2UXDC

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uxdC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uxdC02
3LUSA 5LMUC 4JYAC 2ATWA 2KZFA 1ML8A 3R9XA 1N33C 4DV1C 4B3MC 1UKKA 4AQYC 3AF5A 1QWIA 3AF6A 4DV6C 4X65C 1FJGC 2OPLB 2DYJA 4X62C 4LF6C 2UUBC 1WH9A 2F4VC 1XNRC 4MH4A 4DR6C 4JV5C 1IBMC 2D7VA 4DV7C 1HNXC 3T1HC 2ZM6C 4KHPC 3J7AD 4YHHC 4JI2C 4DR7C 3OTOC 5BR8C 2ASBA 1N32C 2E5LC 1VLAA 5FLXD 2PN2A 4B3TC 2JMPA 1HNZC 4NXNC 1N36C 2EGTA 5LMNC 3EERA 1N34C 2UUCC 4DV5C 4OX9C 4JI0C 2PT7G 2UU9C 3CJEA 1WF3A 4JI4C 1N2FA 4JI8C 2UXBC 4B3RC 3JAMD 4YY3C 2OPLA 1PA4A 4XX2A 2UUAC 4DUYC 2XR1A 2E8CA 4DV4C 3IEUA 2VQEC 2ONFA 1IBLC 3GKUA 1XMQC 4LF4C 4DR2C 5A2QD 4DR1C 1XMOC 1USPB 4B3SC 2YCBA 4BSZA 1IBKC 4K0KC 4NOZA 2VQFC 1KKGA 1JOSA 1HNWC 1USPA 2HJGA 4JI5C 4GKJC 4DCVA 4MTNA 2HHHC 4DV0C 2QL8A 5IT9D 4JI6C 3R9WA 2E8FA 2UXDC 4LF9C 4DUZC 3I07A 4NXMC 1EGAA 4LF5C 4LFBC 4DR5C 4DCTA 1K0RA 3T1YC 1XNQC 4X66C 1MKYA 4DR3C 4DV3C 4LFCC 5IWAC 1HH2P 1I94C 4DCSA 1NYEA 4DR4C 2CY1A 4DCUA 2BJOA 1HR0C 1L2FA 4LF8C 3J81D 4LFAC 1ZB9A 1J5EC 3J80D 2UXCC 1ZB8A 4DV2C 3IEVA 2E8EA 4JI7C 4GKKC 4JI3C 4LF7C 2E7GA 4JI1C 2CXCA 4X64C 1LQLA
chains in the Genus database with same CATH superfamily
5LMUC 4JYAC 2KZFA 4DV1C 5K8FA 4B3MC 1UKKA 4RVNA 1QWIA 3DLPX 3DHVA 2OPLB 2DYJA 5BSTA 4LF6C 1RY2A 1UWDA 1GPMA 4PUGA 1IBMC 4D57A 1HNXC 2WP0C 3GR1A 2D1QA 3NYRA 2KDNA 2ASBA 2M5HA 1N32C 1O90A 5CZXA 5FLXD 2D1RA 1M6XA 1XRAA 4DV5C 1WF3A 4RMNA 4LE5A 4JI8C 5BSMA 3IPLA 4YY3C 5KYVA 4RVOA 3E7XA 3CQ3A 2E8CA 4DV4C 3O2EA 3RV2A 5A1IA 1USPB 1IBKC 5BUQA 1JOSA 4R1LA 1HNWC 4GKJC 4DCVA 4MTNA 1M6XC 4DV0C 3R9WA 4DUZC 3I07A 4D4GA 1QM4A 4L4QA 1EGAA 1NY8A 4U5YD 2Y27A 3T1YC 3VNSA 5CZVA 1PG3A 2P2BA 2P2FA 3KXWA 4DCSA 1MDBA 5BURA 1HR0C 2YWCA 5BSUA 1L2FA 2D1SA 2P20A 1ZB9A 2UXCC 1ZB8A 3IEVA 3FCCA 3NI2A 4JI1C 3EQ6A 3UOWA 2VSQA 4RLFA 2M5OA 2E0GA 2YX1A 2ATWA 1N33C 3A9VA 4AQYC 1O93A 4DV6C 4GXRA 2DPLA 4PHTA 4RM2A 5GTDA 4PUIA 3ETCA 1O92A 3CW8X 4JV5C 2P2MA 1MDFA 4DV7C 2ZM6C 1PG4A 4FUTA 1MXBA 2D27A 3TUFA 4YHHC 4G1IA 5BR8C 3S82A 4ODJA 3B7WA 1VLAA 2PN2A 1HNZC 1PU1A 3EERA 1N34C 3UX3A 2UUCC 4JM1A 2UU9C 3CJEA 4JI4C 4BCAA 1N2FA 4DG8A 4B3RC 2WD9A 4ZJZA 4XX2A 5E7QA 4GXQA 4DUYC 3IEUA 3NPDA 1XMQC 2D28C 4LF4C 4DR2C 4RM3A 5A2QD 1RG9A 4I9FA 1XMOC 4B3SC 3GPCA 4BSZA 1FUGA 1KKGA 3LGXA 1USPA 2HJGA 4PZPA 3UEBA 2HHHC 2QVZX 5IT9D 1VEHA 3UZ0A 5H9UA 2E8FA 3CQ1A 4I9GA 3A26A 4NXMC 5AE1A 4LF5C 5A1GA 1AMUA 1XNQC 3PESA 4BC9A 1XRCA 1HH2P 1NYEA 4DR4C 4DCUA 2AYAA 2BJOA 3A4IA 4LF8C 5LCIA 2MCQA 4KTVA 2MMAB 1MXCA 1J5EC 4DV2C 1XHJA 4JI3C 2Y4OA 3PROC 4OYCA 2E7GA 1FLOA 4L7IA 3LUSA 5T8TA 4G36A 3GR0A 4WV3A 1ML8A 3R9XA 4KTTA 2CU6A 2Z51A 3AF5A 3TR3A 3AF6A 3H2TA 3AY0A 1ULTA 1V60A 4PUHA 3FCEA 4MH4A 4L2ZA 5AE2A 5DV9A 3VNRA 2D7VA 3J7AD 4DR7C 4IZ6A 1T5DX 3L95X 4NDNA 2E5LC 4PROC 2KZ0A 5K85A 3NYQA 4RLQA 2QW0X 4JI0C 2PT7G 3LAXA 1P7LA 2ZTBA 2OPLA 1TH5A 4HPVA 2XR1A 4D56A 1IBLC 4ZLPA 4DG9A 3CQ2A 4NOZA 4D4IA 2VQFC 4FTFA 5JRHA 2YWBA 4JI6C 1XDXA 3G7SA 4DCTA 4FUQA 3N2QA 5A19A 3R44A 1BA3A 4DR3C 4DV3C 1I94C 2DHMA 1MXAA 2CY1A 5T8SA 2PG1E 3LNVA 3J80D 4EATA 2E8EA 4JI7C 5BSVA 4LF7C 2D1TA 4BBYA 1YJ7A 5KYTA 2CXCA 2P2JA 4X64C 4OXIA 1T5HX 2VZEA 4G37A 3VNQA 1LQLA 3I08A 5KEIA 3K6RA 4ISBA 1LCIA 1FJGC 4R0MA 4X65C 4X62C 3IMLA 2UUBC 3TQIA 3ETOA 1WH9A 2F4VC 1XNRC 4DR6C 1V26A 1P4EA 3PBKA 3T1HC 5BUSA 4GS5A 4BC7A 4KHPC 2BH1X 3E7WA 4JI2C 3OTOC 4B3TC 2JMPA 4IR7A 1N36C 2EGTA 4NXNC 5LMNC 4OX9C 2UXBC 1P4EC 3CW9A 1IB8A 3JAMD 1PA4A 2UUAC 1MD9A 3FM7A 2ZZNA 5BSWA 2P02A 2VQEC 2ONFA 3GKUA 2OBVA 1WCJA 5BSRA 3TDEA 2QVXX 4DR1C 3DAYA 2YCBA 1V25A 2NCLA 4K0KC 1XS3A 4JI5C 2QL8A 2Y4NA 2UXDC 4LF9C 2JNVA 5IFIA 3A9UA 4LFBC 2QVYX 4DR5C 3RG2A 1K0RA 4R1MA 5ADZA 3C5EA 1O9TA 3N54B 5AE3A 4X66C 1MKYA 4LFCC 5IWAC 3UX2A 3SO4A 1YGTA 4TPSB 3L8CA 2V7BA 3J81D 4K0BA 4LFAC 2OO4A 3A25A 2MM9A 4GKKC 3LNOA 1XRBA 4WS9A 2P2QA 2ZZMA 2PROA
chains in the Genus database with same CATH topology
5LMUC 4JYAC 2KZFA 4DV1C 5K8FA 4B3MC 1UKKA 4RVNA 1QWIA 3DLPX 3DHVA 2OPLB 2DYJA 5BSTA 4LF6C 1RY2A 1GPMA 1IBMC 4D57A 1HNXC 2WP0C 3GR1A 2D1QA 3NYRA 2ASBA 1N32C 1O90A 5CZXA 5FLXD 2D1RA 1XRAA 4DV5C 1WF3A 4RMNA 4LE5A 4JI8C 5BSMA 3IPLA 4YY3C 5KYVA 4RVOA 3E7XA 2E8CA 4DV4C 3RV2A 5A1IA 1USPB 1IBKC 5BUQA 1JOSA 4R1LA 1HNWC 4GKJC 4DCVA 4MTNA 4DV0C 3R9WA 4DUZC 3I07A 4D4GA 1QM4A 4L4QA 1EGAA 4U5YD 2Y27A 3T1YC 3VNSA 5CZVA 1PG3A 2P2BA 2P2FA 3KXWA 4DCSA 1MDBA 5BURA 1HR0C 2YWCA 5BSUA 1L2FA 2D1SA 2P20A 1ZB9A 2UXCC 1ZB8A 3IEVA 3FCCA 3NI2A 4JI1C 3EQ6A 3UOWA 2VSQA 4RLFA 2E0GA 2ATWA 1N33C 3A9VA 4AQYC 1O93A 4DV6C 4GXRA 2DPLA 4PHTA 4RM2A 5GTDA 3ETCA 1O92A 3CW8X 4JV5C 2P2MA 1MDFA 4DV7C 2ZM6C 1PG4A 4FUTA 1MXBA 2D27A 3TUFA 4YHHC 4G1IA 5BR8C 3S82A 4ODJA 3B7WA 1VLAA 2PN2A 1HNZC 3EERA 1N34C 2UUCC 4JM1A 2UU9C 3CJEA 4JI4C 4BCAA 1N2FA 4DG8A 4B3RC 2WD9A 4ZJZA 4XX2A 5E7QA 4GXQA 4DUYC 3IEUA 3NPDA 1XMQC 2D28C 4LF4C 4DR2C 4RM3A 5A2QD 1RG9A 4I9FA 1XMOC 4B3SC 3GPCA 4BSZA 1FUGA 1KKGA 3LGXA 1USPA 2HJGA 4PZPA 2HHHC 2QVZX 5IT9D 3UZ0A 5H9UA 2E8FA 4I9GA 4NXMC 5AE1A 4LF5C 5A1GA 1AMUA 1XNQC 3PESA 4BC9A 1XRCA 1HH2P 1NYEA 4DR4C 4DCUA 2AYAA 2BJOA 3A4IA 4LF8C 4KTVA 1MXCA 1J5EC 4DV2C 4JI3C 2Y4OA 3PROC 4OYCA 2E7GA 4L7IA 3LUSA 5T8TA 4G36A 3GR0A 4WV3A 1ML8A 3R9XA 4KTTA 3AF5A 3AF6A 3H2TA 1ULTA 3FCEA 4MH4A 4L2ZA 5AE2A 5DV9A 3VNRA 2D7VA 3J7AD 4DR7C 4IZ6A 1T5DX 3L95X 4NDNA 2E5LC 4PROC 5K85A 3NYQA 4RLQA 2QW0X 4JI0C 2PT7G 3LAXA 1P7LA 2OPLA 4HPVA 2XR1A 4D56A 1IBLC 4ZLPA 4DG9A 4NOZA 4D4IA 2VQFC 4FTFA 5JRHA 2YWBA 4JI6C 3G7SA 4DCTA 4FUQA 3N2QA 5A19A 3R44A 1BA3A 4DR3C 4DV3C 1I94C 1MXAA 2CY1A 5T8SA 3LNVA 3J80D 4EATA 2E8EA 4JI7C 5BSVA 4LF7C 2D1TA 4BBYA 1YJ7A 5KYTA 2CXCA 4X64C 2P2JA 4OXIA 1T5HX 2VZEA 4G37A 3VNQA 1LQLA 3I08A 5KEIA 4ISBA 1LCIA 1FJGC 4R0MA 4X65C 4X62C 3IMLA 2UUBC 3TQIA 3ETOA 1WH9A 2F4VC 1XNRC 4DR6C 1V26A 3PBKA 3T1HC 5BUSA 4GS5A 4BC7A 4KHPC 2BH1X 3E7WA 4JI2C 3OTOC 4B3TC 2JMPA 4IR7A 1N36C 2EGTA 4NXNC 5LMNC 4OX9C 2UXBC 3CW9A 3JAMD 1PA4A 2UUAC 1MD9A 5BSWA 2P02A 2VQEC 2ONFA 3GKUA 2OBVA 5BSRA 3TDEA 2QVXX 4DR1C 3DAYA 2YCBA 1V25A 4K0KC 4JI5C 2QL8A 2Y4NA 2UXDC 4LF9C 5IFIA 3A9UA 4LFBC 2QVYX 4DR5C 3RG2A 1K0RA 4R1MA 5ADZA 3C5EA 1O9TA 3N54B 5AE3A 4X66C 1MKYA 4LFCC 5IWAC 3SO4A 4TPSB 3L8CA 2V7BA 3J81D 4K0BA 4LFAC 2OO4A 4GKKC 1XRBA 4WS9A 2P2QA 2PROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LUS A;  5LMU C;  4JYA C;  2ATW A;  2KZF A;  1ML8 A;  3R9X A;  1N33 C;  4DV1 C;  4B3M C;  1UKK A;  4AQY C;  3AF5 A;  1QWI A;  3AF6 A;  4DV6 C;  4X65 C;  1FJG C;  2OPL B;  2DYJ A;  4X62 C;  4LF6 C;  2UUB C;  1WH9 A;  2F4V C;  1XNR C;  4MH4 A;  4DR6 C;  4JV5 C;  1IBM C;  2D7V A;  4DV7 C;  1HNX C;  3T1H C;  2ZM6 C;  4KHP C;  3J7A D;  4YHH C;  4JI2 C;  4DR7 C;  3OTO C;  5BR8 C;  2ASB A;  1N32 C;  2E5L C;  1VLA A;  5FLX D;  2PN2 A;  4B3T C;  2JMP A;  1HNZ C;  4NXN C;  1N36 C;  2EGT A;  5LMN C;  3EER A;  1N34 C;  2UUC C;  4DV5 C;  4OX9 C;  4JI0 C;  2PT7 G;  2UU9 C;  3CJE A;  1WF3 A;  4JI4 C;  1N2F A;  4JI8 C;  2UXB C;  4B3R C;  3JAM D;  4YY3 C;  2OPL A;  1PA4 A;  4XX2 A;  2UUA C;  4DUY C;  2XR1 A;  2E8C A;  4DV4 C;  3IEU A;  2VQE C;  2ONF A;  1IBL C;  3GKU A;  1XMQ C;  4LF4 C;  4DR2 C;  5A2Q D;  4DR1 C;  1XMO C;  1USP B;  4B3S C;  2YCB A;  4BSZ A;  1IBK C;  4K0K C;  4NOZ A;  2VQF C;  1KKG A;  1JOS A;  1HNW C;  1USP A;  2HJG A;  4JI5 C;  4GKJ C;  4DCV A;  4MTN A;  2HHH C;  4DV0 C;  2QL8 A;  5IT9 D;  4JI6 C;  3R9W A;  2E8F A;  2UXD C;  4LF9 C;  4DUZ C;  3I07 A;  4NXM C;  1EGA A;  4LF5 C;  4LFB C;  4DR5 C;  4DCT A;  1K0R A;  3T1Y C;  1XNQ C;  4X66 C;  1MKY A;  4DR3 C;  4DV3 C;  4LFC C;  5IWA C;  1HH2 P;  1I94 C;  4DCS A;  1NYE A;  4DR4 C;  2CY1 A;  4DCU A;  2BJO A;  1HR0 C;  1L2F A;  4LF8 C;  3J81 D;  4LFA C;  1ZB9 A;  1J5E C;  3J80 D;  2UXC C;  1ZB8 A;  4DV2 C;  3IEV A;  2E8E A;  4JI7 C;  4GKK C;  4JI3 C;  4LF7 C;  2E7G A;  4JI1 C;  2CXC A;  4X64 C;  1LQL A; 
#chains in the Genus database with same CATH topology
 5LMU C;  4JYA C;  2KZF A;  4DV1 C;  5K8F A;  4B3M C;  1UKK A;  4RVN A;  1QWI A;  3DLP X;  3DHV A;  2OPL B;  2DYJ A;  5BST A;  4LF6 C;  1RY2 A;  1UWD A;  1GPM A;  4PUG A;  1IBM C;  4D57 A;  1HNX C;  2WP0 C;  3GR1 A;  2D1Q A;  3NYR A;  2KDN A;  2ASB A;  2M5H A;  1N32 C;  1O90 A;  5CZX A;  5FLX D;  2D1R A;  1M6X A;  1XRA A;  4DV5 C;  1WF3 A;  4RMN A;  4LE5 A;  4JI8 C;  5BSM A;  3IPL A;  4YY3 C;  5KYV A;  4RVO A;  3E7X A;  3CQ3 A;  2E8C A;  4DV4 C;  3O2E A;  3RV2 A;  5A1I A;  1USP B;  1IBK C;  5BUQ A;  1JOS A;  4R1L A;  1HNW C;  4GKJ C;  4DCV A;  4MTN A;  1M6X C;  4DV0 C;  3R9W A;  4DUZ C;  3I07 A;  4D4G A;  1QM4 A;  4L4Q A;  1EGA A;  1NY8 A;  4U5Y D;  2Y27 A;  3T1Y C;  3VNS A;  5CZV A;  1PG3 A;  2P2B A;  2P2F A;  3KXW A;  4DCS A;  1MDB A;  5BUR A;  1HR0 C;  2YWC A;  5BSU A;  1L2F A;  2D1S A;  2P20 A;  1ZB9 A;  2UXC C;  1ZB8 A;  3IEV A;  3FCC A;  3NI2 A;  4JI1 C;  3EQ6 A;  3UOW A;  2VSQ A;  4RLF A;  2M5O A;  2E0G A;  2YX1 A;  2ATW A;  1N33 C;  3A9V A;  4AQY C;  1O93 A;  4DV6 C;  4GXR A;  2DPL A;  4PHT A;  4RM2 A;  5GTD A;  4PUI A;  3ETC A;  1O92 A;  3CW8 X;  4JV5 C;  2P2M A;  1MDF A;  4DV7 C;  2ZM6 C;  1PG4 A;  4FUT A;  1MXB A;  2D27 A;  3TUF A;  4YHH C;  4G1I A;  5BR8 C;  3S82 A;  4ODJ A;  3B7W A;  1VLA A;  2PN2 A;  1HNZ C;  1PU1 A;  3EER A;  1N34 C;  3UX3 A;  2UUC C;  4JM1 A;  2UU9 C;  3CJE A;  4JI4 C;  4BCA A;  1N2F A;  4DG8 A;  4B3R C;  2WD9 A;  4ZJZ A;  4XX2 A;  5E7Q A;  4GXQ A;  4DUY C;  3IEU A;  3NPD A;  1XMQ C;  2D28 C;  4LF4 C;  4DR2 C;  4RM3 A;  5A2Q D;  1RG9 A;  4I9F A;  1XMO C;  4B3S C;  3GPC A;  4BSZ A;  1FUG A;  1KKG A;  3LGX A;  1USP A;  2HJG A;  4PZP A;  3UEB A;  2HHH C;  2QVZ X;  5IT9 D;  1VEH A;  3UZ0 A;  5H9U A;  2E8F A;  3CQ1 A;  4I9G A;  3A26 A;  4NXM C;  5AE1 A;  4LF5 C;  5A1G A;  1AMU A;  1XNQ C;  3PES A;  4BC9 A;  1XRC A;  1HH2 P;  1NYE A;  4DR4 C;  4DCU A;  2AYA A;  2BJO A;  3A4I A;  4LF8 C;  5LCI A;  2MCQ A;  4KTV A;  2MMA B;  1MXC A;  1J5E C;  4DV2 C;  1XHJ A;  4JI3 C;  2Y4O A;  3PRO C;  4OYC A;  2E7G A;  1FLO A;  4L7I A;  3LUS A;  5T8T A;  4G36 A;  3GR0 A;  4WV3 A;  1ML8 A;  3R9X A;  4KTT A;  2CU6 A;  2Z51 A;  3AF5 A;  3TR3 A;  3AF6 A;  3H2T A;  3AY0 A;  1ULT A;  1V60 A;  4PUH A;  3FCE A;  4MH4 A;  4L2Z A;  5AE2 A;  5DV9 A;  3VNR A;  2D7V A;  3J7A D;  4DR7 C;  4IZ6 A;  1T5D X;  3L95 X;  4NDN A;  2E5L C;  4PRO C;  2KZ0 A;  5K85 A;  3NYQ A;  4RLQ A;  2QW0 X;  4JI0 C;  2PT7 G;  3LAX A;  1P7L A;  2ZTB A;  2OPL A;  1TH5 A;  4HPV A;  2XR1 A;  4D56 A;  1IBL C;  4ZLP A;  4DG9 A;  3CQ2 A;  4NOZ A;  4D4I A;  2VQF C;  4FTF A;  5JRH A;  2YWB A;  4JI6 C;  1XDX A;  3G7S A;  4DCT A;  4FUQ A;  3N2Q A;  5A19 A;  3R44 A;  1BA3 A;  4DR3 C;  4DV3 C;  1I94 C;  2DHM A;  1MXA A;  2CY1 A;  5T8S A;  2PG1 E;  3LNV A;  3J80 D;  4EAT A;  2E8E A;  4JI7 C;  5BSV A;  4LF7 C;  2D1T A;  4BBY A;  1YJ7 A;  5KYT A;  2CXC A;  2P2J A;  4X64 C;  4OXI A;  1T5H X;  2VZE A;  4G37 A;  3VNQ A;  1LQL A;  3I08 A;  5KEI A;  3K6R A;  4ISB A;  1LCI A;  1FJG C;  4R0M A;  4X65 C;  4X62 C;  3IML A;  2UUB C;  3TQI A;  3ETO A;  1WH9 A;  2F4V C;  1XNR C;  4DR6 C;  1V26 A;  1P4E A;  3PBK A;  3T1H C;  5BUS A;  4GS5 A;  4BC7 A;  4KHP C;  2BH1 X;  3E7W A;  4JI2 C;  3OTO C;  4B3T C;  2JMP A;  4IR7 A;  1N36 C;  2EGT A;  4NXN C;  5LMN C;  4OX9 C;  2UXB C;  1P4E C;  3CW9 A;  1IB8 A;  3JAM D;  1PA4 A;  2UUA C;  1MD9 A;  3FM7 A;  2ZZN A;  5BSW A;  2P02 A;  2VQE C;  2ONF A;  3GKU A;  2OBV A;  1WCJ A;  5BSR A;  3TDE A;  2QVX X;  4DR1 C;  3DAY A;  2YCB A;  1V25 A;  2NCL A;  4K0K C;  1XS3 A;  4JI5 C;  2QL8 A;  2Y4N A;  2UXD C;  4LF9 C;  2JNV A;  5IFI A;  3A9U A;  4LFB C;  2QVY X;  4DR5 C;  3RG2 A;  1K0R A;  4R1M A;  5ADZ A;  3C5E A;  1O9T A;  3N54 B;  5AE3 A;  4X66 C;  1MKY A;  4LFC C;  5IWA C;  3UX2 A;  3SO4 A;  1YGT A;  4TPS B;  3L8C A;  2V7B A;  3J81 D;  4K0B A;  4LFA C;  2OO4 A;  3A25 A;  2MM9 A;  4GKK C;  3LNO A;  1XRB A;  4WS9 A;  2P2Q A;  2ZZM A;  2PRO A; 
#chains in the Genus database with same CATH homology
 5LMU C;  4JYA C;  2KZF A;  4DV1 C;  5K8F A;  4B3M C;  1UKK A;  4RVN A;  1QWI A;  3DLP X;  3DHV A;  2OPL B;  2DYJ A;  5BST A;  4LF6 C;  1RY2 A;  1GPM A;  1IBM C;  4D57 A;  1HNX C;  2WP0 C;  3GR1 A;  2D1Q A;  3NYR A;  2ASB A;  1N32 C;  1O90 A;  5CZX A;  5FLX D;  2D1R A;  1XRA A;  4DV5 C;  1WF3 A;  4RMN A;  4LE5 A;  4JI8 C;  5BSM A;  3IPL A;  4YY3 C;  5KYV A;  4RVO A;  3E7X A;  2E8C A;  4DV4 C;  3RV2 A;  5A1I A;  1USP B;  1IBK C;  5BUQ A;  1JOS A;  4R1L A;  1HNW C;  4GKJ C;  4DCV A;  4MTN A;  4DV0 C;  3R9W A;  4DUZ C;  3I07 A;  4D4G A;  1QM4 A;  4L4Q A;  1EGA A;  4U5Y D;  2Y27 A;  3T1Y C;  3VNS A;  5CZV A;  1PG3 A;  2P2B A;  2P2F A;  3KXW A;  4DCS A;  1MDB A;  5BUR A;  1HR0 C;  2YWC A;  5BSU A;  1L2F A;  2D1S A;  2P20 A;  1ZB9 A;  2UXC C;  1ZB8 A;  3IEV A;  3FCC A;  3NI2 A;  4JI1 C;  3EQ6 A;  3UOW A;  2VSQ A;  4RLF A;  2E0G A;  2ATW A;  1N33 C;  3A9V A;  4AQY C;  1O93 A;  4DV6 C;  4GXR A;  2DPL A;  4PHT A;  4RM2 A;  5GTD A;  3ETC A;  1O92 A;  3CW8 X;  4JV5 C;  2P2M A;  1MDF A;  4DV7 C;  2ZM6 C;  1PG4 A;  4FUT A;  1MXB A;  2D27 A;  3TUF A;  4YHH C;  4G1I A;  5BR8 C;  3S82 A;  4ODJ A;  3B7W A;  1VLA A;  2PN2 A;  1HNZ C;  3EER A;  1N34 C;  2UUC C;  4JM1 A;  2UU9 C;  3CJE A;  4JI4 C;  4BCA A;  1N2F A;  4DG8 A;  4B3R C;  2WD9 A;  4ZJZ A;  4XX2 A;  5E7Q A;  4GXQ A;  4DUY C;  3IEU A;  3NPD A;  1XMQ C;  2D28 C;  4LF4 C;  4DR2 C;  4RM3 A;  5A2Q D;  1RG9 A;  4I9F A;  1XMO C;  4B3S C;  3GPC A;  4BSZ A;  1FUG A;  1KKG A;  3LGX A;  1USP A;  2HJG A;  4PZP A;  2HHH C;  2QVZ X;  5IT9 D;  3UZ0 A;  5H9U A;  2E8F A;  4I9G A;  4NXM C;  5AE1 A;  4LF5 C;  5A1G A;  1AMU A;  1XNQ C;  3PES A;  4BC9 A;  1XRC A;  1HH2 P;  1NYE A;  4DR4 C;  4DCU A;  2AYA A;  2BJO A;  3A4I A;  4LF8 C;  4KTV A;  1MXC A;  1J5E C;  4DV2 C;  4JI3 C;  2Y4O A;  3PRO C;  4OYC A;  2E7G A;  4L7I A;  3LUS A;  5T8T A;  4G36 A;  3GR0 A;  4WV3 A;  1ML8 A;  3R9X A;  4KTT A;  3AF5 A;  3AF6 A;  3H2T A;  1ULT A;  3FCE A;  4MH4 A;  4L2Z A;  5AE2 A;  5DV9 A;  3VNR A;  2D7V A;  3J7A D;  4DR7 C;  4IZ6 A;  1T5D X;  3L95 X;  4NDN A;  2E5L C;  4PRO C;  5K85 A;  3NYQ A;  4RLQ A;  2QW0 X;  4JI0 C;  2PT7 G;  3LAX A;  1P7L A;  2OPL A;  4HPV A;  2XR1 A;  4D56 A;  1IBL C;  4ZLP A;  4DG9 A;  4NOZ A;  4D4I A;  2VQF C;  4FTF A;  5JRH A;  2YWB A;  4JI6 C;  3G7S A;  4DCT A;  4FUQ A;  3N2Q A;  5A19 A;  3R44 A;  1BA3 A;  4DR3 C;  4DV3 C;  1I94 C;  1MXA A;  2CY1 A;  5T8S A;  3LNV A;  3J80 D;  4EAT A;  2E8E A;  4JI7 C;  5BSV A;  4LF7 C;  2D1T A;  4BBY A;  1YJ7 A;  5KYT A;  2CXC A;  4X64 C;  2P2J A;  4OXI A;  1T5H X;  2VZE A;  4G37 A;  3VNQ A;  1LQL A;  3I08 A;  5KEI A;  4ISB A;  1LCI A;  1FJG C;  4R0M A;  4X65 C;  4X62 C;  3IML A;  2UUB C;  3TQI A;  3ETO A;  1WH9 A;  2F4V C;  1XNR C;  4DR6 C;  1V26 A;  3PBK A;  3T1H C;  5BUS A;  4GS5 A;  4BC7 A;  4KHP C;  2BH1 X;  3E7W A;  4JI2 C;  3OTO C;  4B3T C;  2JMP A;  4IR7 A;  1N36 C;  2EGT A;  4NXN C;  5LMN C;  4OX9 C;  2UXB C;  3CW9 A;  3JAM D;  1PA4 A;  2UUA C;  1MD9 A;  5BSW A;  2P02 A;  2VQE C;  2ONF A;  3GKU A;  2OBV A;  5BSR A;  3TDE A;  2QVX X;  4DR1 C;  3DAY A;  2YCB A;  1V25 A;  4K0K C;  4JI5 C;  2QL8 A;  2Y4N A;  2UXD C;  4LF9 C;  5IFI A;  3A9U A;  4LFB C;  2QVY X;  4DR5 C;  3RG2 A;  1K0R A;  4R1M A;  5ADZ A;  3C5E A;  1O9T A;  3N54 B;  5AE3 A;  4X66 C;  1MKY A;  4LFC C;  5IWA C;  3SO4 A;  4TPS B;  3L8C A;  2V7B A;  3J81 D;  4K0B A;  4LFA C;  2OO4 A;  4GKK C;  1XRB A;  4WS9 A;  2P2Q A;  2PRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...