4GKKC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4gkkC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4gkkC02
1XMQC 1QWIA 1J5EC 4KHPC 4DV6C 1HR0C 4AQYC 4DV4C 4LF7C 2XR1A 1FJGC 4BSZA 4DV1C 1VLAA 4LF6C 4DV0C 2E8CA 4DCUA 4B3SC 2HJGA 4JI3C 5A2QD 2PT7G 1HNXC 2OPLB 1PA4A 2ATWA 3CJEA 4JYAC 4DR3C 4K0KC 4MH4A 5BR8C 1IBLC 4JI1C 4JI2C 3JAMD 2E5LC 4DR6C 4DR5C 3GKUA 4JI4C 5IWAC 4DV7C 4LF5C 1XMOC 1EGAA 4DR4C 1MKYA 1XNQC 3T1HC 4DUZC 4DR7C 3LUSA 1N36C 1L2FA 4JI6C 3R9WA 4DCTA 3EERA 4JI0C 1USPA 4X64C 2UXBC 3J7AD 2CY1A 4MTNA 1K0RA 3J81D 2EGTA 3R9XA 4DV3C 4GKKC 1WF3A 2CXCA 4YHHC 4X66C 1ZB8A 4NXMC 1IBMC 2HHHC 4B3TC 4JI8C 1USPB 3I07A 2ONFA 2D7VA 4LFAC 4X62C 3OTOC 2ZM6C 2VQFC 3T1YC 2ASBA 1LQLA 2BJOA 4LFBC 2YCBA 4DUYC 1KKGA 4JI5C 3AF5A 5FLXD 4OX9C 4JI7C 1WH9A 1N2FA 5LMUC 1ZB9A 1HNZC 2UXDC 2E7GA 4DCVA 2E8EA 4LFCC 2DYJA 2QL8A 1UKKA 4B3RC 2UXCC 2E8FA 5IT9D 2PN2A 2OPLA 3IEUA 1I94C 1N34C 2JMPA 4LF9C 2KZFA 4DV5C 4DV2C 3AF6A 1N33C 2VQEC 1HNWC 4LF4C 1JOSA 2UUBC 4XX2A 4DCSA 4JV5C 1IBKC 4GKJC 4NOZA 1N32C 1XNRC 4B3MC 5LMNC 4LF8C 2UU9C 4YY3C 1ML8A 3J80D 4DR1C 2F4VC 2UUCC 4X65C 2UUAC 4NXNC 3IEVA 4DR2C 1HH2P 1NYEA
chains in the Genus database with same CATH superfamily
4U5YD 1J5EC 5BSVA 2QVYX 2XR1A 2NCLA 1VLAA 2D1RA 5BSTA 3A25A 1UWDA 2PT7G 1HNXC 4RLFA 5KYVA 4OXIA 3TR3A 4JI2C 4G37A 4DR5C 5IWAC 3VNQA 4LF5C 1XMOC 1EGAA 2MM9A 4ISBA 5A19A 1M6XC 3EERA 4PZPA 1MDFA 4JI0C 1USPA 4ZJZA 3KXWA 2UXBC 2P20A 3NYRA 2D1QA 1K0RA 2EGTA 3R9XA 1PG3A 3LNVA 3RG2A 4PUGA 1XRAA 1PU1A 2DPLA 4KTTA 1MXBA 4X66C 5K8FA 4NXMC 1IBMC 2HHHC 2QVZX 5GTDA 2KZ0A 4X62C 3IMLA 5BUSA 4LFBC 4RVOA 2YCBA 4DUYC 3GR1A 4JI7C 1HNZC 5H9UA 4DG9A 2E7GA 5K85A 2MMAB 2E8EA 4PUHA 2DYJA 4D4IA 3AY0A 4KTVA 3N2QA 3K6RA 1M6XA 3O2EA 4BC7A 4PHTA 2PN2A 3IEUA 1N34C 4DV5C 3SO4A 3E7XA 1HNWC 4GS5A 1V25A 2D27A 4GKJC 4G1IA 2MCQA 4LF8C 2UU9C 3J80D 4PUIA 2F4VC 2ZZMA 4L2ZA 5BSMA 2PG1E 5IFIA 4DV4C 4LF7C 1O93A 3GPCA 4RVNA 3TUFA 5DV9A 1YJ7A 4GXQA 5A2QD 4I9GA 2P2JA 4L7IA 2OPLB 1PA4A 1O9TA 3I08A 2ATWA 3CJEA 3UX3A 4RM2A 1IBLC 4D4GA 2M5OA 4G36A 1GPMA 4GXRA 3JAMD 5AE2A 2VSQA 2YWBA 1MKYA 2VZEA 3CW8X 3N54B 3J7AD 4DV3C 4NDNA 4YHHC 1P4EA 4B3TC 4JI8C 5E7QA 1WCJA 4FTFA 2QW0X 3CQ1A 5A1IA 2ONFA 3A9UA 2JNVA 3A26A 3PESA 4ZLPA 2BH1X 1LQLA 3PROC 5FLXD 3NPDA 1P7LA 3CQ2A 2UXDC 3LNOA 3G7SA 3A9VA 4FUQA 2WD9A 3E7WA 5AE3A 2QL8A 1UKKA 3UOWA 2KDNA 2UXCC 2P2MA 4ODJA 2E8FA 4IZ6A 4PROC 3UZ0A 2YX1A 2OPLA 3EQ6A 3FCCA 5BSRA 4DV2C 3AF6A 2D1SA 4K0BA 3VNRA 5BUQA 4DG8A 4JM1A 5KEIA 1MDBA 3C5EA 4NOZA 1XNRC 1V60A 5LMNC 2DHMA 2OO4A 1QM4A 1T5DX 4BBYA 5ADZA 1O92A 1QWIA 4DV6C 1HR0C 4AQYC 1FUGA 2P2FA 3FM7A 4L4QA 1FLOA 2P2BA 4BSZA 1ULTA 4DV0C 4DCUA 4B3SC 2AYAA 2HJGA 4RMNA 4JI3C 5AE1A 4K0KC 1V26A 5BR8C 4BC9A 4JI1C 2E5LC 4DR6C 2M5HA 3CW9A 4JI4C 1YGTA 4DV7C 4OYCA 1TH5A 4HPVA 1XRBA 1XNQC 1MD9A 2OBVA 4DR7C 1P4EC 1N36C 3R9WA 4DCTA 3NYQA 4X64C 1RY2A 5A1GA 3L95X 4RM3A 4GKKC 4IR7A 1ZB8A 1USPB 4EATA 3S82A 3FCEA 4LFAC 3OTOC 3T1YC 2BJOA 1KKGA 3ETCA 1IB8A 3UX2A 3AF5A 1WH9A 4TPSB 2YWCA 2E0GA 4LFCC 1NY8A 1O90A 1XDXA 2Y4OA 2ZTBA 4R1LA 5BSWA 5IT9D 3TQIA 2Y27A 1I94C 4LF9C 2WP0C 5BURA 2KZFA 2V7BA 1N33C 3GR0A 1JOSA 2UUBC 1MXAA 4DCSA 1T5HX 1VEHA 1BA3A 5KYTA 3R44A 3A4IA 4B3MC 1ML8A 4DR1C 1XRCA 4X65C 5LCIA 2UUAC 4NXNC 5JRHA 4DR2C 1HH2P 1NYEA 1XMQC 3H2TA 4KHPC 2Z51A 3LAXA 1FJGC 3UEBA 5BSUA 4DV1C 4LF6C 5T8SA 2E8CA 2Y4NA 5T8TA 4D56A 4JYAC 4DR3C 4R0MA 4MH4A 5CZVA 3IPLA 4WS9A 3CQ3A 3GKUA 3NI2A 1AMUA 4DR4C 3T1HC 4DUZC 3LUSA 1PG4A 1L2FA 4JI6C 2CY1A 4FUTA 1LCIA 4MTNA 3J81D 1WF3A 2CXCA 3B7WA 3L8CA 1XS3A 3DAYA 3DLPX 3PBKA 2P02A 4D57A 3I07A 2D7VA 2QVXX 2ZM6C 2VQFC 2ASBA 2P2QA 3DHVA 4JI5C 4OX9C 1N2FA 5LMUC 1ZB9A 4DCVA 5CZXA 3RV2A 4WV3A 4BCAA 2D1TA 4B3RC 3LGXA 4RLQA 4R1MA 2JMPA 1XHJA 3ETOA 1MXCA 3VNSA 2VQEC 4LF4C 2ZZNA 4XX2A 4JV5C 1IBKC 1N32C 1RG9A 4YY3C 2UUCC 3TDEA 2PROA 2CU6A 4LE5A 3IEVA 4I9FA 2D28C
chains in the Genus database with same CATH topology
4U5YD 1J5EC 5BSVA 2QVYX 2XR1A 1VLAA 2D1RA 5BSTA 2PT7G 1HNXC 4RLFA 5KYVA 4OXIA 4JI2C 4G37A 4DR5C 5IWAC 3VNQA 4LF5C 1XMOC 1EGAA 4ISBA 5A19A 3EERA 4PZPA 1MDFA 4JI0C 1USPA 4ZJZA 3KXWA 2UXBC 2P20A 3NYRA 2D1QA 1K0RA 2EGTA 3R9XA 1PG3A 3LNVA 3RG2A 1XRAA 2DPLA 4KTTA 1MXBA 4X66C 5K8FA 4NXMC 1IBMC 2HHHC 2QVZX 5GTDA 4X62C 3IMLA 5BUSA 4LFBC 4RVOA 2YCBA 4DUYC 3GR1A 4JI7C 1HNZC 5H9UA 4DG9A 2E7GA 5K85A 2E8EA 2DYJA 4D4IA 4KTVA 3N2QA 4BC7A 4PHTA 2PN2A 3IEUA 1N34C 4DV5C 3SO4A 3E7XA 1HNWC 4GS5A 1V25A 2D27A 4GKJC 4G1IA 4LF8C 2UU9C 3J80D 2F4VC 4L2ZA 5BSMA 5IFIA 4DV4C 4LF7C 1O93A 3GPCA 4RVNA 3TUFA 5DV9A 1YJ7A 4GXQA 5A2QD 4I9GA 2P2JA 4L7IA 2OPLB 1PA4A 1O9TA 3I08A 2ATWA 3CJEA 4RM2A 1IBLC 4D4GA 4G36A 1GPMA 4GXRA 3JAMD 5AE2A 2VSQA 2YWBA 1MKYA 2VZEA 3CW8X 3N54B 3J7AD 4DV3C 4NDNA 4YHHC 4B3TC 4JI8C 5E7QA 4FTFA 2QW0X 5A1IA 2ONFA 3A9UA 3PESA 4ZLPA 2BH1X 1LQLA 3PROC 5FLXD 3NPDA 1P7LA 2UXDC 3G7SA 3A9VA 4FUQA 2WD9A 3E7WA 5AE3A 2QL8A 1UKKA 3UOWA 2UXCC 2P2MA 4ODJA 2E8FA 4IZ6A 4PROC 3UZ0A 2OPLA 3EQ6A 3FCCA 5BSRA 4DV2C 3AF6A 2D1SA 4K0BA 3VNRA 5BUQA 4DG8A 4JM1A 5KEIA 1MDBA 3C5EA 4NOZA 1XNRC 5LMNC 2OO4A 1QM4A 1T5DX 4BBYA 5ADZA 1O92A 1QWIA 4DV6C 1HR0C 4AQYC 1FUGA 2P2FA 4L4QA 2P2BA 4BSZA 1ULTA 4DV0C 4DCUA 4B3SC 2AYAA 2HJGA 4RMNA 4JI3C 5AE1A 4K0KC 1V26A 5BR8C 4BC9A 4JI1C 2E5LC 4DR6C 3CW9A 4JI4C 4DV7C 4OYCA 4HPVA 1XRBA 1XNQC 1MD9A 2OBVA 4DR7C 1N36C 3R9WA 4DCTA 3NYQA 4X64C 1RY2A 5A1GA 3L95X 4RM3A 4GKKC 4IR7A 1ZB8A 1USPB 4EATA 3S82A 3FCEA 4LFAC 3T1YC 3OTOC 2BJOA 1KKGA 3ETCA 3AF5A 1WH9A 4TPSB 2YWCA 2E0GA 4LFCC 1O90A 2Y4OA 4R1LA 5BSWA 5IT9D 3TQIA 2Y27A 1I94C 4LF9C 2WP0C 5BURA 2KZFA 2V7BA 1N33C 3GR0A 1JOSA 2UUBC 1MXAA 4DCSA 1T5HX 1BA3A 5KYTA 3R44A 3A4IA 4B3MC 1ML8A 4DR1C 1XRCA 4X65C 2UUAC 4NXNC 5JRHA 4DR2C 1HH2P 1NYEA 1XMQC 3H2TA 4KHPC 3LAXA 1FJGC 5BSUA 4DV1C 4LF6C 5T8SA 2E8CA 2Y4NA 5T8TA 4D56A 4JYAC 4DR3C 4R0MA 4MH4A 5CZVA 3IPLA 4WS9A 3GKUA 3NI2A 1AMUA 4DR4C 3T1HC 4DUZC 3LUSA 1PG4A 1L2FA 4JI6C 2CY1A 4FUTA 1LCIA 4MTNA 3J81D 1WF3A 2CXCA 3B7WA 3L8CA 3DAYA 3DLPX 3PBKA 2P02A 4D57A 3I07A 2D7VA 2QVXX 2ZM6C 2VQFC 2ASBA 2P2QA 3DHVA 4JI5C 4OX9C 1N2FA 5LMUC 1ZB9A 5CZXA 4DCVA 3RV2A 4WV3A 4BCAA 2D1TA 4B3RC 3LGXA 4RLQA 4R1MA 2JMPA 3ETOA 1MXCA 3VNSA 2VQEC 4LF4C 4XX2A 4JV5C 1IBKC 1N32C 1RG9A 4YY3C 2UUCC 3TDEA 2PROA 4LE5A 3IEVA 4I9FA 2D28C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ C;  1QWI A;  1J5E C;  4KHP C;  4DV6 C;  1HR0 C;  4AQY C;  4DV4 C;  4LF7 C;  2XR1 A;  1FJG C;  4BSZ A;  4DV1 C;  1VLA A;  4LF6 C;  4DV0 C;  2E8C A;  4DCU A;  4B3S C;  2HJG A;  4JI3 C;  5A2Q D;  2PT7 G;  1HNX C;  2OPL B;  1PA4 A;  2ATW A;  3CJE A;  4JYA C;  4DR3 C;  4K0K C;  4MH4 A;  5BR8 C;  1IBL C;  4JI1 C;  4JI2 C;  3JAM D;  2E5L C;  4DR6 C;  4DR5 C;  3GKU A;  4JI4 C;  5IWA C;  4DV7 C;  4LF5 C;  1XMO C;  1EGA A;  4DR4 C;  1MKY A;  1XNQ C;  3T1H C;  4DUZ C;  4DR7 C;  3LUS A;  1N36 C;  1L2F A;  4JI6 C;  3R9W A;  4DCT A;  3EER A;  4JI0 C;  1USP A;  4X64 C;  2UXB C;  3J7A D;  2CY1 A;  4MTN A;  1K0R A;  3J81 D;  2EGT A;  3R9X A;  4DV3 C;  4GKK C;  1WF3 A;  2CXC A;  4YHH C;  4X66 C;  1ZB8 A;  4NXM C;  1IBM C;  2HHH C;  4B3T C;  4JI8 C;  1USP B;  3I07 A;  2ONF A;  2D7V A;  4LFA C;  4X62 C;  3OTO C;  2ZM6 C;  2VQF C;  3T1Y C;  2ASB A;  1LQL A;  2BJO A;  4LFB C;  2YCB A;  4DUY C;  1KKG A;  4JI5 C;  3AF5 A;  5FLX D;  4OX9 C;  4JI7 C;  1WH9 A;  1N2F A;  5LMU C;  1ZB9 A;  1HNZ C;  2UXD C;  2E7G A;  4DCV A;  2E8E A;  4LFC C;  2DYJ A;  2QL8 A;  1UKK A;  4B3R C;  2UXC C;  2E8F A;  5IT9 D;  2PN2 A;  2OPL A;  3IEU A;  1I94 C;  1N34 C;  2JMP A;  4LF9 C;  2KZF A;  4DV5 C;  4DV2 C;  3AF6 A;  1N33 C;  2VQE C;  1HNW C;  4LF4 C;  1JOS A;  2UUB C;  4XX2 A;  4DCS A;  4JV5 C;  1IBK C;  4GKJ C;  4NOZ A;  1N32 C;  1XNR C;  4B3M C;  5LMN C;  4LF8 C;  2UU9 C;  4YY3 C;  1ML8 A;  3J80 D;  4DR1 C;  2F4V C;  2UUC C;  4X65 C;  2UUA C;  4NXN C;  3IEV A;  4DR2 C;  1HH2 P;  1NYE A; 
#chains in the Genus database with same CATH topology
 4U5Y D;  1J5E C;  5BSV A;  2QVY X;  2XR1 A;  2NCL A;  1VLA A;  2D1R A;  5BST A;  3A25 A;  1UWD A;  2PT7 G;  1HNX C;  4RLF A;  5KYV A;  4OXI A;  3TR3 A;  4JI2 C;  4G37 A;  4DR5 C;  5IWA C;  3VNQ A;  4LF5 C;  1XMO C;  1EGA A;  2MM9 A;  4ISB A;  5A19 A;  1M6X C;  3EER A;  4PZP A;  1MDF A;  4JI0 C;  1USP A;  4ZJZ A;  3KXW A;  2UXB C;  2P20 A;  3NYR A;  2D1Q A;  1K0R A;  2EGT A;  3R9X A;  1PG3 A;  3LNV A;  3RG2 A;  4PUG A;  1XRA A;  1PU1 A;  2DPL A;  4KTT A;  1MXB A;  4X66 C;  5K8F A;  4NXM C;  1IBM C;  2HHH C;  2QVZ X;  5GTD A;  2KZ0 A;  4X62 C;  3IML A;  5BUS A;  4LFB C;  4RVO A;  2YCB A;  4DUY C;  3GR1 A;  4JI7 C;  1HNZ C;  5H9U A;  4DG9 A;  2E7G A;  5K85 A;  2MMA B;  2E8E A;  4PUH A;  2DYJ A;  4D4I A;  3AY0 A;  4KTV A;  3N2Q A;  3K6R A;  1M6X A;  3O2E A;  4BC7 A;  4PHT A;  2PN2 A;  3IEU A;  1N34 C;  4DV5 C;  3SO4 A;  3E7X A;  1HNW C;  4GS5 A;  1V25 A;  2D27 A;  4GKJ C;  4G1I A;  2MCQ A;  4LF8 C;  2UU9 C;  3J80 D;  4PUI A;  2F4V C;  2ZZM A;  4L2Z A;  5BSM A;  2PG1 E;  5IFI A;  4DV4 C;  4LF7 C;  1O93 A;  3GPC A;  4RVN A;  3TUF A;  5DV9 A;  1YJ7 A;  4GXQ A;  5A2Q D;  4I9G A;  2P2J A;  4L7I A;  2OPL B;  1PA4 A;  1O9T A;  3I08 A;  2ATW A;  3CJE A;  3UX3 A;  4RM2 A;  1IBL C;  4D4G A;  2M5O A;  4G36 A;  1GPM A;  4GXR A;  3JAM D;  5AE2 A;  2VSQ A;  2YWB A;  1MKY A;  2VZE A;  3CW8 X;  3N54 B;  3J7A D;  4DV3 C;  4NDN A;  4YHH C;  1P4E A;  4B3T C;  4JI8 C;  5E7Q A;  1WCJ A;  4FTF A;  2QW0 X;  3CQ1 A;  5A1I A;  2ONF A;  3A9U A;  2JNV A;  3A26 A;  3PES A;  4ZLP A;  2BH1 X;  1LQL A;  3PRO C;  5FLX D;  3NPD A;  1P7L A;  3CQ2 A;  2UXD C;  3LNO A;  3G7S A;  3A9V A;  4FUQ A;  2WD9 A;  3E7W A;  5AE3 A;  2QL8 A;  1UKK A;  3UOW A;  2KDN A;  2UXC C;  2P2M A;  4ODJ A;  2E8F A;  4IZ6 A;  4PRO C;  3UZ0 A;  2YX1 A;  2OPL A;  3EQ6 A;  3FCC A;  5BSR A;  4DV2 C;  3AF6 A;  2D1S A;  4K0B A;  3VNR A;  5BUQ A;  4DG8 A;  4JM1 A;  5KEI A;  1MDB A;  3C5E A;  4NOZ A;  1XNR C;  1V60 A;  5LMN C;  2DHM A;  2OO4 A;  1QM4 A;  1T5D X;  4BBY A;  5ADZ A;  1O92 A;  1QWI A;  4DV6 C;  1HR0 C;  4AQY C;  1FUG A;  2P2F A;  3FM7 A;  4L4Q A;  1FLO A;  2P2B A;  4BSZ A;  1ULT A;  4DV0 C;  4DCU A;  4B3S C;  2AYA A;  2HJG A;  4RMN A;  4JI3 C;  5AE1 A;  4K0K C;  1V26 A;  5BR8 C;  4BC9 A;  4JI1 C;  2E5L C;  4DR6 C;  2M5H A;  3CW9 A;  4JI4 C;  1YGT A;  4DV7 C;  4OYC A;  1TH5 A;  4HPV A;  1XRB A;  1XNQ C;  1MD9 A;  2OBV A;  4DR7 C;  1P4E C;  1N36 C;  3R9W A;  4DCT A;  3NYQ A;  4X64 C;  1RY2 A;  5A1G A;  3L95 X;  4RM3 A;  4GKK C;  4IR7 A;  1ZB8 A;  1USP B;  4EAT A;  3S82 A;  3FCE A;  4LFA C;  3OTO C;  3T1Y C;  2BJO A;  1KKG A;  3ETC A;  1IB8 A;  3UX2 A;  3AF5 A;  1WH9 A;  4TPS B;  2YWC A;  2E0G A;  4LFC C;  1NY8 A;  1O90 A;  1XDX A;  2Y4O A;  2ZTB A;  4R1L A;  5BSW A;  5IT9 D;  3TQI A;  2Y27 A;  1I94 C;  4LF9 C;  2WP0 C;  5BUR A;  2KZF A;  2V7B A;  1N33 C;  3GR0 A;  1JOS A;  2UUB C;  1MXA A;  4DCS A;  1T5H X;  1VEH A;  1BA3 A;  5KYT A;  3R44 A;  3A4I A;  4B3M C;  1ML8 A;  4DR1 C;  1XRC A;  4X65 C;  5LCI A;  2UUA C;  4NXN C;  5JRH A;  4DR2 C;  1HH2 P;  1NYE A;  1XMQ C;  3H2T A;  4KHP C;  2Z51 A;  3LAX A;  1FJG C;  3UEB A;  5BSU A;  4DV1 C;  4LF6 C;  5T8S A;  2E8C A;  2Y4N A;  5T8T A;  4D56 A;  4JYA C;  4DR3 C;  4R0M A;  4MH4 A;  5CZV A;  3IPL A;  4WS9 A;  3CQ3 A;  3GKU A;  3NI2 A;  1AMU A;  4DR4 C;  3T1H C;  4DUZ C;  3LUS A;  1PG4 A;  1L2F A;  4JI6 C;  2CY1 A;  4FUT A;  1LCI A;  4MTN A;  3J81 D;  1WF3 A;  2CXC A;  3B7W A;  3L8C A;  1XS3 A;  3DAY A;  3DLP X;  3PBK A;  2P02 A;  4D57 A;  3I07 A;  2D7V A;  2QVX X;  2ZM6 C;  2VQF C;  2ASB A;  2P2Q A;  3DHV A;  4JI5 C;  4OX9 C;  1N2F A;  5LMU C;  1ZB9 A;  4DCV A;  5CZX A;  3RV2 A;  4WV3 A;  4BCA A;  2D1T A;  4B3R C;  3LGX A;  4RLQ A;  4R1M A;  2JMP A;  1XHJ A;  3ETO A;  1MXC A;  3VNS A;  2VQE C;  4LF4 C;  2ZZN A;  4XX2 A;  4JV5 C;  1IBK C;  1N32 C;  1RG9 A;  4YY3 C;  2UUC C;  3TDE A;  2PRO A;  2CU6 A;  4LE5 A;  3IEV A;  4I9F A;  2D28 C; 
#chains in the Genus database with same CATH homology
 4U5Y D;  1J5E C;  5BSV A;  2QVY X;  2XR1 A;  1VLA A;  2D1R A;  5BST A;  2PT7 G;  1HNX C;  4RLF A;  5KYV A;  4OXI A;  4JI2 C;  4G37 A;  4DR5 C;  5IWA C;  3VNQ A;  4LF5 C;  1XMO C;  1EGA A;  4ISB A;  5A19 A;  3EER A;  4PZP A;  1MDF A;  4JI0 C;  1USP A;  4ZJZ A;  3KXW A;  2UXB C;  2P20 A;  3NYR A;  2D1Q A;  1K0R A;  2EGT A;  3R9X A;  1PG3 A;  3LNV A;  3RG2 A;  1XRA A;  2DPL A;  4KTT A;  1MXB A;  4X66 C;  5K8F A;  4NXM C;  1IBM C;  2HHH C;  2QVZ X;  5GTD A;  4X62 C;  3IML A;  5BUS A;  4LFB C;  4RVO A;  2YCB A;  4DUY C;  3GR1 A;  4JI7 C;  1HNZ C;  5H9U A;  4DG9 A;  2E7G A;  5K85 A;  2E8E A;  2DYJ A;  4D4I A;  4KTV A;  3N2Q A;  4BC7 A;  4PHT A;  2PN2 A;  3IEU A;  1N34 C;  4DV5 C;  3SO4 A;  3E7X A;  1HNW C;  4GS5 A;  1V25 A;  2D27 A;  4GKJ C;  4G1I A;  4LF8 C;  2UU9 C;  3J80 D;  2F4V C;  4L2Z A;  5BSM A;  5IFI A;  4DV4 C;  4LF7 C;  1O93 A;  3GPC A;  4RVN A;  3TUF A;  5DV9 A;  1YJ7 A;  4GXQ A;  5A2Q D;  4I9G A;  2P2J A;  4L7I A;  2OPL B;  1PA4 A;  1O9T A;  3I08 A;  2ATW A;  3CJE A;  4RM2 A;  1IBL C;  4D4G A;  4G36 A;  1GPM A;  4GXR A;  3JAM D;  5AE2 A;  2VSQ A;  2YWB A;  1MKY A;  2VZE A;  3CW8 X;  3N54 B;  3J7A D;  4DV3 C;  4NDN A;  4YHH C;  4B3T C;  4JI8 C;  5E7Q A;  4FTF A;  2QW0 X;  5A1I A;  2ONF A;  3A9U A;  3PES A;  4ZLP A;  2BH1 X;  1LQL A;  3PRO C;  5FLX D;  3NPD A;  1P7L A;  2UXD C;  3G7S A;  3A9V A;  4FUQ A;  2WD9 A;  3E7W A;  5AE3 A;  2QL8 A;  1UKK A;  3UOW A;  2UXC C;  2P2M A;  4ODJ A;  2E8F A;  4IZ6 A;  4PRO C;  3UZ0 A;  2OPL A;  3EQ6 A;  3FCC A;  5BSR A;  4DV2 C;  3AF6 A;  2D1S A;  4K0B A;  3VNR A;  5BUQ A;  4DG8 A;  4JM1 A;  5KEI A;  1MDB A;  3C5E A;  4NOZ A;  1XNR C;  5LMN C;  2OO4 A;  1QM4 A;  1T5D X;  4BBY A;  5ADZ A;  1O92 A;  1QWI A;  4DV6 C;  1HR0 C;  4AQY C;  1FUG A;  2P2F A;  4L4Q A;  2P2B A;  4BSZ A;  1ULT A;  4DV0 C;  4DCU A;  4B3S C;  2AYA A;  2HJG A;  4RMN A;  4JI3 C;  5AE1 A;  4K0K C;  1V26 A;  5BR8 C;  4BC9 A;  4JI1 C;  2E5L C;  4DR6 C;  3CW9 A;  4JI4 C;  4DV7 C;  4OYC A;  4HPV A;  1XRB A;  1XNQ C;  1MD9 A;  2OBV A;  4DR7 C;  1N36 C;  3R9W A;  4DCT A;  3NYQ A;  4X64 C;  1RY2 A;  5A1G A;  3L95 X;  4RM3 A;  4GKK C;  4IR7 A;  1ZB8 A;  1USP B;  4EAT A;  3S82 A;  3FCE A;  4LFA C;  3T1Y C;  3OTO C;  2BJO A;  1KKG A;  3ETC A;  3AF5 A;  1WH9 A;  4TPS B;  2YWC A;  2E0G A;  4LFC C;  1O90 A;  2Y4O A;  4R1L A;  5BSW A;  5IT9 D;  3TQI A;  2Y27 A;  1I94 C;  4LF9 C;  2WP0 C;  5BUR A;  2KZF A;  2V7B A;  1N33 C;  3GR0 A;  1JOS A;  2UUB C;  1MXA A;  4DCS A;  1T5H X;  1BA3 A;  5KYT A;  3R44 A;  3A4I A;  4B3M C;  1ML8 A;  4DR1 C;  1XRC A;  4X65 C;  2UUA C;  4NXN C;  5JRH A;  4DR2 C;  1HH2 P;  1NYE A;  1XMQ C;  3H2T A;  4KHP C;  3LAX A;  1FJG C;  5BSU A;  4DV1 C;  4LF6 C;  5T8S A;  2E8C A;  2Y4N A;  5T8T A;  4D56 A;  4JYA C;  4DR3 C;  4R0M A;  4MH4 A;  5CZV A;  3IPL A;  4WS9 A;  3GKU A;  3NI2 A;  1AMU A;  4DR4 C;  3T1H C;  4DUZ C;  3LUS A;  1PG4 A;  1L2F A;  4JI6 C;  2CY1 A;  4FUT A;  1LCI A;  4MTN A;  3J81 D;  1WF3 A;  2CXC A;  3B7W A;  3L8C A;  3DAY A;  3DLP X;  3PBK A;  2P02 A;  4D57 A;  3I07 A;  2D7V A;  2QVX X;  2ZM6 C;  2VQF C;  2ASB A;  2P2Q A;  3DHV A;  4JI5 C;  4OX9 C;  1N2F A;  5LMU C;  1ZB9 A;  5CZX A;  4DCV A;  3RV2 A;  4WV3 A;  4BCA A;  2D1T A;  4B3R C;  3LGX A;  4RLQ A;  4R1M A;  2JMP A;  3ETO A;  1MXC A;  3VNS A;  2VQE C;  4LF4 C;  4XX2 A;  4JV5 C;  1IBK C;  1N32 C;  1RG9 A;  4YY3 C;  2UUC C;  3TDE A;  2PRO A;  4LE5 A;  3IEV A;  4I9F A;  2D28 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...