2UXDC

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 35
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uxdC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uxdC02
4KHPC 4JI1C 4DCSA 1XMOC 1J5EC 2ASBA 4B3MC 5IWAC 4DR7C 2OPLB 4X66C 1XNRC 4OX9C 3I07A 3T1YC 3J80D 2D7VA 1KKGA 2E7GA 2PN2A 1IBKC 1N36C 4YY3C 4DCUA 4NOZA 4DV7C 2VQEC 4DR3C 2F4VC 4B3SC 4LFBC 4LF4C 1XNQC 1IBMC 2QL8A 1IBLC 1ZB9A 3EERA 1MKYA 4K0KC 1HH2P 4JV5C 4X64C 4DR4C 4LF9C 1N32C 4JYAC 2E8FA 2EGTA 1VLAA 2HHHC 4NXMC 4DCVA 3LUSA 4LF5C 2E8EA 1JOSA 4DV0C 4X65C 3T1HC 3IEUA 5LMNC 2PT7G 2E8CA 5BR8C 2UUCC 1EGAA 3GKUA 4B3TC 1LQLA 2HJGA 2UXCC 3AF6A 2UUBC 4JI8C 1L2FA 4JI7C 2ATWA 1K0RA 2VQFC 3R9WA 4DV4C 4GKJC 4MH4A 4DV2C 1UKKA 4DV1C 4JI5C 2CY1A 4LF6C 3OTOC 4DUYC 4BSZA 4DV6C 1HNZC 4JI3C 2BJOA 2E5LC 4LFCC 5LMUC 4JI2C 3JAMD 1HR0C 4GKKC 5IT9D 1HNXC 4NXNC 4DR1C 1PA4A 4YHHC 4X62C 3J7AD 1QWIA 1N34C 2JMPA 4DV3C 2KZFA 4DR6C 4LF8C 2OPLA 1N33C 1USPA 4JI0C 1ZB8A 2UU9C 4LFAC 4XX2A 2ZM6C 3AF5A 2UXDC 4B3RC 4MTNA 2ONFA 2UXBC 2DYJA 1WF3A 2XR1A 3R9XA 4LF7C 4AQYC 3J81D 5FLXD 1ML8A 1XMQC 5A2QD 1N2FA 3IEVA 4DCTA 1FJGC 2YCBA 1HNWC 1NYEA 4DR2C 4DR5C 4JI6C 1USPB 3CJEA 1I94C 4DUZC 4DV5C 2CXCA 1WH9A 4JI4C 2UUAC
chains in the Genus database with same CATH superfamily
2AYAA 1QM4A 3RG2A 4DR7C 4GS5A 2OPLB 4X66C 3I07A 2D7VA 2ZTBA 1KKGA 4D4IA 1XS3A 1O90A 4NOZA 1AMUA 4DV7C 2VQEC 3GR1A 2F4VC 4LF4C 1UWDA 1MKYA 4DR4C 4JYAC 3PESA 4NXMC 4DCVA 4LF5C 2E8EA 1PG4A 4LE5A 2DPLA 3IEUA 5BR8C 2E8CA 3I08A 2VSQA 2UUCC 1MD9A 3LAXA 2VZEA 2UUBC 4WV3A 3NYQA 2D1QA 3EQ6A 4LF6C 3A26A 4FUTA 4BSZA 4GXRA 3VNRA 4U5YD 4KTVA 4JM1A 4DR1C 5BSTA 4X62C 1M6XA 2JMPA 3K6RA 2P20A 4DV3C 4DR6C 1MDBA 5BSRA 4NDNA 4WS9A 3AF5A 2UXDC 1IB8A 4GXQA 3CQ3A 1O9TA 2KDNA 2UXBC 1T5HX 1WF3A 2Y4OA 3R9XA 3UEBA 4PHTA 2CU6A 2WD9A 1XMQC 1N2FA 2ZZMA 3RV2A 4JI6C 1WH9A 3T1YC 3C5EA 2ASBA 1J5EC 4B3MC 5T8SA 1XNRC 1V26A 4FUQA 3UX3A 1GPMA 5AE3A 4EATA 4ZLPA 2E7GA 2MCQA 3E7XA 4DCUA 3L8CA 5BSUA 4PUGA 4LFBC 1XNQC 5ADZA 1IBMC 2BH1X 1IBLC 1XDXA 1HH2P 4JV5C 4IR7A 3PROC 2QVZX 5K8FA 5BSVA 2PG1E 1VLAA 2M5OA 1RG9A 2P2JA 1JOSA 3T1HC 2Y27A 3KXWA 5LMNC 2P2MA 4L4QA 2E0GA 5IFIA 3GR0A 3AF6A 4JI8C 2ATWA 1XHJA 3GPCA 2CY1A 3OTOC 1TH5A 1HNZC 1LCIA 2E5LC 3FCCA 5LMUC 4JI2C 1HR0C 4GKKC 1RY2A 4DG9A 1PA4A 4PROC 3J7AD 1QWIA 4RMNA 1O92A 1N33C 2WP0C 4BC9A 3IMLA 2UU9C 4LFAC 4XX2A 2OBVA 4B3RC 3SO4A 4MTNA 2ONFA 2DYJA 5JRHA 5BUSA 3UZ0A 2XR1A 5A19A 5AE1A 3S82A 5LCIA 3FM7A 2YWCA 4D57A 4BCAA 3IEVA 4DCTA 4I9FA 3LNOA 1YJ7A 3CW8X 1NYEA 4DR5C 1MXAA 1I94C 4DV5C 3LGXA 5AE2A 1NY8A 3L95X 1XRAA 4KHPC 1XMOC 3DLPX 4L7IA 3A25A 4OX9C 3J80D 1WCJA 4ODJA 1P4EA 1MDFA 4R0MA 1N36C 2PROA 1PG3A 3AY0A 3ETOA 1T5DX 2QL8A 1ZB9A 3EERA 3TR3A 4ZJZA 2M5HA 4X64C 1N32C 3CQ2A 4KTTA 4FTFA 4RLFA 1P7LA 4RLQA 4PUIA 4RM2A 2V7BA 3TUFA 4DV0C 4X65C 4I9GA 4OYCA 4IZ6A 2JNVA 3GKUA 1LQLA 3CQ1A 3UX2A 1MXBA 3R44A 1L2FA 4JI7C 4GKJC 1K0RA 2VQFC 3R9WA 4DV4C 1XRCA 2Y4NA 4DV1C 4JI5C 1V25A 4HPVA 3VNQA 5BUQA 3N54B 2ZZNA 4JI3C 4LFCC 1YGTA 3DAYA 3NPDA 2P2QA 2KZFA 3A4IA 2OPLA 4G37A 1USPA 4JI0C 1ZB8A 1M6XC 2KZ0A 2ZM6C 3G7SA 5CZVA 3PBKA 2QW0X 2OO4A 3VNSA 3TDEA 2NCLA 3O2EA 4AQYC 5K85A 1V60A 5FLXD 1ML8A 1MXCA 3LNVA 3ETCA 1HNWC 5T8TA 1O93A 2YX1A 1USPB 4DUZC 4BC7A 4JI1C 1FLOA 4DCSA 3TQIA 5IWAC 3NI2A 3DHVA 5CZXA 5A1GA 3CW9A 4PZPA 2PN2A 1IBKC 4YY3C 2D28C 4DR3C 2MMAB 1BA3A 4B3SC 3A9UA 4R1MA 1FUGA 2QVXX 4K0KC 5KEIA 4LF9C 5BSMA 3UOWA 2E8FA 2EGTA 1P4EC 2HHHC 4G36A 2D1RA 5KYTA 4PUHA 3H2TA 3LUSA 5H9UA 2PT7G 5DV9A 2D27A 4R1LA 1EGAA 2D1SA 5E7QA 2P2BA 4B3TC 3A9VA 2HJGA 2UXCC 1ULTA 4OXIA 4DV2C 4MH4A 1UKKA 3FCEA 1VEHA 4RVNA 2YWBA 5A1IA 4DUYC 3NYRA 5GTDA 4DV6C 2DHMA 2BJOA 3JAMD 4K0BA 5IT9D 4TPSB 1HNXC 4NXNC 2D1TA 4BBYA 5BSWA 4YHHC 1N34C 4D56A 4LF8C 3B7WA 5KYVA 3N2QA 2QVYX 4G1IA 1XRBA 2MM9A 4LF7C 3E7WA 3J81D 5A2QD 2P02A 1FJGC 2P2FA 2YCBA 5BURA 4DR2C 1PU1A 3CJEA 4ISBA 4RM3A 2CXCA 4L2ZA 3IPLA 4RVOA 2Z51A 4D4GA 4JI4C 2UUAC 4DG8A
chains in the Genus database with same CATH topology
2AYAA 1QM4A 3RG2A 4DR7C 4GS5A 2OPLB 4X66C 3I07A 2D7VA 1KKGA 4D4IA 1O90A 4NOZA 1AMUA 4DV7C 2VQEC 3GR1A 2F4VC 4LF4C 1MKYA 4DR4C 4JYAC 3PESA 4NXMC 4DCVA 4LF5C 2E8EA 1PG4A 4LE5A 2DPLA 3IEUA 5BR8C 2E8CA 3I08A 2VSQA 2UUCC 1MD9A 3LAXA 2VZEA 2UUBC 4WV3A 3NYQA 2D1QA 3EQ6A 4LF6C 4FUTA 4BSZA 4GXRA 3VNRA 4U5YD 4KTVA 4JM1A 4DR1C 5BSTA 4X62C 2JMPA 2P20A 4DV3C 4DR6C 1MDBA 5BSRA 4NDNA 4WS9A 3AF5A 2UXDC 4GXQA 2UXBC 1O9TA 1T5HX 1WF3A 2Y4OA 3R9XA 4PHTA 2WD9A 1XMQC 1N2FA 3RV2A 4JI6C 3T1YC 1WH9A 3C5EA 2ASBA 1J5EC 4B3MC 5T8SA 1XNRC 1V26A 4FUQA 1GPMA 5AE3A 4EATA 4ZLPA 2E7GA 3E7XA 4DCUA 3L8CA 5BSUA 4LFBC 1XNQC 5ADZA 1IBMC 2BH1X 1IBLC 1HH2P 4JV5C 4IR7A 3PROC 2QVZX 5K8FA 5BSVA 1VLAA 1RG9A 2P2JA 1JOSA 3T1HC 2Y27A 3KXWA 5LMNC 2P2MA 4L4QA 2E0GA 5IFIA 3GR0A 3AF6A 4JI8C 2ATWA 3GPCA 2CY1A 3OTOC 1HNZC 1LCIA 2E5LC 3FCCA 5LMUC 4JI2C 1HR0C 4GKKC 1RY2A 4DG9A 1PA4A 4PROC 3J7AD 1QWIA 4RMNA 1O92A 1N33C 2WP0C 4BC9A 3IMLA 2UU9C 4LFAC 4XX2A 2OBVA 4B3RC 3SO4A 4MTNA 2ONFA 2DYJA 5JRHA 5BUSA 3UZ0A 2XR1A 5A19A 5AE1A 3S82A 2YWCA 4D57A 4BCAA 3IEVA 4DCTA 4I9FA 1YJ7A 3CW8X 1NYEA 4DR5C 1MXAA 1I94C 4DV5C 3LGXA 5AE2A 3L95X 1XRAA 4KHPC 1XMOC 3DLPX 4L7IA 4OX9C 3J80D 4ODJA 1MDFA 4R0MA 1N36C 2PROA 1PG3A 3ETOA 1T5DX 2QL8A 1ZB9A 3EERA 4ZJZA 4X64C 1N32C 4KTTA 4FTFA 4RLFA 1P7LA 4RLQA 4RM2A 2V7BA 3TUFA 4DV0C 4X65C 4I9GA 4OYCA 4IZ6A 3GKUA 1LQLA 1MXBA 3R44A 1L2FA 4JI7C 4GKJC 1K0RA 2VQFC 3R9WA 4DV4C 1XRCA 2Y4NA 4DV1C 4JI5C 1V25A 4HPVA 3VNQA 5BUQA 3N54B 4JI3C 4LFCC 3DAYA 3NPDA 2P2QA 2KZFA 3A4IA 2OPLA 4G37A 1USPA 4JI0C 1ZB8A 2ZM6C 3G7SA 5CZVA 3PBKA 2QW0X 2OO4A 3VNSA 3TDEA 4AQYC 5K85A 5FLXD 1ML8A 1MXCA 3LNVA 3ETCA 1HNWC 5T8TA 1O93A 1USPB 4DUZC 4BC7A 4JI1C 4DCSA 3TQIA 5IWAC 3NI2A 3DHVA 5CZXA 5A1GA 3CW9A 4PZPA 2PN2A 1IBKC 4YY3C 2D28C 4DR3C 1BA3A 4B3SC 3A9UA 4R1MA 1FUGA 2QVXX 4K0KC 5KEIA 4LF9C 5BSMA 3UOWA 2E8FA 2EGTA 2HHHC 4G36A 2D1RA 5KYTA 3H2TA 3LUSA 5H9UA 2PT7G 5DV9A 2D27A 4R1LA 1EGAA 2D1SA 5E7QA 2P2BA 4B3TC 3A9VA 2HJGA 2UXCC 1ULTA 4OXIA 4MH4A 4DV2C 1UKKA 3FCEA 4RVNA 2YWBA 5A1IA 4DUYC 3NYRA 5GTDA 4DV6C 2BJOA 3JAMD 4K0BA 5IT9D 4TPSB 1HNXC 4NXNC 2D1TA 4BBYA 5BSWA 4YHHC 1N34C 4D56A 4LF8C 3B7WA 5KYVA 3N2QA 2QVYX 4G1IA 1XRBA 4LF7C 3E7WA 3J81D 5A2QD 2P02A 1FJGC 2P2FA 2YCBA 5BURA 4DR2C 3CJEA 4ISBA 4RM3A 2CXCA 4L2ZA 3IPLA 4RVOA 4D4GA 4JI4C 2UUAC 4DG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP C;  4JI1 C;  4DCS A;  1XMO C;  1J5E C;  2ASB A;  4B3M C;  5IWA C;  4DR7 C;  2OPL B;  4X66 C;  1XNR C;  4OX9 C;  3I07 A;  3T1Y C;  3J80 D;  2D7V A;  1KKG A;  2E7G A;  2PN2 A;  1IBK C;  1N36 C;  4YY3 C;  4DCU A;  4NOZ A;  4DV7 C;  2VQE C;  4DR3 C;  2F4V C;  4B3S C;  4LFB C;  4LF4 C;  1XNQ C;  1IBM C;  2QL8 A;  1IBL C;  1ZB9 A;  3EER A;  1MKY A;  4K0K C;  1HH2 P;  4JV5 C;  4X64 C;  4DR4 C;  4LF9 C;  1N32 C;  4JYA C;  2E8F A;  2EGT A;  1VLA A;  2HHH C;  4NXM C;  4DCV A;  3LUS A;  4LF5 C;  2E8E A;  1JOS A;  4DV0 C;  4X65 C;  3T1H C;  3IEU A;  5LMN C;  2PT7 G;  2E8C A;  5BR8 C;  2UUC C;  1EGA A;  3GKU A;  4B3T C;  1LQL A;  2HJG A;  2UXC C;  3AF6 A;  2UUB C;  4JI8 C;  1L2F A;  4JI7 C;  2ATW A;  1K0R A;  2VQF C;  3R9W A;  4DV4 C;  4GKJ C;  4MH4 A;  4DV2 C;  1UKK A;  4DV1 C;  4JI5 C;  2CY1 A;  4LF6 C;  3OTO C;  4DUY C;  4BSZ A;  4DV6 C;  1HNZ C;  4JI3 C;  2BJO A;  2E5L C;  4LFC C;  5LMU C;  4JI2 C;  3JAM D;  1HR0 C;  4GKK C;  5IT9 D;  1HNX C;  4NXN C;  4DR1 C;  1PA4 A;  4YHH C;  4X62 C;  3J7A D;  1QWI A;  1N34 C;  2JMP A;  4DV3 C;  2KZF A;  4DR6 C;  4LF8 C;  2OPL A;  1N33 C;  1USP A;  4JI0 C;  1ZB8 A;  2UU9 C;  4LFA C;  4XX2 A;  2ZM6 C;  3AF5 A;  2UXD C;  4B3R C;  4MTN A;  2ONF A;  2UXB C;  2DYJ A;  1WF3 A;  2XR1 A;  3R9X A;  4LF7 C;  4AQY C;  3J81 D;  5FLX D;  1ML8 A;  1XMQ C;  5A2Q D;  1N2F A;  3IEV A;  4DCT A;  1FJG C;  2YCB A;  1HNW C;  1NYE A;  4DR2 C;  4DR5 C;  4JI6 C;  1USP B;  3CJE A;  1I94 C;  4DUZ C;  4DV5 C;  2CXC A;  1WH9 A;  4JI4 C;  2UUA C; 
#chains in the Genus database with same CATH topology
 2AYA A;  1QM4 A;  3RG2 A;  4DR7 C;  4GS5 A;  2OPL B;  4X66 C;  3I07 A;  2D7V A;  2ZTB A;  1KKG A;  4D4I A;  1XS3 A;  1O90 A;  4NOZ A;  1AMU A;  4DV7 C;  2VQE C;  3GR1 A;  2F4V C;  4LF4 C;  1UWD A;  1MKY A;  4DR4 C;  4JYA C;  3PES A;  4NXM C;  4DCV A;  4LF5 C;  2E8E A;  1PG4 A;  4LE5 A;  2DPL A;  3IEU A;  5BR8 C;  2E8C A;  3I08 A;  2VSQ A;  2UUC C;  1MD9 A;  3LAX A;  2VZE A;  2UUB C;  4WV3 A;  3NYQ A;  2D1Q A;  3EQ6 A;  4LF6 C;  3A26 A;  4FUT A;  4BSZ A;  4GXR A;  3VNR A;  4U5Y D;  4KTV A;  4JM1 A;  4DR1 C;  5BST A;  4X62 C;  1M6X A;  2JMP A;  3K6R A;  2P20 A;  4DV3 C;  4DR6 C;  1MDB A;  5BSR A;  4NDN A;  4WS9 A;  3AF5 A;  2UXD C;  1IB8 A;  4GXQ A;  3CQ3 A;  1O9T A;  2KDN A;  2UXB C;  1T5H X;  1WF3 A;  2Y4O A;  3R9X A;  3UEB A;  4PHT A;  2CU6 A;  2WD9 A;  1XMQ C;  1N2F A;  2ZZM A;  3RV2 A;  4JI6 C;  1WH9 A;  3T1Y C;  3C5E A;  2ASB A;  1J5E C;  4B3M C;  5T8S A;  1XNR C;  1V26 A;  4FUQ A;  3UX3 A;  1GPM A;  5AE3 A;  4EAT A;  4ZLP A;  2E7G A;  2MCQ A;  3E7X A;  4DCU A;  3L8C A;  5BSU A;  4PUG A;  4LFB C;  1XNQ C;  5ADZ A;  1IBM C;  2BH1 X;  1IBL C;  1XDX A;  1HH2 P;  4JV5 C;  4IR7 A;  3PRO C;  2QVZ X;  5K8F A;  5BSV A;  2PG1 E;  1VLA A;  2M5O A;  1RG9 A;  2P2J A;  1JOS A;  3T1H C;  2Y27 A;  3KXW A;  5LMN C;  2P2M A;  4L4Q A;  2E0G A;  5IFI A;  3GR0 A;  3AF6 A;  4JI8 C;  2ATW A;  1XHJ A;  3GPC A;  2CY1 A;  3OTO C;  1TH5 A;  1HNZ C;  1LCI A;  2E5L C;  3FCC A;  5LMU C;  4JI2 C;  1HR0 C;  4GKK C;  1RY2 A;  4DG9 A;  1PA4 A;  4PRO C;  3J7A D;  1QWI A;  4RMN A;  1O92 A;  1N33 C;  2WP0 C;  4BC9 A;  3IML A;  2UU9 C;  4LFA C;  4XX2 A;  2OBV A;  4B3R C;  3SO4 A;  4MTN A;  2ONF A;  2DYJ A;  5JRH A;  5BUS A;  3UZ0 A;  2XR1 A;  5A19 A;  5AE1 A;  3S82 A;  5LCI A;  3FM7 A;  2YWC A;  4D57 A;  4BCA A;  3IEV A;  4DCT A;  4I9F A;  3LNO A;  1YJ7 A;  3CW8 X;  1NYE A;  4DR5 C;  1MXA A;  1I94 C;  4DV5 C;  3LGX A;  5AE2 A;  1NY8 A;  3L95 X;  1XRA A;  4KHP C;  1XMO C;  3DLP X;  4L7I A;  3A25 A;  4OX9 C;  3J80 D;  1WCJ A;  4ODJ A;  1P4E A;  1MDF A;  4R0M A;  1N36 C;  2PRO A;  1PG3 A;  3AY0 A;  3ETO A;  1T5D X;  2QL8 A;  1ZB9 A;  3EER A;  3TR3 A;  4ZJZ A;  2M5H A;  4X64 C;  1N32 C;  3CQ2 A;  4KTT A;  4FTF A;  4RLF A;  1P7L A;  4RLQ A;  4PUI A;  4RM2 A;  2V7B A;  3TUF A;  4DV0 C;  4X65 C;  4I9G A;  4OYC A;  4IZ6 A;  2JNV A;  3GKU A;  1LQL A;  3CQ1 A;  3UX2 A;  1MXB A;  3R44 A;  1L2F A;  4JI7 C;  4GKJ C;  1K0R A;  2VQF C;  3R9W A;  4DV4 C;  1XRC A;  2Y4N A;  4DV1 C;  4JI5 C;  1V25 A;  4HPV A;  3VNQ A;  5BUQ A;  3N54 B;  2ZZN A;  4JI3 C;  4LFC C;  1YGT A;  3DAY A;  3NPD A;  2P2Q A;  2KZF A;  3A4I A;  2OPL A;  4G37 A;  1USP A;  4JI0 C;  1ZB8 A;  1M6X C;  2KZ0 A;  2ZM6 C;  3G7S A;  5CZV A;  3PBK A;  2QW0 X;  2OO4 A;  3VNS A;  3TDE A;  2NCL A;  3O2E A;  4AQY C;  5K85 A;  1V60 A;  5FLX D;  1ML8 A;  1MXC A;  3LNV A;  3ETC A;  1HNW C;  5T8T A;  1O93 A;  2YX1 A;  1USP B;  4DUZ C;  4BC7 A;  4JI1 C;  1FLO A;  4DCS A;  3TQI A;  5IWA C;  3NI2 A;  3DHV A;  5CZX A;  5A1G A;  3CW9 A;  4PZP A;  2PN2 A;  1IBK C;  4YY3 C;  2D28 C;  4DR3 C;  2MMA B;  1BA3 A;  4B3S C;  3A9U A;  4R1M A;  1FUG A;  2QVX X;  4K0K C;  5KEI A;  4LF9 C;  5BSM A;  3UOW A;  2E8F A;  2EGT A;  1P4E C;  2HHH C;  4G36 A;  2D1R A;  5KYT A;  4PUH A;  3H2T A;  3LUS A;  5H9U A;  2PT7 G;  5DV9 A;  2D27 A;  4R1L A;  1EGA A;  2D1S A;  5E7Q A;  2P2B A;  4B3T C;  3A9V A;  2HJG A;  2UXC C;  1ULT A;  4OXI A;  4DV2 C;  4MH4 A;  1UKK A;  3FCE A;  1VEH A;  4RVN A;  2YWB A;  5A1I A;  4DUY C;  3NYR A;  5GTD A;  4DV6 C;  2DHM A;  2BJO A;  3JAM D;  4K0B A;  5IT9 D;  4TPS B;  1HNX C;  4NXN C;  2D1T A;  4BBY A;  5BSW A;  4YHH C;  1N34 C;  4D56 A;  4LF8 C;  3B7W A;  5KYV A;  3N2Q A;  2QVY X;  4G1I A;  1XRB A;  2MM9 A;  4LF7 C;  3E7W A;  3J81 D;  5A2Q D;  2P02 A;  1FJG C;  2P2F A;  2YCB A;  5BUR A;  4DR2 C;  1PU1 A;  3CJE A;  4ISB A;  4RM3 A;  2CXC A;  4L2Z A;  3IPL A;  4RVO A;  2Z51 A;  4D4G A;  4JI4 C;  2UUA C;  4DG8 A; 
#chains in the Genus database with same CATH homology
 2AYA A;  1QM4 A;  3RG2 A;  4DR7 C;  4GS5 A;  2OPL B;  4X66 C;  3I07 A;  2D7V A;  1KKG A;  4D4I A;  1O90 A;  4NOZ A;  1AMU A;  4DV7 C;  2VQE C;  3GR1 A;  2F4V C;  4LF4 C;  1MKY A;  4DR4 C;  4JYA C;  3PES A;  4NXM C;  4DCV A;  4LF5 C;  2E8E A;  1PG4 A;  4LE5 A;  2DPL A;  3IEU A;  5BR8 C;  2E8C A;  3I08 A;  2VSQ A;  2UUC C;  1MD9 A;  3LAX A;  2VZE A;  2UUB C;  4WV3 A;  3NYQ A;  2D1Q A;  3EQ6 A;  4LF6 C;  4FUT A;  4BSZ A;  4GXR A;  3VNR A;  4U5Y D;  4KTV A;  4JM1 A;  4DR1 C;  5BST A;  4X62 C;  2JMP A;  2P20 A;  4DV3 C;  4DR6 C;  1MDB A;  5BSR A;  4NDN A;  4WS9 A;  3AF5 A;  2UXD C;  4GXQ A;  2UXB C;  1O9T A;  1T5H X;  1WF3 A;  2Y4O A;  3R9X A;  4PHT A;  2WD9 A;  1XMQ C;  1N2F A;  3RV2 A;  4JI6 C;  3T1Y C;  1WH9 A;  3C5E A;  2ASB A;  1J5E C;  4B3M C;  5T8S A;  1XNR C;  1V26 A;  4FUQ A;  1GPM A;  5AE3 A;  4EAT A;  4ZLP A;  2E7G A;  3E7X A;  4DCU A;  3L8C A;  5BSU A;  4LFB C;  1XNQ C;  5ADZ A;  1IBM C;  2BH1 X;  1IBL C;  1HH2 P;  4JV5 C;  4IR7 A;  3PRO C;  2QVZ X;  5K8F A;  5BSV A;  1VLA A;  1RG9 A;  2P2J A;  1JOS A;  3T1H C;  2Y27 A;  3KXW A;  5LMN C;  2P2M A;  4L4Q A;  2E0G A;  5IFI A;  3GR0 A;  3AF6 A;  4JI8 C;  2ATW A;  3GPC A;  2CY1 A;  3OTO C;  1HNZ C;  1LCI A;  2E5L C;  3FCC A;  5LMU C;  4JI2 C;  1HR0 C;  4GKK C;  1RY2 A;  4DG9 A;  1PA4 A;  4PRO C;  3J7A D;  1QWI A;  4RMN A;  1O92 A;  1N33 C;  2WP0 C;  4BC9 A;  3IML A;  2UU9 C;  4LFA C;  4XX2 A;  2OBV A;  4B3R C;  3SO4 A;  4MTN A;  2ONF A;  2DYJ A;  5JRH A;  5BUS A;  3UZ0 A;  2XR1 A;  5A19 A;  5AE1 A;  3S82 A;  2YWC A;  4D57 A;  4BCA A;  3IEV A;  4DCT A;  4I9F A;  1YJ7 A;  3CW8 X;  1NYE A;  4DR5 C;  1MXA A;  1I94 C;  4DV5 C;  3LGX A;  5AE2 A;  3L95 X;  1XRA A;  4KHP C;  1XMO C;  3DLP X;  4L7I A;  4OX9 C;  3J80 D;  4ODJ A;  1MDF A;  4R0M A;  1N36 C;  2PRO A;  1PG3 A;  3ETO A;  1T5D X;  2QL8 A;  1ZB9 A;  3EER A;  4ZJZ A;  4X64 C;  1N32 C;  4KTT A;  4FTF A;  4RLF A;  1P7L A;  4RLQ A;  4RM2 A;  2V7B A;  3TUF A;  4DV0 C;  4X65 C;  4I9G A;  4OYC A;  4IZ6 A;  3GKU A;  1LQL A;  1MXB A;  3R44 A;  1L2F A;  4JI7 C;  4GKJ C;  1K0R A;  2VQF C;  3R9W A;  4DV4 C;  1XRC A;  2Y4N A;  4DV1 C;  4JI5 C;  1V25 A;  4HPV A;  3VNQ A;  5BUQ A;  3N54 B;  4JI3 C;  4LFC C;  3DAY A;  3NPD A;  2P2Q A;  2KZF A;  3A4I A;  2OPL A;  4G37 A;  1USP A;  4JI0 C;  1ZB8 A;  2ZM6 C;  3G7S A;  5CZV A;  3PBK A;  2QW0 X;  2OO4 A;  3VNS A;  3TDE A;  4AQY C;  5K85 A;  5FLX D;  1ML8 A;  1MXC A;  3LNV A;  3ETC A;  1HNW C;  5T8T A;  1O93 A;  1USP B;  4DUZ C;  4BC7 A;  4JI1 C;  4DCS A;  3TQI A;  5IWA C;  3NI2 A;  3DHV A;  5CZX A;  5A1G A;  3CW9 A;  4PZP A;  2PN2 A;  1IBK C;  4YY3 C;  2D28 C;  4DR3 C;  1BA3 A;  4B3S C;  3A9U A;  4R1M A;  1FUG A;  2QVX X;  4K0K C;  5KEI A;  4LF9 C;  5BSM A;  3UOW A;  2E8F A;  2EGT A;  2HHH C;  4G36 A;  2D1R A;  5KYT A;  3H2T A;  3LUS A;  5H9U A;  2PT7 G;  5DV9 A;  2D27 A;  4R1L A;  1EGA A;  2D1S A;  5E7Q A;  2P2B A;  4B3T C;  3A9V A;  2HJG A;  2UXC C;  1ULT A;  4OXI A;  4MH4 A;  4DV2 C;  1UKK A;  3FCE A;  4RVN A;  2YWB A;  5A1I A;  4DUY C;  3NYR A;  5GTD A;  4DV6 C;  2BJO A;  3JAM D;  4K0B A;  5IT9 D;  4TPS B;  1HNX C;  4NXN C;  2D1T A;  4BBY A;  5BSW A;  4YHH C;  1N34 C;  4D56 A;  4LF8 C;  3B7W A;  5KYV A;  3N2Q A;  2QVY X;  4G1I A;  1XRB A;  4LF7 C;  3E7W A;  3J81 D;  5A2Q D;  2P02 A;  1FJG C;  2P2F A;  2YCB A;  5BUR A;  4DR2 C;  3CJE A;  4ISB A;  4RM3 A;  2CXC A;  4L2Z A;  3IPL A;  4RVO A;  4D4G A;  4JI4 C;  2UUA C;  4DG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...