2UXDC

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uxdC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uxdC02
1ML8A 1UKKA 2UUBC 2D7VA 4JI6C 4GKKC 4XX2A 1VLAA 2VQFC 4YHHC 4DCSA 4DV4C 2F4VC 3R9WA 2VQEC 1JOSA 2KZFA 1IBLC 2YCBA 4OX9C 4X65C 1I94C 1FJGC 2E5LC 2DYJA 3LUSA 4DV6C 1WF3A 2HJGA 4DV1C 4LFCC 2ASBA 4DCVA 4NXNC 4B3MC 2EGTA 3AF6A 1K0RA 3EERA 3R9XA 1KKGA 4MTNA 1IBKC 5BR8C 4JI0C 2ZM6C 1HR0C 4LF4C 4K0KC 2CXCA 4DUZC 4X66C 4X62C 1L2FA 2PN2A 1WH9A 3AF5A 1LQLA 4JI7C 4DR7C 2PT7G 4DV3C 1MKYA 2E8EA 4NXMC 1J5EC 3T1YC 2UXDC 4JI4C 4LFAC 2BJOA 4JI8C 4YY3C 4DR6C 1N36C 4JI3C 4B3SC 3J7AD 1N32C 2HHHC 4DV7C 3OTOC 1XNQC 4LF7C 1XNRC 4DV0C 3J81D 4DR4C 4DCTA 1ZB9A 2JMPA 3I07A 1XMOC 4JI5C 4NOZA 5IWAC 3T1HC 4MH4A 4B3TC 2QL8A 4B3RC 5FLXD 2E8FA 1QWIA 2CY1A 2ONFA 4JI2C 4JYAC 5IT9D 3IEUA 1NYEA 4BSZA 3IEVA 1PA4A 2OPLB 2XR1A 2UU9C 2UUCC 3JAMD 4JI1C 4LF6C 1HH2P 1HNWC 4DV2C 3J80D 4LF8C 1N34C 4DCUA 5LMNC 1HNZC 2E8CA 2E7GA 5LMUC 4DUYC 4DR1C 4AQYC 2UUAC 2OPLA 4DR3C 1USPB 4KHPC 4GKJC 1ZB8A 3CJEA 4JV5C 1N33C 1USPA 4X64C 4LF5C 4LF9C 2UXBC 1XMQC 3GKUA 4LFBC 4DV5C 1HNXC 2UXCC 4DR2C 1EGAA 2ATWA 1N2FA 5A2QD 4DR5C 1IBMC
chains in the Genus database with same CATH superfamily
2KZ0A 3KXWA 2UUBC 2D7VA 5K85A 4XX2A 4DCSA 3GR0A 3FCEA 3S82A 2DHMA 5IFIA 5DV9A 1IBLC 1XDXA 2Y4NA 2YCBA 4OX9C 4X65C 1I94C 2WD9A 4BBYA 2DYJA 4DV6C 4PUIA 4BC9A 4L4QA 1V25A 4D57A 4RVOA 3R9XA 3B7WA 1UWDA 1IBKC 2ZM6C 2PROA 4K0KC 3NYQA 1ULTA 2M5HA 4U5YD 3AF5A 3G7SA 1LQLA 1WCJA 3FM7A 1MXBA 4DR7C 2PT7G 5A19A 2BH1X 4G36A 2E8EA 4NXMC 3RG2A 2UXDC 4YY3C 1N36C 1O92A 2P02A 4KTVA 3L8CA 2HHHC 4DV7C 3LNOA 3N2QA 1XNRC 1MXAA 3J81D 1ZB9A 4JI5C 5AE3A 4FTFA 4MH4A 4RM3A 2QL8A 4B3RC 5FLXD 2E8FA 3VNRA 1QWIA 5BURA 4JI2C 5IT9D 1YGTA 4D4IA 2UUCC 3LAXA 3PROC 1HNWC 1O9TA 3J80D 5LMNC 4FUQA 2E8CA 4BCAA 4TPSB 1FLOA 5GTDA 1USPB 5K8FA 4EATA 4GKJC 2WP0C 2P2MA 4GS5A 3ETCA 1NY8A 2KDNA 2D1RA 3LGXA 1USPA 4LF5C 4GXRA 2P2QA 5BSWA 5E7QA 1XMQC 3R44A 3ETOA 4DR2C 2VSQA 1ML8A 3CW8X 2JNVA 5T8TA 3NYRA 1VLAA 5T8SA 4YHHC 2F4VC 3A9VA 2QVZX 4D4GA 3DHVA 2E5LC 3TQIA 5KYTA 4PROC 1V60A 1WF3A 2HJGA 2D1TA 2OBVA 4DV1C 5BSUA 4LFCC 1PG4A 4B3MC 4I9FA 3EERA 1HR0C 4LF4C 2MM9A 2YWCA 1WH9A 2M5OA 4JI7C 1MKYA 3T1YC 5LCIA 1PG3A 1FUGA 1MDFA 4JI8C 2AYAA 4DR6C 4B3SC 2P20A 3UOWA 2D28C 2QVYX 1BA3A 1P7LA 4BC7A 2YWBA 3GR1A 1N32C 4DCTA 4IR7A 3O2EA 1XMOC 4NOZA 1TH5A 4B3TC 2QVXX 2CY1A 1YJ7A 3IEVA 1XRCA 2OPLB 3SO4A 4ISBA 4LE5A 5BSRA 2OO4A 2V7BA 2ZZMA 3LNVA 4DUYC 4AQYC 2UUAC 2OPLA 1T5HX 4KHPC 4WS9A 2Y4OA 4IZ6A 1ZB8A 4R0MA 4JV5C 3TDEA 3UEBA 3GKUA 4LFBC 4DV5C 2P2JA 2E0GA 5BSVA 5A2QD 3UZ0A 1MD9A 3C5EA 1QM4A 2VQFC 4DV4C 5BUQA 1MDBA 3R9WA 4KTTA 4ZLPA 1JOSA 3TUFA 3FCCA 3AY0A 2PG1E 1FJGC 3A4IA 2MCQA 2ASBA 4DCVA 3GPCA 5BR8C 3A9UA 2CXCA 4DUZC 4X66C 3DLPX 3CQ2A 4HPVA 4R1MA 1MXCA 5A1IA 4PHTA 1J5EC 4OYCA 4JI4C 4JI3C 4PUGA 4WV3A 2Y27A 3J7AD 2ZTBA 4K0BA 1GPMA 1XNQC 5CZVA 1M6XC 1RY2A 4DR4C 1O93A 2ONFA 1NYEA 4BSZA 4DG8A 5ADZA 3K6RA 3JAMD 5AE1A 4LF6C 1HH2P 4DG9A 1XHJA 2D1QA 2MMAB 3UX2A 2E7GA 1XRBA 4RMNA 3UX3A 4DR3C 3A26A 5AE2A 4L7IA 3PESA 4ZJZA 1P4EC 3NI2A 1N33C 3CQ3A 2UXBC 4RLQA 3CW9A 1N2FA 1IBMC 1UKKA 2YX1A 1O90A 3N54B 3VNSA 4JI6C 4R1LA 3IPLA 4GKKC 4I9GA 2VQEC 2KZFA 3IMLA 3VNQA 1V26A 3DAYA 5JRHA 3LUSA 4GXQA 4FUTA 4NXNC 5KYVA 2EGTA 1K0RA 3AF6A 1KKGA 5H9UA 3CQ1A 4MTNA 4JI0C 4X62C 1L2FA 4L2ZA 2PN2A 1VEHA 3NPDA 1XS3A 3RV2A 3EQ6A 2P2BA 1AMUA 1M6XA 4DV3C 1RG9A 3A25A 2CU6A 3TR3A 2QW0X 4LFAC 2BJOA 5BSMA 4JM1A 4RM2A 1T5DX 2Z51A 4PZPA 1LCIA 4OXIA 4PUHA 2D27A 4G37A 4RVNA 3OTOC 4LF7C 4NDNA 4DV0C 4ODJA 5A1GA 3E7XA 2JMPA 3I07A 4G1IA 5IWAC 3T1HC 2VZEA 2ZZNA 1XRAA 5CZXA 4JYAC 3IEUA 2DPLA 1PA4A 2XR1A 2UU9C 1P4EA 4JI1C 4DV2C 4LF8C 5BUSA 1N34C 3L95X 4DCUA 1HNZC 5LMUC 4DR1C 3H2TA 2NCLA 5BSTA 3E7WA 3PBKA 4D56A 5KEIA 2P2FA 3CJEA 3I08A 4LF9C 4X64C 1HNXC 2UXCC 1IB8A 1EGAA 2ATWA 4RLFA 1PU1A 4DR5C 2D1SA
chains in the Genus database with same CATH topology
3KXWA 2UUBC 2D7VA 5K85A 4XX2A 4DCSA 3GR0A 3FCEA 3S82A 5IFIA 5DV9A 1IBLC 2Y4NA 2YCBA 4OX9C 4X65C 1I94C 2WD9A 4BBYA 2DYJA 4DV6C 4BC9A 4L4QA 1V25A 4D57A 4RVOA 3R9XA 3B7WA 1IBKC 2ZM6C 2PROA 4K0KC 3NYQA 1ULTA 4U5YD 3AF5A 3G7SA 1LQLA 1MXBA 4DR7C 2PT7G 5A19A 2BH1X 4G36A 2E8EA 4NXMC 3RG2A 2UXDC 4YY3C 1N36C 1O92A 2P02A 4KTVA 3L8CA 2HHHC 4DV7C 3N2QA 1XNRC 1MXAA 3J81D 1ZB9A 4JI5C 5AE3A 4FTFA 4MH4A 4RM3A 2QL8A 4B3RC 5FLXD 2E8FA 3VNRA 1QWIA 5BURA 4JI2C 5IT9D 4D4IA 2UUCC 3LAXA 3PROC 1HNWC 1O9TA 3J80D 5LMNC 4FUQA 2E8CA 4BCAA 4TPSB 5GTDA 1USPB 5K8FA 4EATA 4GKJC 2WP0C 2P2MA 4GS5A 3ETCA 2D1RA 3LGXA 1USPA 4LF5C 4GXRA 2P2QA 5BSWA 5E7QA 1XMQC 3R44A 3ETOA 4DR2C 2VSQA 1ML8A 3CW8X 5T8TA 3NYRA 1VLAA 5T8SA 4YHHC 2F4VC 3A9VA 2QVZX 4D4GA 3DHVA 2E5LC 3TQIA 5KYTA 4PROC 1WF3A 2HJGA 2D1TA 2OBVA 4DV1C 5BSUA 4LFCC 1PG4A 4B3MC 4I9FA 3EERA 1HR0C 4LF4C 2YWCA 1WH9A 4JI7C 1MKYA 3T1YC 1PG3A 1FUGA 1MDFA 4JI8C 2AYAA 4DR6C 4B3SC 2P20A 3UOWA 2D28C 2QVYX 1BA3A 1P7LA 4BC7A 2YWBA 3GR1A 1N32C 4DCTA 4IR7A 1XMOC 4NOZA 4B3TC 2QVXX 2CY1A 1YJ7A 3IEVA 2OPLB 1XRCA 3SO4A 4ISBA 4LE5A 5BSRA 2OO4A 2V7BA 3LNVA 4DUYC 4AQYC 2UUAC 2OPLA 1T5HX 4KHPC 4WS9A 2Y4OA 4IZ6A 1ZB8A 4R0MA 4JV5C 3TDEA 3GKUA 4LFBC 4DV5C 2P2JA 2E0GA 5BSVA 5A2QD 3UZ0A 1MD9A 3C5EA 1QM4A 2VQFC 4DV4C 5BUQA 1MDBA 3R9WA 4KTTA 4ZLPA 1JOSA 3TUFA 3FCCA 1FJGC 3A4IA 2ASBA 4DCVA 3GPCA 5BR8C 3A9UA 2CXCA 4DUZC 4X66C 3DLPX 4HPVA 4R1MA 1MXCA 5A1IA 4PHTA 1J5EC 4OYCA 4JI4C 4JI3C 4WV3A 2Y27A 3J7AD 4K0BA 1GPMA 1XNQC 5CZVA 1RY2A 4DR4C 1O93A 2ONFA 1NYEA 4BSZA 4DG8A 5ADZA 3JAMD 5AE1A 4LF6C 1HH2P 4DG9A 2D1QA 2E7GA 1XRBA 4RMNA 4DR3C 5AE2A 4L7IA 3PESA 4ZJZA 3NI2A 1N33C 2UXBC 4RLQA 3CW9A 1N2FA 1IBMC 1UKKA 1O90A 3N54B 3VNSA 4JI6C 4R1LA 3IPLA 4GKKC 4I9GA 2VQEC 2KZFA 3IMLA 3VNQA 1V26A 3DAYA 5JRHA 3LUSA 4GXQA 4FUTA 4NXNC 5KYVA 2EGTA 1K0RA 3AF6A 1KKGA 5H9UA 4MTNA 4JI0C 4X62C 1L2FA 4L2ZA 2PN2A 3NPDA 3RV2A 3EQ6A 2P2BA 1AMUA 4DV3C 1RG9A 2QW0X 4LFAC 2BJOA 5BSMA 4JM1A 4RM2A 1T5DX 4PZPA 1LCIA 4OXIA 2D27A 4G37A 4RVNA 3OTOC 4LF7C 4NDNA 4DV0C 4ODJA 5A1GA 3E7XA 2JMPA 3I07A 4G1IA 5IWAC 3T1HC 2VZEA 1XRAA 5CZXA 4JYAC 3IEUA 2DPLA 1PA4A 2XR1A 2UU9C 4JI1C 4DV2C 4LF8C 5BUSA 1N34C 3L95X 4DCUA 1HNZC 5LMUC 4DR1C 3H2TA 5BSTA 3E7WA 3PBKA 4D56A 5KEIA 2P2FA 3CJEA 3I08A 4LF9C 4X64C 1HNXC 2UXCC 1EGAA 2ATWA 4RLFA 4DR5C 2D1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML8 A;  1UKK A;  2UUB C;  2D7V A;  4JI6 C;  4GKK C;  4XX2 A;  1VLA A;  2VQF C;  4YHH C;  4DCS A;  4DV4 C;  2F4V C;  3R9W A;  2VQE C;  1JOS A;  2KZF A;  1IBL C;  2YCB A;  4OX9 C;  4X65 C;  1I94 C;  1FJG C;  2E5L C;  2DYJ A;  3LUS A;  4DV6 C;  1WF3 A;  2HJG A;  4DV1 C;  4LFC C;  2ASB A;  4DCV A;  4NXN C;  4B3M C;  2EGT A;  3AF6 A;  1K0R A;  3EER A;  3R9X A;  1KKG A;  4MTN A;  1IBK C;  5BR8 C;  4JI0 C;  2ZM6 C;  1HR0 C;  4LF4 C;  4K0K C;  2CXC A;  4DUZ C;  4X66 C;  4X62 C;  1L2F A;  2PN2 A;  1WH9 A;  3AF5 A;  1LQL A;  4JI7 C;  4DR7 C;  2PT7 G;  4DV3 C;  1MKY A;  2E8E A;  4NXM C;  1J5E C;  3T1Y C;  2UXD C;  4JI4 C;  4LFA C;  2BJO A;  4JI8 C;  4YY3 C;  4DR6 C;  1N36 C;  4JI3 C;  4B3S C;  3J7A D;  1N32 C;  2HHH C;  4DV7 C;  3OTO C;  1XNQ C;  4LF7 C;  1XNR C;  4DV0 C;  3J81 D;  4DR4 C;  4DCT A;  1ZB9 A;  2JMP A;  3I07 A;  1XMO C;  4JI5 C;  4NOZ A;  5IWA C;  3T1H C;  4MH4 A;  4B3T C;  2QL8 A;  4B3R C;  5FLX D;  2E8F A;  1QWI A;  2CY1 A;  2ONF A;  4JI2 C;  4JYA C;  5IT9 D;  3IEU A;  1NYE A;  4BSZ A;  3IEV A;  1PA4 A;  2OPL B;  2XR1 A;  2UU9 C;  2UUC C;  3JAM D;  4JI1 C;  4LF6 C;  1HH2 P;  1HNW C;  4DV2 C;  3J80 D;  4LF8 C;  1N34 C;  4DCU A;  5LMN C;  1HNZ C;  2E8C A;  2E7G A;  5LMU C;  4DUY C;  4DR1 C;  4AQY C;  2UUA C;  2OPL A;  4DR3 C;  1USP B;  4KHP C;  4GKJ C;  1ZB8 A;  3CJE A;  4JV5 C;  1N33 C;  1USP A;  4X64 C;  4LF5 C;  4LF9 C;  2UXB C;  1XMQ C;  3GKU A;  4LFB C;  4DV5 C;  1HNX C;  2UXC C;  4DR2 C;  1EGA A;  2ATW A;  1N2F A;  5A2Q D;  4DR5 C;  1IBM C; 
#chains in the Genus database with same CATH topology
 2KZ0 A;  3KXW A;  2UUB C;  2D7V A;  5K85 A;  4XX2 A;  4DCS A;  3GR0 A;  3FCE A;  3S82 A;  2DHM A;  5IFI A;  5DV9 A;  1IBL C;  1XDX A;  2Y4N A;  2YCB A;  4OX9 C;  4X65 C;  1I94 C;  2WD9 A;  4BBY A;  2DYJ A;  4DV6 C;  4PUI A;  4BC9 A;  4L4Q A;  1V25 A;  4D57 A;  4RVO A;  3R9X A;  3B7W A;  1UWD A;  1IBK C;  2ZM6 C;  2PRO A;  4K0K C;  3NYQ A;  1ULT A;  2M5H A;  4U5Y D;  3AF5 A;  3G7S A;  1LQL A;  1WCJ A;  3FM7 A;  1MXB A;  4DR7 C;  2PT7 G;  5A19 A;  2BH1 X;  4G36 A;  2E8E A;  4NXM C;  3RG2 A;  2UXD C;  4YY3 C;  1N36 C;  1O92 A;  2P02 A;  4KTV A;  3L8C A;  2HHH C;  4DV7 C;  3LNO A;  3N2Q A;  1XNR C;  1MXA A;  3J81 D;  1ZB9 A;  4JI5 C;  5AE3 A;  4FTF A;  4MH4 A;  4RM3 A;  2QL8 A;  4B3R C;  5FLX D;  2E8F A;  3VNR A;  1QWI A;  5BUR A;  4JI2 C;  5IT9 D;  1YGT A;  4D4I A;  2UUC C;  3LAX A;  3PRO C;  1HNW C;  1O9T A;  3J80 D;  5LMN C;  4FUQ A;  2E8C A;  4BCA A;  4TPS B;  1FLO A;  5GTD A;  1USP B;  5K8F A;  4EAT A;  4GKJ C;  2WP0 C;  2P2M A;  4GS5 A;  3ETC A;  1NY8 A;  2KDN A;  2D1R A;  3LGX A;  1USP A;  4LF5 C;  4GXR A;  2P2Q A;  5BSW A;  5E7Q A;  1XMQ C;  3R44 A;  3ETO A;  4DR2 C;  2VSQ A;  1ML8 A;  3CW8 X;  2JNV A;  5T8T A;  3NYR A;  1VLA A;  5T8S A;  4YHH C;  2F4V C;  3A9V A;  2QVZ X;  4D4G A;  3DHV A;  2E5L C;  3TQI A;  5KYT A;  4PRO C;  1V60 A;  1WF3 A;  2HJG A;  2D1T A;  2OBV A;  4DV1 C;  5BSU A;  4LFC C;  1PG4 A;  4B3M C;  4I9F A;  3EER A;  1HR0 C;  4LF4 C;  2MM9 A;  2YWC A;  1WH9 A;  2M5O A;  4JI7 C;  1MKY A;  3T1Y C;  5LCI A;  1PG3 A;  1FUG A;  1MDF A;  4JI8 C;  2AYA A;  4DR6 C;  4B3S C;  2P20 A;  3UOW A;  2D28 C;  2QVY X;  1BA3 A;  1P7L A;  4BC7 A;  2YWB A;  3GR1 A;  1N32 C;  4DCT A;  4IR7 A;  3O2E A;  1XMO C;  4NOZ A;  1TH5 A;  4B3T C;  2QVX X;  2CY1 A;  1YJ7 A;  3IEV A;  1XRC A;  2OPL B;  3SO4 A;  4ISB A;  4LE5 A;  5BSR A;  2OO4 A;  2V7B A;  2ZZM A;  3LNV A;  4DUY C;  4AQY C;  2UUA C;  2OPL A;  1T5H X;  4KHP C;  4WS9 A;  2Y4O A;  4IZ6 A;  1ZB8 A;  4R0M A;  4JV5 C;  3TDE A;  3UEB A;  3GKU A;  4LFB C;  4DV5 C;  2P2J A;  2E0G A;  5BSV A;  5A2Q D;  3UZ0 A;  1MD9 A;  3C5E A;  1QM4 A;  2VQF C;  4DV4 C;  5BUQ A;  1MDB A;  3R9W A;  4KTT A;  4ZLP A;  1JOS A;  3TUF A;  3FCC A;  3AY0 A;  2PG1 E;  1FJG C;  3A4I A;  2MCQ A;  2ASB A;  4DCV A;  3GPC A;  5BR8 C;  3A9U A;  2CXC A;  4DUZ C;  4X66 C;  3DLP X;  3CQ2 A;  4HPV A;  4R1M A;  1MXC A;  5A1I A;  4PHT A;  1J5E C;  4OYC A;  4JI4 C;  4JI3 C;  4PUG A;  4WV3 A;  2Y27 A;  3J7A D;  2ZTB A;  4K0B A;  1GPM A;  1XNQ C;  5CZV A;  1M6X C;  1RY2 A;  4DR4 C;  1O93 A;  2ONF A;  1NYE A;  4BSZ A;  4DG8 A;  5ADZ A;  3K6R A;  3JAM D;  5AE1 A;  4LF6 C;  1HH2 P;  4DG9 A;  1XHJ A;  2D1Q A;  2MMA B;  3UX2 A;  2E7G A;  1XRB A;  4RMN A;  3UX3 A;  4DR3 C;  3A26 A;  5AE2 A;  4L7I A;  3PES A;  4ZJZ A;  1P4E C;  3NI2 A;  1N33 C;  3CQ3 A;  2UXB C;  4RLQ A;  3CW9 A;  1N2F A;  1IBM C;  1UKK A;  2YX1 A;  1O90 A;  3N54 B;  3VNS A;  4JI6 C;  4R1L A;  3IPL A;  4GKK C;  4I9G A;  2VQE C;  2KZF A;  3IML A;  3VNQ A;  1V26 A;  3DAY A;  5JRH A;  3LUS A;  4GXQ A;  4FUT A;  4NXN C;  5KYV A;  2EGT A;  1K0R A;  3AF6 A;  1KKG A;  5H9U A;  3CQ1 A;  4MTN A;  4JI0 C;  4X62 C;  1L2F A;  4L2Z A;  2PN2 A;  1VEH A;  3NPD A;  1XS3 A;  3RV2 A;  3EQ6 A;  2P2B A;  1AMU A;  1M6X A;  4DV3 C;  1RG9 A;  3A25 A;  2CU6 A;  3TR3 A;  2QW0 X;  4LFA C;  2BJO A;  5BSM A;  4JM1 A;  4RM2 A;  1T5D X;  2Z51 A;  4PZP A;  1LCI A;  4OXI A;  4PUH A;  2D27 A;  4G37 A;  4RVN A;  3OTO C;  4LF7 C;  4NDN A;  4DV0 C;  4ODJ A;  5A1G A;  3E7X A;  2JMP A;  3I07 A;  4G1I A;  5IWA C;  3T1H C;  2VZE A;  2ZZN A;  1XRA A;  5CZX A;  4JYA C;  3IEU A;  2DPL A;  1PA4 A;  2XR1 A;  2UU9 C;  1P4E A;  4JI1 C;  4DV2 C;  4LF8 C;  5BUS A;  1N34 C;  3L95 X;  4DCU A;  1HNZ C;  5LMU C;  4DR1 C;  3H2T A;  2NCL A;  5BST A;  3E7W A;  3PBK A;  4D56 A;  5KEI A;  2P2F A;  3CJE A;  3I08 A;  4LF9 C;  4X64 C;  1HNX C;  2UXC C;  1IB8 A;  1EGA A;  2ATW A;  4RLF A;  1PU1 A;  4DR5 C;  2D1S A; 
#chains in the Genus database with same CATH homology
 3KXW A;  2UUB C;  2D7V A;  5K85 A;  4XX2 A;  4DCS A;  3GR0 A;  3FCE A;  3S82 A;  5IFI A;  5DV9 A;  1IBL C;  2Y4N A;  2YCB A;  4OX9 C;  4X65 C;  1I94 C;  2WD9 A;  4BBY A;  2DYJ A;  4DV6 C;  4BC9 A;  4L4Q A;  1V25 A;  4D57 A;  4RVO A;  3R9X A;  3B7W A;  1IBK C;  2ZM6 C;  2PRO A;  4K0K C;  3NYQ A;  1ULT A;  4U5Y D;  3AF5 A;  3G7S A;  1LQL A;  1MXB A;  4DR7 C;  2PT7 G;  5A19 A;  2BH1 X;  4G36 A;  2E8E A;  4NXM C;  3RG2 A;  2UXD C;  4YY3 C;  1N36 C;  1O92 A;  2P02 A;  4KTV A;  3L8C A;  2HHH C;  4DV7 C;  3N2Q A;  1XNR C;  1MXA A;  3J81 D;  1ZB9 A;  4JI5 C;  5AE3 A;  4FTF A;  4MH4 A;  4RM3 A;  2QL8 A;  4B3R C;  5FLX D;  2E8F A;  3VNR A;  1QWI A;  5BUR A;  4JI2 C;  5IT9 D;  4D4I A;  2UUC C;  3LAX A;  3PRO C;  1HNW C;  1O9T A;  3J80 D;  5LMN C;  4FUQ A;  2E8C A;  4BCA A;  4TPS B;  5GTD A;  1USP B;  5K8F A;  4EAT A;  4GKJ C;  2WP0 C;  2P2M A;  4GS5 A;  3ETC A;  2D1R A;  3LGX A;  1USP A;  4LF5 C;  4GXR A;  2P2Q A;  5BSW A;  5E7Q A;  1XMQ C;  3R44 A;  3ETO A;  4DR2 C;  2VSQ A;  1ML8 A;  3CW8 X;  5T8T A;  3NYR A;  1VLA A;  5T8S A;  4YHH C;  2F4V C;  3A9V A;  2QVZ X;  4D4G A;  3DHV A;  2E5L C;  3TQI A;  5KYT A;  4PRO C;  1WF3 A;  2HJG A;  2D1T A;  2OBV A;  4DV1 C;  5BSU A;  4LFC C;  1PG4 A;  4B3M C;  4I9F A;  3EER A;  1HR0 C;  4LF4 C;  2YWC A;  1WH9 A;  4JI7 C;  1MKY A;  3T1Y C;  1PG3 A;  1FUG A;  1MDF A;  4JI8 C;  2AYA A;  4DR6 C;  4B3S C;  2P20 A;  3UOW A;  2D28 C;  2QVY X;  1BA3 A;  1P7L A;  4BC7 A;  2YWB A;  3GR1 A;  1N32 C;  4DCT A;  4IR7 A;  1XMO C;  4NOZ A;  4B3T C;  2QVX X;  2CY1 A;  1YJ7 A;  3IEV A;  2OPL B;  1XRC A;  3SO4 A;  4ISB A;  4LE5 A;  5BSR A;  2OO4 A;  2V7B A;  3LNV A;  4DUY C;  4AQY C;  2UUA C;  2OPL A;  1T5H X;  4KHP C;  4WS9 A;  2Y4O A;  4IZ6 A;  1ZB8 A;  4R0M A;  4JV5 C;  3TDE A;  3GKU A;  4LFB C;  4DV5 C;  2P2J A;  2E0G A;  5BSV A;  5A2Q D;  3UZ0 A;  1MD9 A;  3C5E A;  1QM4 A;  2VQF C;  4DV4 C;  5BUQ A;  1MDB A;  3R9W A;  4KTT A;  4ZLP A;  1JOS A;  3TUF A;  3FCC A;  1FJG C;  3A4I A;  2ASB A;  4DCV A;  3GPC A;  5BR8 C;  3A9U A;  2CXC A;  4DUZ C;  4X66 C;  3DLP X;  4HPV A;  4R1M A;  1MXC A;  5A1I A;  4PHT A;  1J5E C;  4OYC A;  4JI4 C;  4JI3 C;  4WV3 A;  2Y27 A;  3J7A D;  4K0B A;  1GPM A;  1XNQ C;  5CZV A;  1RY2 A;  4DR4 C;  1O93 A;  2ONF A;  1NYE A;  4BSZ A;  4DG8 A;  5ADZ A;  3JAM D;  5AE1 A;  4LF6 C;  1HH2 P;  4DG9 A;  2D1Q A;  2E7G A;  1XRB A;  4RMN A;  4DR3 C;  5AE2 A;  4L7I A;  3PES A;  4ZJZ A;  3NI2 A;  1N33 C;  2UXB C;  4RLQ A;  3CW9 A;  1N2F A;  1IBM C;  1UKK A;  1O90 A;  3N54 B;  3VNS A;  4JI6 C;  4R1L A;  3IPL A;  4GKK C;  4I9G A;  2VQE C;  2KZF A;  3IML A;  3VNQ A;  1V26 A;  3DAY A;  5JRH A;  3LUS A;  4GXQ A;  4FUT A;  4NXN C;  5KYV A;  2EGT A;  1K0R A;  3AF6 A;  1KKG A;  5H9U A;  4MTN A;  4JI0 C;  4X62 C;  1L2F A;  4L2Z A;  2PN2 A;  3NPD A;  3RV2 A;  3EQ6 A;  2P2B A;  1AMU A;  4DV3 C;  1RG9 A;  2QW0 X;  4LFA C;  2BJO A;  5BSM A;  4JM1 A;  4RM2 A;  1T5D X;  4PZP A;  1LCI A;  4OXI A;  2D27 A;  4G37 A;  4RVN A;  3OTO C;  4LF7 C;  4NDN A;  4DV0 C;  4ODJ A;  5A1G A;  3E7X A;  2JMP A;  3I07 A;  4G1I A;  5IWA C;  3T1H C;  2VZE A;  1XRA A;  5CZX A;  4JYA C;  3IEU A;  2DPL A;  1PA4 A;  2XR1 A;  2UU9 C;  4JI1 C;  4DV2 C;  4LF8 C;  5BUS A;  1N34 C;  3L95 X;  4DCU A;  1HNZ C;  5LMU C;  4DR1 C;  3H2T A;  5BST A;  3E7W A;  3PBK A;  4D56 A;  5KEI A;  2P2F A;  3CJE A;  3I08 A;  4LF9 C;  4X64 C;  1HNX C;  2UXC C;  1EGA A;  2ATW A;  4RLF A;  4DR5 C;  2D1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...