4GKKC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4gkkC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4gkkC02
4XX2A 3EERA 4YY3C 3J81D 2E5LC 2UXDC 4DCSA 4DV2C 2UUBC 1XMOC 1XNQC 1N33C 2ONFA 2ZM6C 4LFCC 1VLAA 3GKUA 3IEVA 1N36C 2UXCC 1ZB9A 4B3SC 4LF9C 5LMUC 4GKKC 4LF7C 2KZFA 4YHHC 2UXBC 2CXCA 3OTOC 1EGAA 3LUSA 4DV4C 4JI5C 4DCVA 2ATWA 1K0RA 3CJEA 4GKJC 4DUYC 2UU9C 2JMPA 3JAMD 2E7GA 3AF6A 1HH2P 2DYJA 4X62C 1IBLC 4DV5C 4LFAC 2XR1A 5FLXD 4DR2C 1N2FA 1J5EC 4NXNC 4DR5C 5IWAC 4LF4C 4B3RC 2VQFC 1LQLA 4MTNA 1QWIA 4LFBC 1IBMC 4DR3C 5BR8C 4JI6C 4DUZC 2E8CA 1USPB 3R9XA 4DR4C 4JV5C 4DCUA 2HJGA 4DV7C 1KKGA 4DV0C 4DV6C 2PN2A 5A2QD 2CY1A 1UKKA 4JI7C 4B3MC 4LF8C 4JI8C 1JOSA 4JI1C 4DV1C 2UUAC 1FJGC 4OX9C 2PT7G 2EGTA 5IT9D 1WF3A 4MH4A 3R9WA 1NYEA 1L2FA 2E8FA 4JI3C 1N32C 4NXMC 1HNXC 1USPA 3AF5A 3T1HC 4X66C 4KHPC 3T1YC 4K0KC 4NOZA 4DCTA 3IEUA 4DR6C 4BSZA 4JI0C 2BJOA 3I07A 4JI2C 1XMQC 2UUCC 2YCBA 4X64C 1N34C 1WH9A 2QL8A 2E8EA 4DV3C 3J7AD 2VQEC 5LMNC 4JI4C 4JYAC 4AQYC 2ASBA 4X65C 2D7VA 1HNZC 1HR0C 4LF6C 2OPLB 2OPLA 1I94C 1XNRC 1HNWC 4LF5C 1MKYA 1IBKC 4DR7C 2HHHC 4B3TC 1ZB8A 1ML8A 2F4VC 1PA4A 4DR1C 3J80D
chains in the Genus database with same CATH superfamily
3NI2A 2WP0C 3EERA 2ZZNA 4DCSA 4DV2C 1XNQC 2ONFA 4NDNA 1NY8A 2ZM6C 4LFCC 3IEVA 3ETOA 3A9UA 3R44A 3N2QA 4ZLPA 1T5DX 4GKKC 3A9VA 1XRAA 4G36A 5BSVA 2CXCA 2QVZX 1BA3A 4JI5C 4DCVA 2ATWA 4DUYC 2E7GA 2KZ0A 1HH2P 4X62C 2JNVA 4DV5C 4LFAC 4RMNA 1J5EC 4DR2C 1N2FA 4I9FA 4NXNC 3J80D 5T8TA 2VQFC 4FTFA 4BC7A 2KDNA 1ULTA 4DR3C 4DUZC 4DCUA 1XDXA 1XHJA 4ISBA 2CY1A 1T5HX 5JRHA 5A1GA 1JOSA 2DHMA 2WD9A 5CZXA 5BSMA 1M6XC 3LGXA 4MH4A 1RG9A 2Y4OA 4PROC 1HNXC 4X66C 4KHPC 4L2ZA 3IEUA 4BSZA 4JI0C 2D1SA 2MMAB 4K0BA 4JI2C 2UUCC 2D27A 4DV3C 3J7AD 4JYAC 3VNRA 1V60A 2OPLB 2M5HA 1I94C 1XNRC 3NYQA 1P4EC 2HHHC 1YJ7A 1ML8A 2VZEA 1PG3A 4DR1C 2YWCA 1N33C 1VLAA 5T8SA 1N36C 4FUTA 3G7SA 4B3SC 1WCJA 4DG9A 4LF7C 2KZFA 4BBYA 3CQ1A 2NCLA 4L4QA 3OTOC 2P02A 1EGAA 1VEHA 4D56A 2YX1A 3JAMD 4GS5A 2QVXX 5BSTA 3TDEA 2DYJA 3IMLA 2PG1E 2P2JA 1IBLC 5BUSA 4G1IA 3UEBA 4LF4C 5IFIA 3CQ2A 5BR8C 4JI6C 4JV5C 2HJGA 3RG2A 4DV7C 1KKGA 4DV0C 4DV6C 3NPDA 2Y4NA 1LCIA 2DPLA 2QVYX 2MM9A 5BSUA 4WV3A 5BSWA 3UX2A 2UUAC 1FJGC 4PHTA 5IT9D 1WF3A 4IZ6A 2P2FA 3R9WA 1NYEA 4RM2A 2P2QA 4IR7A 3UOWA 3T1YC 4K0KC 4DCTA 1O92A 1MXCA 2YCBA 1O93A 2E8EA 2P2BA 2VQEC 4JM1A 4FUQA 3ETCA 4RVOA 4HPVA 4X65C 2D7VA 1HNZC 4LF6C 4U5YD 1HNWC 1IBKC 4L7IA 4GXQA 4D4GA 3I08A 4XX2A 4YY3C 3J81D 2V7BA 2E5LC 3GR0A 4PUGA 3TUFA 1XMOC 2D1QA 5AE2A 3LNOA 5H9UA 3GKUA 4D4IA 3DAYA 5BUQA 2D28C 5LMUC 4LF9C 3E7XA 4YHHC 2UXBC 3H2TA 1XRCA 3PROC 3LUSA 4DV4C 1M6XA 4GKJC 2JMPA 1GPMA 3DLPX 1QM4A 2OO4A 3K6RA 2QW0X 1MXBA 3UZ0A 2XR1A 2AYAA 5IWAC 1PU1A 4B3RC 3VNQA 3FM7A 1LQLA 5AE3A 1V26A 4MTNA 1QWIA 5CZVA 1IBMC 3E7WA 4DR4C 3C5EA 4R0MA 2BH1X 2PN2A 3EQ6A 5A2QD 1UKKA 3LNVA 5BURA 2Y27A 3FCCA 4LF8C 4JI8C 4JI1C 4OXIA 2D1TA 4DV1C 1P4EA 4OX9C 2PT7G 2P20A 3A26A 1L2FA 2E8FA 2YWBA 4JI3C 3A25A 1USPA 3T1HC 5DV9A 1XS3A 1AMUA 5AE1A 3VNSA 1P7LA 4D57A 4X64C 1N34C 1MXAA 2QL8A 3A4IA 3UX3A 2MCQA 1IB8A 3O2EA 3KXWA 4AQYC 2ASBA 5ADZA 1HR0C 4BC9A 2OPLA 5KEIA 5KYVA 4LF5C 1MKYA 4DR7C 1ZB8A 4PUIA 1PA4A 4PZPA 4ODJA 3TR3A 4KTVA 3CQ3A 3SO4A 2Z51A 4WS9A 2UXDC 3AY0A 3L8CA 2UUBC 3RV2A 2UXCC 1ZB9A 3L95X 5GTDA 3PBKA 5K85A 4LE5A 4EATA 2P2MA 3CW9A 1K0RA 3CJEA 4OYCA 3DHVA 2UU9C 1TH5A 3AF6A 4RVNA 2D1RA 3FCEA 3TQIA 3PESA 2CU6A 4R1LA 3LAXA 4RLFA 5FLXD 4DR5C 2PROA 3NYRA 4LFBC 4I9GA 5BSRA 2E8CA 1USPB 5LCIA 3R9XA 5K8FA 2OBVA 4JI7C 4ZJZA 3S82A 4B3MC 2ZZMA 1O90A 1V25A 1MDBA 5KYTA 1MD9A 2EGTA 2M5OA 1PG4A 4KTTA 3CW8X 4DG8A 3N54B 1XRBA 1N32C 4NXMC 1FUGA 1RY2A 4BCAA 3AF5A 1FLOA 3B7WA 5A19A 4NOZA 3GR1A 5A1IA 4DR6C 3GPCA 1O9TA 2BJOA 3I07A 3IPLA 1XMQC 4RM3A 1WH9A 4R1MA 1YGTA 5LMNC 4JI4C 2E0GA 4GXRA 2ZTBA 2VSQA 4TPSB 4RLQA 4G37A 4B3TC 1UWDA 5E7QA 1MDFA 2F4VC 4PUHA
chains in the Genus database with same CATH topology
3NI2A 2WP0C 3EERA 4DCSA 4DV2C 1XNQC 2ONFA 4NDNA 2ZM6C 4LFCC 3IEVA 3ETOA 3A9UA 3R44A 3N2QA 4ZLPA 1T5DX 4GKKC 3A9VA 1XRAA 4G36A 5BSVA 2CXCA 2QVZX 1BA3A 4JI5C 4DCVA 2ATWA 4DUYC 2E7GA 1HH2P 4X62C 4DV5C 4LFAC 4RMNA 1J5EC 4DR2C 1N2FA 4I9FA 4NXNC 5T8TA 2VQFC 4FTFA 4BC7A 1ULTA 4DR3C 4DUZC 4DCUA 4ISBA 2CY1A 1T5HX 5JRHA 5A1GA 1JOSA 2WD9A 5CZXA 5BSMA 3LGXA 4MH4A 1RG9A 2Y4OA 4PROC 1HNXC 4X66C 4KHPC 4L2ZA 3IEUA 4BSZA 4JI0C 2D1SA 4K0BA 4JI2C 2UUCC 2D27A 4DV3C 3J7AD 4JYAC 3VNRA 2OPLB 1I94C 1XNRC 3NYQA 2HHHC 1YJ7A 1ML8A 2VZEA 1PG3A 4DR1C 2YWCA 1N33C 1VLAA 5T8SA 1N36C 4FUTA 3G7SA 4B3SC 4DG9A 4LF7C 2KZFA 4BBYA 4L4QA 3OTOC 2P02A 1EGAA 4D56A 3JAMD 4GS5A 2QVXX 5BSTA 3TDEA 2DYJA 3IMLA 2P2JA 1IBLC 5BUSA 4G1IA 4LF4C 5IFIA 5BR8C 4JI6C 4JV5C 2HJGA 3RG2A 4DV7C 1KKGA 4DV0C 4DV6C 3NPDA 2Y4NA 1LCIA 2DPLA 2QVYX 5BSUA 4WV3A 5BSWA 2UUAC 1FJGC 4PHTA 5IT9D 1WF3A 4IZ6A 2P2FA 3R9WA 1NYEA 4RM2A 2P2QA 4IR7A 3UOWA 3T1YC 4K0KC 4DCTA 1O92A 1MXCA 2YCBA 1O93A 2E8EA 2P2BA 2VQEC 4JM1A 4FUQA 3ETCA 4RVOA 4HPVA 4X65C 2D7VA 1HNZC 4LF6C 4U5YD 1HNWC 1IBKC 4L7IA 4GXQA 4D4GA 3I08A 4XX2A 4YY3C 3J81D 2V7BA 2E5LC 3GR0A 3TUFA 1XMOC 2D1QA 5AE2A 5H9UA 3GKUA 4D4IA 3DAYA 5BUQA 2D28C 5LMUC 4LF9C 3E7XA 4YHHC 2UXBC 3H2TA 1XRCA 3PROC 3LUSA 4DV4C 4GKJC 2JMPA 1GPMA 3DLPX 1QM4A 2OO4A 2QW0X 1MXBA 3UZ0A 2XR1A 2AYAA 5IWAC 4B3RC 3VNQA 1LQLA 5AE3A 1V26A 4MTNA 1QWIA 5CZVA 1IBMC 3E7WA 4DR4C 3C5EA 4R0MA 2BH1X 2PN2A 3EQ6A 5A2QD 1UKKA 3LNVA 5BURA 2Y27A 3FCCA 4LF8C 4JI8C 4JI1C 4OXIA 2D1TA 4DV1C 4OX9C 2PT7G 2P20A 1L2FA 2E8FA 2YWBA 4JI3C 1USPA 3T1HC 5DV9A 1AMUA 5AE1A 3VNSA 1P7LA 4X64C 4D57A 1N34C 1MXAA 2QL8A 3A4IA 3KXWA 4AQYC 2ASBA 5ADZA 1HR0C 4BC9A 2OPLA 5KEIA 5KYVA 4LF5C 1MKYA 4DR7C 1ZB8A 1PA4A 4PZPA 4ODJA 4KTVA 3SO4A 4WS9A 2UXDC 2UUBC 3L8CA 3RV2A 2UXCC 1ZB9A 3L95X 5GTDA 3PBKA 5K85A 4LE5A 4EATA 2P2MA 3CW9A 1K0RA 3CJEA 4OYCA 3DHVA 2UU9C 3AF6A 4RVNA 2D1RA 3FCEA 3TQIA 3PESA 4R1LA 3LAXA 4RLFA 5FLXD 4DR5C 2PROA 3NYRA 4LFBC 4I9GA 5BSRA 2E8CA 1USPB 3R9XA 5K8FA 2OBVA 4JI7C 4ZJZA 3S82A 4B3MC 1O90A 1V25A 1MDBA 5KYTA 1MD9A 2EGTA 1PG4A 4KTTA 3CW8X 4DG8A 3N54B 1XRBA 1N32C 4NXMC 1FUGA 1RY2A 4BCAA 3AF5A 3B7WA 5A19A 4NOZA 3GR1A 5A1IA 4DR6C 3GPCA 1O9TA 2BJOA 3I07A 3IPLA 1XMQC 4RM3A 1WH9A 4R1MA 5LMNC 4JI4C 2E0GA 4GXRA 2VSQA 4TPSB 4RLQA 4G37A 4B3TC 5E7QA 1MDFA 2F4VC 3J80D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XX2 A;  3EER A;  4YY3 C;  3J81 D;  2E5L C;  2UXD C;  4DCS A;  4DV2 C;  2UUB C;  1XMO C;  1XNQ C;  1N33 C;  2ONF A;  2ZM6 C;  4LFC C;  1VLA A;  3GKU A;  3IEV A;  1N36 C;  2UXC C;  1ZB9 A;  4B3S C;  4LF9 C;  5LMU C;  4GKK C;  4LF7 C;  2KZF A;  4YHH C;  2UXB C;  2CXC A;  3OTO C;  1EGA A;  3LUS A;  4DV4 C;  4JI5 C;  4DCV A;  2ATW A;  1K0R A;  3CJE A;  4GKJ C;  4DUY C;  2UU9 C;  2JMP A;  3JAM D;  2E7G A;  3AF6 A;  1HH2 P;  2DYJ A;  4X62 C;  1IBL C;  4DV5 C;  4LFA C;  2XR1 A;  5FLX D;  4DR2 C;  1N2F A;  1J5E C;  4NXN C;  4DR5 C;  5IWA C;  4LF4 C;  4B3R C;  2VQF C;  1LQL A;  4MTN A;  1QWI A;  4LFB C;  1IBM C;  4DR3 C;  5BR8 C;  4JI6 C;  4DUZ C;  2E8C A;  1USP B;  3R9X A;  4DR4 C;  4JV5 C;  4DCU A;  2HJG A;  4DV7 C;  1KKG A;  4DV0 C;  4DV6 C;  2PN2 A;  5A2Q D;  2CY1 A;  1UKK A;  4JI7 C;  4B3M C;  4LF8 C;  4JI8 C;  1JOS A;  4JI1 C;  4DV1 C;  2UUA C;  1FJG C;  4OX9 C;  2PT7 G;  2EGT A;  5IT9 D;  1WF3 A;  4MH4 A;  3R9W A;  1NYE A;  1L2F A;  2E8F A;  4JI3 C;  1N32 C;  4NXM C;  1HNX C;  1USP A;  3AF5 A;  3T1H C;  4X66 C;  4KHP C;  3T1Y C;  4K0K C;  4NOZ A;  4DCT A;  3IEU A;  4DR6 C;  4BSZ A;  4JI0 C;  2BJO A;  3I07 A;  4JI2 C;  1XMQ C;  2UUC C;  2YCB A;  4X64 C;  1N34 C;  1WH9 A;  2QL8 A;  2E8E A;  4DV3 C;  3J7A D;  2VQE C;  5LMN C;  4JI4 C;  4JYA C;  4AQY C;  2ASB A;  4X65 C;  2D7V A;  1HNZ C;  1HR0 C;  4LF6 C;  2OPL B;  2OPL A;  1I94 C;  1XNR C;  1HNW C;  4LF5 C;  1MKY A;  1IBK C;  4DR7 C;  2HHH C;  4B3T C;  1ZB8 A;  1ML8 A;  2F4V C;  1PA4 A;  4DR1 C;  3J80 D; 
#chains in the Genus database with same CATH topology
 3NI2 A;  2WP0 C;  3EER A;  2ZZN A;  4DCS A;  4DV2 C;  1XNQ C;  2ONF A;  4NDN A;  1NY8 A;  2ZM6 C;  4LFC C;  3IEV A;  3ETO A;  3A9U A;  3R44 A;  3N2Q A;  4ZLP A;  1T5D X;  4GKK C;  3A9V A;  1XRA A;  4G36 A;  5BSV A;  2CXC A;  2QVZ X;  1BA3 A;  4JI5 C;  4DCV A;  2ATW A;  4DUY C;  2E7G A;  2KZ0 A;  1HH2 P;  4X62 C;  2JNV A;  4DV5 C;  4LFA C;  4RMN A;  1J5E C;  4DR2 C;  1N2F A;  4I9F A;  4NXN C;  3J80 D;  5T8T A;  2VQF C;  4FTF A;  4BC7 A;  2KDN A;  1ULT A;  4DR3 C;  4DUZ C;  4DCU A;  1XDX A;  1XHJ A;  4ISB A;  2CY1 A;  1T5H X;  5JRH A;  5A1G A;  1JOS A;  2DHM A;  2WD9 A;  5CZX A;  5BSM A;  1M6X C;  3LGX A;  4MH4 A;  1RG9 A;  2Y4O A;  4PRO C;  1HNX C;  4X66 C;  4KHP C;  4L2Z A;  3IEU A;  4BSZ A;  4JI0 C;  2D1S A;  2MMA B;  4K0B A;  4JI2 C;  2UUC C;  2D27 A;  4DV3 C;  3J7A D;  4JYA C;  3VNR A;  1V60 A;  2OPL B;  2M5H A;  1I94 C;  1XNR C;  3NYQ A;  1P4E C;  2HHH C;  1YJ7 A;  1ML8 A;  2VZE A;  1PG3 A;  4DR1 C;  2YWC A;  1N33 C;  1VLA A;  5T8S A;  1N36 C;  4FUT A;  3G7S A;  4B3S C;  1WCJ A;  4DG9 A;  4LF7 C;  2KZF A;  4BBY A;  3CQ1 A;  2NCL A;  4L4Q A;  3OTO C;  2P02 A;  1EGA A;  1VEH A;  4D56 A;  2YX1 A;  3JAM D;  4GS5 A;  2QVX X;  5BST A;  3TDE A;  2DYJ A;  3IML A;  2PG1 E;  2P2J A;  1IBL C;  5BUS A;  4G1I A;  3UEB A;  4LF4 C;  5IFI A;  3CQ2 A;  5BR8 C;  4JI6 C;  4JV5 C;  2HJG A;  3RG2 A;  4DV7 C;  1KKG A;  4DV0 C;  4DV6 C;  3NPD A;  2Y4N A;  1LCI A;  2DPL A;  2QVY X;  2MM9 A;  5BSU A;  4WV3 A;  5BSW A;  3UX2 A;  2UUA C;  1FJG C;  4PHT A;  5IT9 D;  1WF3 A;  4IZ6 A;  2P2F A;  3R9W A;  1NYE A;  4RM2 A;  2P2Q A;  4IR7 A;  3UOW A;  3T1Y C;  4K0K C;  4DCT A;  1O92 A;  1MXC A;  2YCB A;  1O93 A;  2E8E A;  2P2B A;  2VQE C;  4JM1 A;  4FUQ A;  3ETC A;  4RVO A;  4HPV A;  4X65 C;  2D7V A;  1HNZ C;  4LF6 C;  4U5Y D;  1HNW C;  1IBK C;  4L7I A;  4GXQ A;  4D4G A;  3I08 A;  4XX2 A;  4YY3 C;  3J81 D;  2V7B A;  2E5L C;  3GR0 A;  4PUG A;  3TUF A;  1XMO C;  2D1Q A;  5AE2 A;  3LNO A;  5H9U A;  3GKU A;  4D4I A;  3DAY A;  5BUQ A;  2D28 C;  5LMU C;  4LF9 C;  3E7X A;  4YHH C;  2UXB C;  3H2T A;  1XRC A;  3PRO C;  3LUS A;  4DV4 C;  1M6X A;  4GKJ C;  2JMP A;  1GPM A;  3DLP X;  1QM4 A;  2OO4 A;  3K6R A;  2QW0 X;  1MXB A;  3UZ0 A;  2XR1 A;  2AYA A;  5IWA C;  1PU1 A;  4B3R C;  3VNQ A;  3FM7 A;  1LQL A;  5AE3 A;  1V26 A;  4MTN A;  1QWI A;  5CZV A;  1IBM C;  3E7W A;  4DR4 C;  3C5E A;  4R0M A;  2BH1 X;  2PN2 A;  3EQ6 A;  5A2Q D;  1UKK A;  3LNV A;  5BUR A;  2Y27 A;  3FCC A;  4LF8 C;  4JI8 C;  4JI1 C;  4OXI A;  2D1T A;  4DV1 C;  1P4E A;  4OX9 C;  2PT7 G;  2P20 A;  3A26 A;  1L2F A;  2E8F A;  2YWB A;  4JI3 C;  3A25 A;  1USP A;  3T1H C;  5DV9 A;  1XS3 A;  1AMU A;  5AE1 A;  3VNS A;  1P7L A;  4D57 A;  4X64 C;  1N34 C;  1MXA A;  2QL8 A;  3A4I A;  3UX3 A;  2MCQ A;  1IB8 A;  3O2E A;  3KXW A;  4AQY C;  2ASB A;  5ADZ A;  1HR0 C;  4BC9 A;  2OPL A;  5KEI A;  5KYV A;  4LF5 C;  1MKY A;  4DR7 C;  1ZB8 A;  4PUI A;  1PA4 A;  4PZP A;  4ODJ A;  3TR3 A;  4KTV A;  3CQ3 A;  3SO4 A;  2Z51 A;  4WS9 A;  2UXD C;  3AY0 A;  3L8C A;  2UUB C;  3RV2 A;  2UXC C;  1ZB9 A;  3L95 X;  5GTD A;  3PBK A;  5K85 A;  4LE5 A;  4EAT A;  2P2M A;  3CW9 A;  1K0R A;  3CJE A;  4OYC A;  3DHV A;  2UU9 C;  1TH5 A;  3AF6 A;  4RVN A;  2D1R A;  3FCE A;  3TQI A;  3PES A;  2CU6 A;  4R1L A;  3LAX A;  4RLF A;  5FLX D;  4DR5 C;  2PRO A;  3NYR A;  4LFB C;  4I9G A;  5BSR A;  2E8C A;  1USP B;  5LCI A;  3R9X A;  5K8F A;  2OBV A;  4JI7 C;  4ZJZ A;  3S82 A;  4B3M C;  2ZZM A;  1O90 A;  1V25 A;  1MDB A;  5KYT A;  1MD9 A;  2EGT A;  2M5O A;  1PG4 A;  4KTT A;  3CW8 X;  4DG8 A;  3N54 B;  1XRB A;  1N32 C;  4NXM C;  1FUG A;  1RY2 A;  4BCA A;  3AF5 A;  1FLO A;  3B7W A;  5A19 A;  4NOZ A;  3GR1 A;  5A1I A;  4DR6 C;  3GPC A;  1O9T A;  2BJO A;  3I07 A;  3IPL A;  1XMQ C;  4RM3 A;  1WH9 A;  4R1M A;  1YGT A;  5LMN C;  4JI4 C;  2E0G A;  4GXR A;  2ZTB A;  2VSQ A;  4TPS B;  4RLQ A;  4G37 A;  4B3T C;  1UWD A;  5E7Q A;  1MDF A;  2F4V C;  4PUH A; 
#chains in the Genus database with same CATH homology
 3NI2 A;  2WP0 C;  3EER A;  4DCS A;  4DV2 C;  1XNQ C;  2ONF A;  4NDN A;  2ZM6 C;  4LFC C;  3IEV A;  3ETO A;  3A9U A;  3R44 A;  3N2Q A;  4ZLP A;  1T5D X;  4GKK C;  3A9V A;  1XRA A;  4G36 A;  5BSV A;  2CXC A;  2QVZ X;  1BA3 A;  4JI5 C;  4DCV A;  2ATW A;  4DUY C;  2E7G A;  1HH2 P;  4X62 C;  4DV5 C;  4LFA C;  4RMN A;  1J5E C;  4DR2 C;  1N2F A;  4I9F A;  4NXN C;  5T8T A;  2VQF C;  4FTF A;  4BC7 A;  1ULT A;  4DR3 C;  4DUZ C;  4DCU A;  4ISB A;  2CY1 A;  1T5H X;  5JRH A;  5A1G A;  1JOS A;  2WD9 A;  5CZX A;  5BSM A;  3LGX A;  4MH4 A;  1RG9 A;  2Y4O A;  4PRO C;  1HNX C;  4X66 C;  4KHP C;  4L2Z A;  3IEU A;  4BSZ A;  4JI0 C;  2D1S A;  4K0B A;  4JI2 C;  2UUC C;  2D27 A;  4DV3 C;  3J7A D;  4JYA C;  3VNR A;  2OPL B;  1I94 C;  1XNR C;  3NYQ A;  2HHH C;  1YJ7 A;  1ML8 A;  2VZE A;  1PG3 A;  4DR1 C;  2YWC A;  1N33 C;  1VLA A;  5T8S A;  1N36 C;  4FUT A;  3G7S A;  4B3S C;  4DG9 A;  4LF7 C;  2KZF A;  4BBY A;  4L4Q A;  3OTO C;  2P02 A;  1EGA A;  4D56 A;  3JAM D;  4GS5 A;  2QVX X;  5BST A;  3TDE A;  2DYJ A;  3IML A;  2P2J A;  1IBL C;  5BUS A;  4G1I A;  4LF4 C;  5IFI A;  5BR8 C;  4JI6 C;  4JV5 C;  2HJG A;  3RG2 A;  4DV7 C;  1KKG A;  4DV0 C;  4DV6 C;  3NPD A;  2Y4N A;  1LCI A;  2DPL A;  2QVY X;  5BSU A;  4WV3 A;  5BSW A;  2UUA C;  1FJG C;  4PHT A;  5IT9 D;  1WF3 A;  4IZ6 A;  2P2F A;  3R9W A;  1NYE A;  4RM2 A;  2P2Q A;  4IR7 A;  3UOW A;  3T1Y C;  4K0K C;  4DCT A;  1O92 A;  1MXC A;  2YCB A;  1O93 A;  2E8E A;  2P2B A;  2VQE C;  4JM1 A;  4FUQ A;  3ETC A;  4RVO A;  4HPV A;  4X65 C;  2D7V A;  1HNZ C;  4LF6 C;  4U5Y D;  1HNW C;  1IBK C;  4L7I A;  4GXQ A;  4D4G A;  3I08 A;  4XX2 A;  4YY3 C;  3J81 D;  2V7B A;  2E5L C;  3GR0 A;  3TUF A;  1XMO C;  2D1Q A;  5AE2 A;  5H9U A;  3GKU A;  4D4I A;  3DAY A;  5BUQ A;  2D28 C;  5LMU C;  4LF9 C;  3E7X A;  4YHH C;  2UXB C;  3H2T A;  1XRC A;  3PRO C;  3LUS A;  4DV4 C;  4GKJ C;  2JMP A;  1GPM A;  3DLP X;  1QM4 A;  2OO4 A;  2QW0 X;  1MXB A;  3UZ0 A;  2XR1 A;  2AYA A;  5IWA C;  4B3R C;  3VNQ A;  1LQL A;  5AE3 A;  1V26 A;  4MTN A;  1QWI A;  5CZV A;  1IBM C;  3E7W A;  4DR4 C;  3C5E A;  4R0M A;  2BH1 X;  2PN2 A;  3EQ6 A;  5A2Q D;  1UKK A;  3LNV A;  5BUR A;  2Y27 A;  3FCC A;  4LF8 C;  4JI8 C;  4JI1 C;  4OXI A;  2D1T A;  4DV1 C;  4OX9 C;  2PT7 G;  2P20 A;  1L2F A;  2E8F A;  2YWB A;  4JI3 C;  1USP A;  3T1H C;  5DV9 A;  1AMU A;  5AE1 A;  3VNS A;  1P7L A;  4X64 C;  4D57 A;  1N34 C;  1MXA A;  2QL8 A;  3A4I A;  3KXW A;  4AQY C;  2ASB A;  5ADZ A;  1HR0 C;  4BC9 A;  2OPL A;  5KEI A;  5KYV A;  4LF5 C;  1MKY A;  4DR7 C;  1ZB8 A;  1PA4 A;  4PZP A;  4ODJ A;  4KTV A;  3SO4 A;  4WS9 A;  2UXD C;  2UUB C;  3L8C A;  3RV2 A;  2UXC C;  1ZB9 A;  3L95 X;  5GTD A;  3PBK A;  5K85 A;  4LE5 A;  4EAT A;  2P2M A;  3CW9 A;  1K0R A;  3CJE A;  4OYC A;  3DHV A;  2UU9 C;  3AF6 A;  4RVN A;  2D1R A;  3FCE A;  3TQI A;  3PES A;  4R1L A;  3LAX A;  4RLF A;  5FLX D;  4DR5 C;  2PRO A;  3NYR A;  4LFB C;  4I9G A;  5BSR A;  2E8C A;  1USP B;  3R9X A;  5K8F A;  2OBV A;  4JI7 C;  4ZJZ A;  3S82 A;  4B3M C;  1O90 A;  1V25 A;  1MDB A;  5KYT A;  1MD9 A;  2EGT A;  1PG4 A;  4KTT A;  3CW8 X;  4DG8 A;  3N54 B;  1XRB A;  1N32 C;  4NXM C;  1FUG A;  1RY2 A;  4BCA A;  3AF5 A;  3B7W A;  5A19 A;  4NOZ A;  3GR1 A;  5A1I A;  4DR6 C;  3GPC A;  1O9T A;  2BJO A;  3I07 A;  3IPL A;  1XMQ C;  4RM3 A;  1WH9 A;  4R1M A;  5LMN C;  4JI4 C;  2E0G A;  4GXR A;  2VSQ A;  4TPS B;  4RLQ A;  4G37 A;  4B3T C;  5E7Q A;  1MDF A;  2F4V C;  3J80 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...