLA 3SO4A 1XMOC 3N54B 2F4VC 1O92A 5BSUA 4IZ6A 1UKKA 4DR1C 3PROC 4MH4A 2E8CA 4GKKC 5A2QD 3K6RA 2VZEA 4RVNA 5KYTA 4NDNA 4WV3A 4G36A 1YJ7A 2BJOA 1MKYA 2QW0X 4JI5C 5E7QA 4DCVA 4I9GA 3T1HC 3LUSA 5CZVA 4JI8C 4LF6C 2E5LC 1IB8A 4RVOA 5LMNC 4FUQA 5BUQA 3NPDA 2WD9A 5KYVA 2ZZMA 1HNZC 3L8CA 3AF6A 1WH9A 5IWAC 5BSRA 2QVZX 3KXWA 2UXDC 2DHMA 4YHHC 5LMUC 1WCJA 5K8FA 1FUGA 4R1MA 4KHPC 5BUSA 4DR5C 2ZM6C 1VEHA 4DR4C 1PU1A 4JV5C 2M5OA 3CQ2A 5A1IA 2ATWA 1QM4A 3RV2A 4B3TC 5AE1A 2E0GA 4RLQA 1L2FA 4L4QA 2D1SA 1JOSA 3A9UA 2DPLA 4PHTA 4LFCC 2QVXX 2V7BA 4PUIA 4X62C 1J5EC 4DR7C 2NCLA 5BR8C 4FUTA 4LF5C 2EGTA 1XHJA 5LCIA 2PT7G 4B3MC 4LF8C 5ADZA 1MDFA 1N2FA 4RM2A 4LFAC 4K0KC 3JAMD 4I9FA 1LCIA 1V26A 2UU9C 3LNVA 1NY8A 1O93A 3VNSA 4JM1A 3UEBA 4JYAC 3I08A 3FM7A 3CJEA 1ULTA 2CU6A 1O9TA 4LF7C 3NYRA 2Y27A 1V60A 4BBYA 2CXCA 3E7WA 4D4IA 1M6XA 4K0BA 3B7WA 1P4EC 1WF3A 4KTTA 4L7IA 2ASBA 2YWCA 1XNQC 1GPMA 4XX2A 3N2QA 1QWIA 3IEUA 2VQFC 3FCCA 1I94C 3J80D 3VNRA 3A25A 4DG8A 3ETOA 2XR1A 2D1QA 1HNWC 1FLOA 3LAXA 1BA3A 4JI2C 1NYEA 4OYCA 5IT9D 2E7GA 5T8SA 3T1YC 4AQYC 2PROA 1KKGA 1MDBA 4DV5C 5T8TA 4B3SC 2P2FA 2M5HA 1T5HX 4DCSA 4KTVA 3GKUA 2BH1X 3G7SA 5IFIA 3UX2A 1VLAA 1ZB9A 4BCAA 4LF4C 2KZFA 2UUBC 5AE2A 1ML8A 4MTNA 5BSWA 2D27A 1EGAA 4ISBA 1PA4A 4JI7C 4PUHA 3DHVA 4YY3C 3PESA 2YWBA 1P4EA 4HPVA 5H9UA 2DYJA 2ZTBA 5BSTA 1XDXA 4DR2C 3R9WA 4ZJZA 3TUFA 4DUYC 4DV4C 2D1RA 4RMNA 3CW9A 3RG2A 3UOWA 1PG3A 5BURA 1YGTA 2E8EA 3A26A 4JI3C 4BC7A 4DG9A 3AF5A 1AMUA 3IMLA 1XRAA 3EERA 4FTFA 3J81D 4L2ZA 4OXIA 2E8FA 2MCQA 1XRCA 2MM9A 4DR3C 3OTOC 3CW8X 5DV9A 5CZXA 2CY1A 4PUGA 3UX3A 3UZ0A 3A9VA 1N34C 2JNVA 2ONFA 4RM3A 2UUAC 4DV3C 2KZ0A 4LF9C 2UXCC 5JRHA 2UUCC 2QVYX 2Y4OA 3VNQA 3CQ3A 4X64C 4JI0C 4X65C 1MXCA 3ETCA 1LQLA 2D28C 5FLXD 4RLFA 4DV1C 5K85A 4LE5A 1N36C 4JI1C 3LNOA 2MMAB 2D7VA 2P2BA 1ZB8A 3NI2A 3I07A 1V25A 3J7AD 2VSQA 4BC9A 4NOZA 1USPA 2Z51A 2OO4A 4D57A 1IBKC 1RY2A 4B3RC 4TPSB 2WP0C 4DR6C 3TQIA 2PG1E 4PZPA 4X66C 3DAYA 4R1LA 3EQ6A 2AYAA 4IR7A 1N32C 3IEVA 3AY0A 5BSMA 4DCTA 4LFBC 1K0RA 3FCEA 1MD9A 4WS9A 2ZZNA 2OPLB 2JMPA 4U5YD 4D4GA 4PROC 2P2JA 4GXRA 1IBLC 4GS5A 2P2QA 1UWDA 4D56A 4DV2C 1PG4A 4NXMC 2OPLA 5A19A 4GKJC 1HH2P 4DUZC 3GR0A 3CQ1A 2P02A 2VQEC 3R44A 2Y4NA 5A1GA 3C5EA 3R9XA 1FJGC 2YCBA 1IBMC 1XS3A 1MXBA 1O90A 3L95X 1XNRC 2YX1A 3O2EA 4JI6C 3S82A 3TR3A 4G37A 2PN2A 5GTDA 3LGXA 1HNXC 4EATA 4OX9C 2KDNA 1USPB 5AE3A 2P2MA 1T5DX 1HR0C 1XRBA 4ZLPA 3NYQA 2UXBC 3A4IA 4JI4C 2P20A
chains in the Genus database with same CATH topology
2HHHC 4DV7C 3DLPX 3TDEA 3H2TA 3PBKA 1P7LA 4G1IA 1RG9A 4BSZA 4DCUA 3E7XA 4ODJA 4DV0C 2QL8A 4DV6C 4GXQA 3GR1A 4NXNC 4R0MA 1XMQC 3GPCA 1N33C 5BSVA 5KEIA 2D1TA 1MXAA 2HJGA 2OBVA 3IPLA 3SO4A 1XMOC 3N54B 2F4VC 1O92A 5BSUA 4IZ6A 1UKKA 4DR1C 3PROC 4MH4A 2E8CA 4GKKC 5A2QD 2VZEA 4RVNA 5KYTA 4NDNA 4WV3A 4G36A 1YJ7A 2BJOA 1MKYA 2QW0X 4JI5C 5E7QA 4DCVA 4I9GA 3T1HC 3LUSA 5CZVA 4JI8C 4LF6C 2E5LC 4RVOA 5LMNC 4FUQA 5BUQA 3NPDA 2WD9A 5KYVA 1HNZC 3L8CA 3AF6A 1WH9A 5IWAC 5BSRA 2QVZX 3KXWA 2UXDC 4YHHC 5LMUC 5K8FA 1FUGA 4R1MA 4KHPC 5BUSA 4DR5C 2ZM6C 4DR4C 4JV5C 5A1IA 2ATWA 1QM4A 3RV2A 4B3TC 5AE1A 2E0GA 4RLQA 1L2FA 4L4QA 2D1SA 1JOSA 3A9UA 2DPLA 4PHTA 4LFCC 2QVXX 2V7BA 4X62C 1J5EC 4DR7C 5BR8C 4FUTA 4LF5C 2EGTA 2PT7G 4B3MC 4LF8C 5ADZA 1MDFA 1N2FA 4RM2A 4LFAC 4K0KC 3JAMD 4I9FA 1LCIA 1V26A 2UU9C 3LNVA 1O93A 3VNSA 4JM1A 4JYAC 3I08A 3CJEA 1ULTA 1O9TA 4LF7C 3NYRA 2Y27A 4BBYA 2CXCA 3E7WA 4D4IA 4K0BA 3B7WA 1WF3A 4KTTA 4L7IA 2ASBA 2YWCA 1XNQC 1GPMA 4XX2A 3N2QA 1QWIA 3IEUA 2VQFC 3FCCA 1I94C 3J80D 3VNRA 4DG8A 3ETOA 2XR1A 2D1QA 1HNWC 3LAXA 1BA3A 4JI2C 1NYEA 4OYCA 5IT9D 2E7GA 5T8SA 3T1YC 4AQYC 2PROA 1KKGA 1MDBA 4DV5C 5T8TA 4B3SC 2P2FA 1T5HX 4DCSA 4KTVA 3GKUA 2BH1X 3G7SA 5IFIA 1VLAA 1ZB9A 4BCAA 4LF4C 2KZFA 2UUBC 5AE2A 1ML8A 4MTNA 5BSWA 2D27A 1EGAA 4ISBA 1PA4A 4JI7C 3DHVA 4YY3C 3PESA 2YWBA 4HPVA 5H9UA 2DYJA 5BSTA 4DR2C 3R9WA 4ZJZA 3TUFA 4DUYC 4DV4C 2D1RA 4RMNA 3CW9A 3RG2A 3UOWA 1PG3A 5BURA 2E8EA 4JI3C 4BC7A 4DG9A 3AF5A 1AMUA 3IMLA 1XRAA 3EERA 4FTFA 3J81D 4L2ZA 4OXIA 2E8FA 1XRCA 4DR3C 3OTOC 3CW8X 5DV9A 5CZXA 2CY1A 3UZ0A 3A9VA 1N34C 2ONFA 4RM3A 2UUAC 4DV3C 4LF9C 2UXCC 5JRHA 2UUCC 2QVYX 2Y4OA 3VNQA 4X64C 4JI0C 4X65C 1MXCA 3ETCA 1LQLA 2D28C 5FLXD 4RLFA 4DV1C 5K85A 4LE5A 1N36C 4JI1C 2D7VA 2P2BA 1ZB8A 3NI2A 3I07A 1V25A 3J7AD 2VSQA 4BC9A 4NOZA 1USPA 2OO4A 4D57A 1IBKC 1RY2A 4B3RC 4TPSB 2WP0C 4DR6C 3TQIA 4PZPA 4X66C 3DAYA 4R1LA 3EQ6A 2AYAA 4IR7A 1N32C 3IEVA 5BSMA 4DCTA 4LFBC 1K0RA 1MD9A 3FCEA 4WS9A 2OPLB 2JMPA 4U5YD 4D4GA 4PROC 2P2JA 4GXRA 1IBLC 4GS5A 2P2QA 4D56A 4DV2C 1PG4A 4NXMC 2OPLA 5A19A 4GKJC 1HH2P 4DUZC 3GR0A 2P02A 2VQEC 3R44A 2Y4NA 5A1GA 3C5EA 3R9XA 1FJGC 2YCBA 1IBMC 1MXBA 1O90A 3L95X 1XNRC 4JI6C 3S82A 4G37A 2PN2A 5GTDA 3LGXA 1HNXC 4EATA 4OX9C 5AE3A 1USPB 2P2MA 1T5DX 1HR0C 1XRBA 4ZLPA 3NYQA 2UXBC 3A4IA 4JI4C 2P20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZB8 A;  3GKU A;  3I07 A;  2ATW A;  2HHH C;  4B3T C;  4DV7 C;  3J7A D;  4NOZ A;  1L2F A;  1VLA A;  1USP A;  1ZB9 A;  4JI4 C;  4LF4 C;  1IBK C;  2KZF A;  4B3R C;  1JOS A;  2UUB C;  4BSZ A;  4LFC C;  4DCU A;  4DR6 C;  1ML8 A;  4MTN A;  4DV0 C;  4X62 C;  1J5E C;  2QL8 A;  1EGA A;  4DR7 C;  4DV6 C;  1PA4 A;  4JI7 C;  4NXN C;  5BR8 C;  4YY3 C;  4X66 C;  1XMQ C;  2DYJ A;  4LF5 C;  1N32 C;  2EGT A;  1N33 C;  4DR2 C;  3R9W A;  3IEV A;  2PT7 G;  4B3M C;  4DUY C;  4DCT A;  4DV4 C;  4LF8 C;  2HJG A;  4LFB C;  1K0R A;  1XMO C;  2F4V C;  1N2F A;  4LFA C;  4K0K C;  3JAM D;  2E8E A;  4JI3 C;  2OPL B;  1UKK A;  4DR1 C;  2JMP A;  4MH4 A;  2E8C A;  3AF5 A;  4GKK C;  2UU9 C;  5A2Q D;  1IBL C;  3EER A;  4JYA C;  3J81 D;  3CJE A;  4LF7 C;  2E8F A;  4DV2 C;  2CXC A;  2BJO A;  1MKY A;  4DR3 C;  3OTO C;  1WF3 A;  4JI5 C;  4NXM C;  2OPL A;  4DCV A;  2CY1 A;  3T1H C;  2ASB A;  3LUS A;  4GKJ C;  4JI8 C;  4LF6 C;  2E5L C;  1HH2 P;  4DUZ C;  5LMN C;  1XNQ C;  1N34 C;  4XX2 A;  2VQE C;  1QWI A;  3IEU A;  2ONF A;  2UUA C;  2VQF C;  4DV3 C;  1I94 C;  4LF9 C;  1HNZ C;  3R9X A;  2YCB A;  3J80 D;  3AF6 A;  1FJG C;  2UXC C;  1IBM C;  1WH9 A;  2UUC C;  5IWA C;  1XNR C;  4JI6 C;  2XR1 A;  1HNW C;  4JI2 C;  4X64 C;  2UXD C;  1NYE A;  2PN2 A;  5IT9 D;  4X65 C;  4YHH C;  5LMU C;  1LQL A;  2E7G A;  1HNX C;  3T1Y C;  4AQY C;  4OX9 C;  1USP B;  5FLX D;  4DV1 C;  1KKG A;  4KHP C;  4DV5 C;  1HR0 C;  1N36 C;  4JI1 C;  4DR5 C;  2ZM6 C;  4DR4 C;  2UXB C;  4B3S C;  2D7V A;  4DCS A;  4JI0 C;  4JV5 C; 
#chains in the Genus database with same CATH topology
 1M6X C;  2HHH C;  4DV7 C;  1TH5 A;  3DLP X;  3TDE A;  3H2T A;  3PBK A;  1P7L A;  4G1I A;  1RG9 A;  4BSZ A;  4DCU A;  3E7X A;  4ODJ A;  4DV0 C;  2QL8 A;  4DV6 C;  4GXQ A;  3GR1 A;  4NXN C;  4R0M A;  3GPC A;  1XMQ C;  1N33 C;  5BSV A;  5KEI A;  2D1T A;  1MXA A;  2HJG A;  2OBV A;  3IPL A;  3SO4 A;  1XMO C;  3N54 B;  2F4V C;  1O92 A;  5BSU A;  4IZ6 A;  1UKK A;  4DR1 C;  3PRO C;  4MH4 A;  2E8C A;  4GKK C;  5A2Q D;  3K6R A;  2VZE A;  4RVN A;  5KYT A;  4NDN A;  4WV3 A;  4G36 A;  1YJ7 A;  2BJO A;  1MKY A;  2QW0 X;  4JI5 C;  5E7Q A;  4DCV A;  4I9G A;  3T1H C;  3LUS A;  5CZV A;  4JI8 C;  4LF6 C;  2E5L C;  1IB8 A;  4RVO A;  5LMN C;  4FUQ A;  5BUQ A;  3NPD A;  2WD9 A;  5KYV A;  2ZZM A;  1HNZ C;  3L8C A;  3AF6 A;  1WH9 A;  5IWA C;  5BSR A;  2QVZ X;  3KXW A;  2UXD C;  2DHM A;  4YHH C;  5LMU C;  1WCJ A;  5K8F A;  1FUG A;  4R1M A;  4KHP C;  5BUS A;  4DR5 C;  2ZM6 C;  1VEH A;  4DR4 C;  1PU1 A;  4JV5 C;  2M5O A;  3CQ2 A;  5A1I A;  2ATW A;  1QM4 A;  3RV2 A;  4B3T C;  5AE1 A;  2E0G A;  4RLQ A;  1L2F A;  4L4Q A;  2D1S A;  1JOS A;  3A9U A;  2DPL A;  4PHT A;  4LFC C;  2QVX X;  2V7B A;  4PUI A;  4X62 C;  1J5E C;  4DR7 C;  2NCL A;  5BR8 C;  4FUT A;  4LF5 C;  2EGT A;  1XHJ A;  5LCI A;  2PT7 G;  4B3M C;  4LF8 C;  5ADZ A;  1MDF A;  1N2F A;  4RM2 A;  4LFA C;  4K0K C;  3JAM D;  4I9F A;  1LCI A;  1V26 A;  2UU9 C;  3LNV A;  1NY8 A;  1O93 A;  3VNS A;  4JM1 A;  3UEB A;  4JYA C;  3I08 A;  3FM7 A;  3CJE A;  1ULT A;  2CU6 A;  1O9T A;  4LF7 C;  3NYR A;  2Y27 A;  1V60 A;  4BBY A;  2CXC A;  3E7W A;  4D4I A;  1M6X A;  4K0B A;  3B7W A;  1P4E C;  1WF3 A;  4KTT A;  4L7I A;  2ASB A;  2YWC A;  1XNQ C;  1GPM A;  4XX2 A;  3N2Q A;  1QWI A;  3IEU A;  2VQF C;  3FCC A;  1I94 C;  3J80 D;  3VNR A;  3A25 A;  4DG8 A;  3ETO A;  2XR1 A;  2D1Q A;  1HNW C;  1FLO A;  3LAX A;  1BA3 A;  4JI2 C;  1NYE A;  4OYC A;  5IT9 D;  2E7G A;  5T8S A;  3T1Y C;  4AQY C;  2PRO A;  1KKG A;  1MDB A;  4DV5 C;  5T8T A;  4B3S C;  2P2F A;  2M5H A;  1T5H X;  4DCS A;  4KTV A;  3GKU A;  2BH1 X;  3G7S A;  5IFI A;  3UX2 A;  1VLA A;  1ZB9 A;  4BCA A;  4LF4 C;  2KZF A;  2UUB C;  5AE2 A;  1ML8 A;  4MTN A;  5BSW A;  2D27 A;  1EGA A;  4ISB A;  1PA4 A;  4JI7 C;  4PUH A;  3DHV A;  4YY3 C;  3PES A;  2YWB A;  1P4E A;  4HPV A;  5H9U A;  2DYJ A;  2ZTB A;  5BST A;  1XDX A;  4DR2 C;  3R9W A;  4ZJZ A;  3TUF A;  4DUY C;  4DV4 C;  2D1R A;  4RMN A;  3CW9 A;  3RG2 A;  3UOW A;  1PG3 A;  5BUR A;  1YGT A;  2E8E A;  3A26 A;  4JI3 C;  4BC7 A;  4DG9 A;  3AF5 A;  1AMU A;  3IML A;  1XRA A;  3EER A;  4FTF A;  3J81 D;  4L2Z A;  4OXI A;  2E8F A;  2MCQ A;  1XRC A;  2MM9 A;  4DR3 C;  3OTO C;  3CW8 X;  5DV9 A;  5CZX A;  2CY1 A;  4PUG A;  3UX3 A;  3UZ0 A;  3A9V A;  1N34 C;  2JNV A;  2ONF A;  4RM3 A;  2UUA C;  4DV3 C;  2KZ0 A;  4LF9 C;  2UXC C;  5JRH A;  2UUC C;  2QVY X;  2Y4O A;  3VNQ A;  3CQ3 A;  4X64 C;  4JI0 C;  4X65 C;  1MXC A;  3ETC A;  1LQL A;  2D28 C;  5FLX D;  4RLF A;  4DV1 C;  5K85 A;  4LE5 A;  1N36 C;  4JI1 C;  3LNO A;  2MMA B;  2D7V A;  2P2B A;  1ZB8 A;  3NI2 A;  3I07 A;  1V25 A;  3J7A D;  2VSQ A;  4BC9 A;  4NOZ A;  1USP A;  2Z51 A;  2OO4 A;  4D57 A;  1IBK C;  1RY2 A;  4B3R C;  4TPS B;  2WP0 C;  4DR6 C;  3TQI A;  2PG1 E;  4PZP A;  4X66 C;  3DAY A;  4R1L A;  3EQ6 A;  2AYA A;  4IR7 A;  1N32 C;  3IEV A;  3AY0 A;  5BSM A;  4DCT A;  4LFB C;  1K0R A;  3FCE A;  1MD9 A;  4WS9 A;  2ZZN A;  2OPL B;  2JMP A;  4U5Y D;  4D4G A;  4PRO C;  2P2J A;  4GXR A;  1IBL C;  4GS5 A;  2P2Q A;  1UWD A;  4D56 A;  4DV2 C;  1PG4 A;  4NXM C;  2OPL A;  5A19 A;  4GKJ C;  1HH2 P;  4DUZ C;  3GR0 A;  3CQ1 A;  2P02 A;  2VQE C;  3R44 A;  2Y4N A;  5A1G A;  3C5E A;  3R9X A;  1FJG C;  2YCB A;  1IBM C;  1XS3 A;  1MXB A;  1O90 A;  3L95 X;  1XNR C;  2YX1 A;  3O2E A;  4JI6 C;  3S82 A;  3TR3 A;  4G37 A;  2PN2 A;  5GTD A;  3LGX A;  1HNX C;  4EAT A;  4OX9 C;  2KDN A;  1USP B;  5AE3 A;  2P2M A;  1T5D X;  1HR0 C;  1XRB A;  4ZLP A;  3NYQ A;  2UXB C;  3A4I A;  4JI4 C;  2P20 A; 
#chains in the Genus database with same CATH homology
 2HHH C;  4DV7 C;  3DLP X;  3TDE A;  3H2T A;  3PBK A;  1P7L A;  4G1I A;  1RG9 A;  4BSZ A;  4DCU A;  3E7X A;  4ODJ A;  4DV0 C;  2QL8 A;  4DV6 C;  4GXQ A;  3GR1 A;  4NXN C;  4R0M A;  1XMQ C;  3GPC A;  1N33 C;  5BSV A;  5KEI A;  2D1T A;  1MXA A;  2HJG A;  2OBV A;  3IPL A;  3SO4 A;  1XMO C;  3N54 B;  2F4V C;  1O92 A;  5BSU A;  4IZ6 A;  1UKK A;  4DR1 C;  3PRO C;  4MH4 A;  2E8C A;  4GKK C;  5A2Q D;  2VZE A;  4RVN A;  5KYT A;  4NDN A;  4WV3 A;  4G36 A;  1YJ7 A;  2BJO A;  1MKY A;  2QW0 X;  4JI5 C;  5E7Q A;  4DCV A;  4I9G A;  3T1H C;  3LUS A;  5CZV A;  4JI8 C;  4LF6 C;  2E5L C;  4RVO A;  5LMN C;  4FUQ A;  5BUQ A;  3NPD A;  2WD9 A;  5KYV A;  1HNZ C;  3L8C A;  3AF6 A;  1WH9 A;  5IWA C;  5BSR A;  2QVZ X;  3KXW A;  2UXD C;  4YHH C;  5LMU C;  5K8F A;  1FUG A;  4R1M A;  4KHP C;  5BUS A;  4DR5 C;  2ZM6 C;  4DR4 C;  4JV5 C;  5A1I A;  2ATW A;  1QM4 A;  3RV2 A;  4B3T C;  5AE1 A;  2E0G A;  4RLQ A;  1L2F A;  4L4Q A;  2D1S A;  1JOS A;  3A9U A;  2DPL A;  4PHT A;  4LFC C;  2QVX X;  2V7B A;  4X62 C;  1J5E C;  4DR7 C;  5BR8 C;  4FUT A;  4LF5 C;  2EGT A;  2PT7 G;  4B3M C;  4LF8 C;  5ADZ A;  1MDF A;  1N2F A;  4RM2 A;  4LFA C;  4K0K C;  3JAM D;  4I9F A;  1LCI A;  1V26 A;  2UU9 C;  3LNV A;  1O93 A;  3VNS A;  4JM1 A;  4JYA C;  3I08 A;  3CJE A;  1ULT A;  1O9T A;  4LF7 C;  3NYR A;  2Y27 A;  4BBY A;  2CXC A;  3E7W A;  4D4I A;  4K0B A;  3B7W A;  1WF3 A;  4KTT A;  4L7I A;  2ASB A;  2YWC A;  1XNQ C;  1GPM A;  4XX2 A;  3N2Q A;  1QWI A;  3IEU A;  2VQF C;  3FCC A;  1I94 C;  3J80 D;  3VNR A;  4DG8 A;  3ETO A;  2XR1 A;  2D1Q A;  1HNW C;  3LAX A;  1BA3 A;  4JI2 C;  1NYE A;  4OYC A;  5IT9 D;  2E7G A;  5T8S A;  3T1Y C;  4AQY C;  2PRO A;  1KKG A;  1MDB A;  4DV5 C;  5T8T A;  4B3S C;  2P2F A;  1T5H X;  4DCS A;  4KTV A;  3GKU A;  2BH1 X;  3G7S A;  5IFI A;  1VLA A;  1ZB9 A;  4BCA A;  4LF4 C;  2KZF A;  2UUB C;  5AE2 A;  1ML8 A;  4MTN A;  5BSW A;  2D27 A;  1EGA A;  4ISB A;  1PA4 A;  4JI7 C;  3DHV A;  4YY3 C;  3PES A;  2YWB A;  4HPV A;  5H9U A;  2DYJ A;  5BST A;  4DR2 C;  3R9W A;  4ZJZ A;  3TUF A;  4DUY C;  4DV4 C;  2D1R A;  4RMN A;  3CW9 A;  3RG2 A;  3UOW A;  1PG3 A;  5BUR A;  2E8E A;  4JI3 C;  4BC7 A;  4DG9 A;  3AF5 A;  1AMU A;  3IML A;  1XRA A;  3EER A;  4FTF A;  3J81 D;  4L2Z A;  4OXI A;  2E8F A;  1XRC A;  4DR3 C;  3OTO C;  3CW8 X;  5DV9 A;  5CZX A;  2CY1 A;  3UZ0 A;  3A9V A;  1N34 C;  2ONF A;  4RM3 A;  2UUA C;  4DV3 C;  4LF9 C;  2UXC C;  5JRH A;  2UUC C;  2QVY X;  2Y4O A;  3VNQ A;  4X64 C;  4JI0 C;  4X65 C;  1MXC A;  3ETC A;  1LQL A;  2D28 C;  5FLX D;  4RLF A;  4DV1 C;  5K85 A;  4LE5 A;  1N36 C;  4JI1 C;  2D7V A;  2P2B A;  1ZB8 A;  3NI2 A;  3I07 A;  1V25 A;  3J7A D;  2VSQ A;  4BC9 A;  4NOZ A;  1USP A;  2OO4 A;  4D57 A;  1IBK C;  1RY2 A;  4B3R C;  4TPS B;  2WP0 C;  4DR6 C;  3TQI A;  4PZP A;  4X66 C;  3DAY A;  4R1L A;  3EQ6 A;  2AYA A;  4IR7 A;  1N32 C;  3IEV A;  5BSM A;  4DCT A;  4LFB C;  1K0R A;  1MD9 A;  3FCE A;  4WS9 A;  2OPL B;  2JMP A;  4U5Y D;  4D4G A;  4PRO C;  2P2J A;  4GXR A;  1IBL C;  4GS5 A;  2P2Q A;  4D56 A;  4DV2 C;  1PG4 A;  4NXM C;  2OPL A;  5A19 A;  4GKJ C;  1HH2 P;  4DUZ C;  3GR0 A;  2P02 A;  2VQE C;  3R44 A;  2Y4N A;  5A1G A;  3C5E A;  3R9X A;  1FJG C;  2YCB A;  1IBM C;  1MXB A;  1O90 A;  3L95 X;  1XNR C;  4JI6 C;  3S82 A;  4G37 A;  2PN2 A;  5GTD A;  3LGX A;  1HNX C;  4EAT A;  4OX9 C;  5AE3 A;  1USP B;  2P2M A;  1T5D X;  1HR0 C;  1XRB A;  4ZLP A;  3NYQ A;  2UXB C;  3A4I A;  4JI4 C;  2P20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...