2UXDC

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 35
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uxdC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uxdC02
3I07A 1N2FA 2ASBA 1EGAA 1I94C 1N32C 3J81D 2E7GA 1QWIA 3R9XA 2BJOA 2PT7G 1HNWC 3CJEA 3T1HC 2QL8A 4LF5C 4MH4A 4DCTA 1USPA 1HNXC 4LF8C 3IEUA 4JI7C 2VQEC 1XNRC 2UXCC 4NOZA 4DUYC 1USPB 4B3SC 2CXCA 4DCUA 4X65C 5IT9D 1UKKA 2XR1A 4DUZC 4DV6C 1LQLA 5BR8C 3J7AD 3AF5A 4JI1C 2E8EA 2JMPA 4DV5C 2HHHC 2UUCC 2E8CA 3OTOC 2F4VC 2UU9C 4X66C 2UXBC 1ZB8A 1N34C 3R9WA 4DR2C 4LF6C 4LF4C 1XMQC 4K0KC 1XNQC 1IBLC 2ATWA 1ZB9A 1HR0C 4LFCC 5IWAC 3LUSA 4XX2A 4B3RC 2KZFA 4DR7C 2HJGA 4DR4C 5LMNC 3J80D 4DCVA 4LF7C 1KKGA 4JI8C 2ZM6C 4GKJC 4B3MC 2UUBC 4LFAC 1VLAA 3AF6A 4DR5C 2DYJA 4JI5C 2PN2A 4JYAC 1IBMC 2D7VA 2YCBA 4X62C 4OX9C 3JAMD 3EERA 5FLXD 2VQFC 1IBKC 4DCSA 4NXNC 4DR1C 2EGTA 4YHHC 4B3TC 1NYEA 2UUAC 1N33C 4DV1C 4NXMC 1HNZC 1J5EC 1ML8A 1K0RA 5LMUC 4KHPC 4DV7C 3IEVA 4DV4C 2OPLA 4LF9C 4AQYC 1L2FA 1WH9A 4DR3C 4YY3C 4JI6C 1MKYA 2UXDC 4DV3C 2CY1A 1JOSA 5A2QD 4LFBC 4JI0C 4JI2C 4GKKC 4BSZA 4JI4C 3T1YC 2OPLB 3GKUA 2E5LC 1XMOC 4JV5C 4JI3C 4DR6C 4MTNA 2ONFA 1FJGC 4DV0C 2E8FA 4X64C 4DV2C 1PA4A 1N36C 1WF3A 1HH2P
chains in the Genus database with same CATH superfamily
1N2FA 3A26A 3A25A 3R9XA 1HNWC 1AMUA 4DG8A 2D27A 3O2EA 4LF5C 4KTTA 4MH4A 2YWCA 3GPCA 4JI7C 2UXCC 4NOZA 4DCUA 1P4EC 3AF5A 4JI1C 3UEBA 2JMPA 2HHHC 4R0MA 2UUCC 4FTFA 3OTOC 4L4QA 4ODJA 2UU9C 4GXRA 4PUGA 4BC9A 4RM3A 3L8CA 2D1TA 1ZB9A 3VNRA 4I9GA 1FLOA 3J80D 2Z51A 4BC7A 4GKJC 2MCQA 2OBVA 2P2JA 4LFAC 1XHJA 2P2MA 4PROC 2WD9A 3C5EA 5ADZA 4R1MA 3UX3A 1P4EA 2ZZMA 4U5YD 2VQFC 2QVYX 3TDEA 1V25A 5BURA 4YHHC 4B3TC 1N33C 3I08A 4PUIA 5KEIA 1HNZC 3PROC 1MDBA 4D4IA 2OPLA 5A1IA 3LGXA 4DR3C 4YY3C 1LCIA 3NYRA 3VNQA 1YJ7A 4JI2C 4BSZA 3CQ2A 3NI2A 5IFIA 3LAXA 1PU1A 2P2BA 2M5OA 4X64C 2UXDC 1N36C 1FUGA 4FUQA 1WF3A 1HH2P 2ASBA 1M6XA 3NPDA 1QWIA 1MXAA 2BJOA 2KZ0A 3CJEA 1MXCA 2QL8A 1TH5A 4DCTA 4LF8C 3IEUA 5DV9A 2ZTBA 1XNRC 4G37A 3A9VA 5KYTA 4X65C 2D1SA 3FCEA 5BSVA 4DV6C 4ZLPA 5BR8C 5GTDA 1XRCA 1O93A 4ZJZA 3B7WA 4DV5C 3ETCA 3E7XA 5A19A 2MM9A 4X66C 2UXBC 1ZB8A 1N34C 3H2TA 4DR2C 3CQ3A 1ULTA 4FUTA 1O92A 4LFCC 4XX2A 5CZXA 2KZFA 2P20A 4DR7C 2HJGA 4OYCA 1O9TA 1RY2A 2P2QA 2UUBC 5AE3A 2QVZX 2Y4OA 4R1LA 2YWBA 4L2ZA 2PN2A 4G1IA 4G36A 3UX2A 2YCBA 4X62C 2DPLA 1O90A 4OX9C 5FLXD 3TQIA 4DR1C 3CW9A 3G7SA 5CZVA 2EGTA 3GR1A 5T8TA 1IB8A 4K0BA 2D1QA 4DV7C 3IEVA 4DV4C 2D28C 3RG2A 3N2QA 3DHVA 4EATA 5BSMA 3TR3A 1WH9A 4ISBA 3ETOA 1MKYA 5AE2A 2Y27A 4OXIA 5JRHA 3DAYA 2QW0X 2OPLB 2E5LC 4WS9A 4MTNA 1FJGC 1V60A 1WCJA 3DLPX 1EGAA 4DG9A 1I94C 3A4IA 5T8SA 2E7GA 1PG3A 3UZ0A 3J81D 1N32C 1NY8A 2PT7G 3T1HC 4PUHA 1USPA 3GR0A 3PESA 1USPB 2CXCA 5IT9D 1UKKA 4PZPA 2V7BA 4RLFA 3J7AD 5BSUA 4D56A 2ZZNA 3TUFA 5BSRA 2E8CA 3CW8X 1GPMA 2Y4NA 1RG9A 3RV2A 2NCLA 3CQ1A 3R9WA 1MD9A 1XMQC 1XNQC 2ATWA 1HR0C 3LUSA 4DR4C 4DCVA 4LF7C 3IPLA 4JI8C 3K6RA 4B3MC 4D57A 4NDNA 2QVXX 1XS3A 2D1RA 1VLAA 3EQ6A 2MMAB 2JNVA 2DYJA 3A9UA 3AF6A 1IBMC 4IR7A 2VSQA 4LE5A 3JAMD 3EERA 1PG4A 4NXNC 4RM2A 2BH1X 4TPSB 1NYEA 2UUAC 3AY0A 4DV1C 2WP0C 1K0RA 5LMUC 4RLQA 2PROA 4LF9C 2AYAA 5H9UA 1L2FA 2DHMA 1VEHA 4JI6C 2CY1A 4GS5A 5A2QD 1XDXA 1XRBA 2E0GA 4D4GA 3N54B 3GKUA 5A1GA 4JV5C 3PBKA 4JI3C 4DR6C 2E8FA 4DV2C 3I07A 1MXBA 1UWDA 4PHTA 2KDNA 5LCIA 4RVOA 1HNXC 4BBYA 3FM7A 2VQEC 4JM1A 1T5DX 5BSTA 4DUYC 4B3SC 4I9FA 5K8FA 4GXQA 2XR1A 3FCCA 3LNVA 4DUZC 1LQLA 4HPVA 2P02A 4BCAA 5E7QA 1QM4A 2E8EA 2F4VC 1T5HX 3L95X 2YX1A 3IMLA 5AE1A 4LF6C 4LF4C 4K0KC 3S82A 1IBLC 2PG1E 5IWAC 4B3RC 3E7WA 5LMNC 4RMNA 1KKGA 2ZM6C 3R44A 1P7LA 3VNSA 4L7IA 4DR5C 4RVNA 4JI5C 4JYAC 2D7VA 3SO4A 2CU6A 1IBKC 4DCSA 4IZ6A 5BUQA 2OO4A 4WV3A 4NXMC 1J5EC 1ML8A 3UOWA 4AQYC 3KXWA 5BSWA 3LNOA 1XRAA 4DV3C 5KYVA 1JOSA 1M6XC 4LFBC 3NYQA 4JI0C 4GKKC 4KTVA 4JI4C 2M5HA 5K85A 3T1YC 2VZEA 1XMOC 1MDFA 5BUSA 1YGTA 2ONFA 4DV0C 1V26A 1PA4A 1BA3A 4KHPC 2P2FA
chains in the Genus database with same CATH topology
1N2FA 3R9XA 1HNWC 1AMUA 4DG8A 2D27A 4LF5C 4KTTA 4MH4A 2YWCA 3GPCA 4JI7C 2UXCC 4NOZA 4DCUA 3AF5A 4JI1C 2HHHC 2JMPA 4R0MA 2UUCC 4FTFA 3OTOC 4L4QA 4ODJA 2UU9C 4GXRA 4BC9A 4RM3A 3L8CA 2D1TA 1ZB9A 3VNRA 4I9GA 3J80D 4BC7A 4GKJC 2OBVA 2P2JA 4LFAC 2P2MA 4PROC 2WD9A 3C5EA 5ADZA 4R1MA 4U5YD 2VQFC 2QVYX 3TDEA 1V25A 5BURA 4YHHC 4B3TC 1N33C 3I08A 5KEIA 1HNZC 3PROC 1MDBA 4D4IA 2OPLA 5A1IA 3LGXA 4DR3C 4YY3C 1LCIA 3NYRA 3VNQA 1YJ7A 4JI2C 4BSZA 3NI2A 5IFIA 3LAXA 2P2BA 4X64C 2UXDC 1N36C 1FUGA 1HH2P 4FUQA 1WF3A 2ASBA 3NPDA 1QWIA 1MXAA 2BJOA 3CJEA 1MXCA 2QL8A 4DCTA 4LF8C 3IEUA 5DV9A 1XNRC 4G37A 3A9VA 5KYTA 4X65C 2D1SA 3FCEA 5BSVA 4DV6C 4ZLPA 5BR8C 5GTDA 1XRCA 1O93A 4ZJZA 3B7WA 4DV5C 3ETCA 3E7XA 5A19A 4X66C 2UXBC 1ZB8A 1N34C 3H2TA 4DR2C 1ULTA 4FUTA 1O92A 4LFCC 4XX2A 5CZXA 2KZFA 2P20A 4DR7C 2HJGA 4OYCA 1O9TA 1RY2A 2P2QA 2UUBC 5AE3A 2QVZX 2Y4OA 4R1LA 2YWBA 4L2ZA 2PN2A 4G1IA 4G36A 2YCBA 4X62C 2DPLA 1O90A 4OX9C 5FLXD 3TQIA 4DR1C 3CW9A 3G7SA 5CZVA 2EGTA 3GR1A 5T8TA 4K0BA 2D1QA 4DV7C 3IEVA 4DV4C 2D28C 3RG2A 3N2QA 3DHVA 4EATA 5BSMA 1WH9A 4ISBA 3ETOA 1MKYA 5AE2A 2Y27A 4OXIA 5JRHA 3DAYA 2QW0X 2OPLB 2E5LC 4WS9A 4MTNA 1FJGC 3DLPX 1EGAA 4DG9A 1I94C 3A4IA 5T8SA 2E7GA 1PG3A 3UZ0A 3J81D 1N32C 2PT7G 3T1HC 1USPA 3GR0A 3PESA 1USPB 2CXCA 5IT9D 1UKKA 4PZPA 2V7BA 4RLFA 3J7AD 5BSUA 4D56A 3TUFA 5BSRA 2E8CA 3CW8X 1GPMA 2Y4NA 1RG9A 3RV2A 3R9WA 1MD9A 1XMQC 1XNQC 2ATWA 1HR0C 3LUSA 4DR4C 4DCVA 4LF7C 3IPLA 4JI8C 4B3MC 4D57A 4NDNA 2QVXX 2D1RA 1VLAA 3EQ6A 3AF6A 2DYJA 3A9UA 1IBMC 4IR7A 2VSQA 4LE5A 3JAMD 3EERA 1PG4A 4NXNC 4RM2A 2BH1X 4TPSB 1NYEA 2UUAC 4DV1C 2WP0C 1K0RA 5LMUC 4RLQA 2PROA 4LF9C 2AYAA 5H9UA 1L2FA 4JI6C 2CY1A 4GS5A 5A2QD 1XRBA 2E0GA 4D4GA 3N54B 3GKUA 5A1GA 4JV5C 3PBKA 4JI3C 4DR6C 2E8FA 4DV2C 3I07A 1MXBA 4PHTA 4RVOA 1HNXC 4BBYA 2VQEC 4JM1A 1T5DX 5BSTA 4DUYC 4B3SC 4I9FA 5K8FA 4GXQA 2XR1A 3FCCA 3LNVA 4DUZC 1LQLA 4HPVA 2P02A 4BCAA 5E7QA 1QM4A 2E8EA 2F4VC 1T5HX 3L95X 3IMLA 5AE1A 4LF6C 4LF4C 4K0KC 3S82A 1IBLC 5IWAC 4B3RC 3E7WA 5LMNC 4RMNA 1KKGA 2ZM6C 3R44A 1P7LA 3VNSA 4L7IA 4DR5C 4JI5C 4RVNA 4JYAC 2D7VA 3SO4A 1IBKC 4DCSA 4IZ6A 5BUQA 2OO4A 4WV3A 4NXMC 1J5EC 1ML8A 3UOWA 4AQYC 3KXWA 5BSWA 1XRAA 4DV3C 5KYVA 1JOSA 4LFBC 3NYQA 4JI0C 4GKKC 4KTVA 4JI4C 5K85A 3T1YC 2VZEA 1XMOC 1MDFA 5BUSA 2ONFA 4DV0C 1V26A 1PA4A 1BA3A 4KHPC 2P2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I07 A;  1N2F A;  2ASB A;  1EGA A;  1I94 C;  1N32 C;  3J81 D;  2E7G A;  1QWI A;  3R9X A;  2BJO A;  2PT7 G;  1HNW C;  3CJE A;  3T1H C;  2QL8 A;  4LF5 C;  4MH4 A;  4DCT A;  1USP A;  1HNX C;  4LF8 C;  3IEU A;  4JI7 C;  2VQE C;  1XNR C;  2UXC C;  4NOZ A;  4DUY C;  1USP B;  4B3S C;  2CXC A;  4DCU A;  4X65 C;  5IT9 D;  1UKK A;  2XR1 A;  4DUZ C;  4DV6 C;  1LQL A;  5BR8 C;  3J7A D;  3AF5 A;  4JI1 C;  2E8E A;  2JMP A;  4DV5 C;  2HHH C;  2UUC C;  2E8C A;  3OTO C;  2F4V C;  2UU9 C;  4X66 C;  2UXB C;  1ZB8 A;  1N34 C;  3R9W A;  4DR2 C;  4LF6 C;  4LF4 C;  1XMQ C;  4K0K C;  1XNQ C;  1IBL C;  2ATW A;  1ZB9 A;  1HR0 C;  4LFC C;  5IWA C;  3LUS A;  4XX2 A;  4B3R C;  2KZF A;  4DR7 C;  2HJG A;  4DR4 C;  5LMN C;  3J80 D;  4DCV A;  4LF7 C;  1KKG A;  4JI8 C;  2ZM6 C;  4GKJ C;  4B3M C;  2UUB C;  4LFA C;  1VLA A;  3AF6 A;  4DR5 C;  2DYJ A;  4JI5 C;  2PN2 A;  4JYA C;  1IBM C;  2D7V A;  2YCB A;  4X62 C;  4OX9 C;  3JAM D;  3EER A;  5FLX D;  2VQF C;  1IBK C;  4DCS A;  4NXN C;  4DR1 C;  2EGT A;  4YHH C;  4B3T C;  1NYE A;  2UUA C;  1N33 C;  4DV1 C;  4NXM C;  1HNZ C;  1J5E C;  1ML8 A;  1K0R A;  5LMU C;  4KHP C;  4DV7 C;  3IEV A;  4DV4 C;  2OPL A;  4LF9 C;  4AQY C;  1L2F A;  1WH9 A;  4DR3 C;  4YY3 C;  4JI6 C;  1MKY A;  2UXD C;  4DV3 C;  2CY1 A;  1JOS A;  5A2Q D;  4LFB C;  4JI0 C;  4JI2 C;  4GKK C;  4BSZ A;  4JI4 C;  3T1Y C;  2OPL B;  3GKU A;  2E5L C;  1XMO C;  4JV5 C;  4JI3 C;  4DR6 C;  4MTN A;  2ONF A;  1FJG C;  4DV0 C;  2E8F A;  4X64 C;  4DV2 C;  1PA4 A;  1N36 C;  1WF3 A;  1HH2 P; 
#chains in the Genus database with same CATH topology
 1N2F A;  3A26 A;  3A25 A;  3R9X A;  1HNW C;  1AMU A;  4DG8 A;  2D27 A;  3O2E A;  4LF5 C;  4KTT A;  4MH4 A;  2YWC A;  3GPC A;  4JI7 C;  2UXC C;  4NOZ A;  4DCU A;  1P4E C;  3AF5 A;  4JI1 C;  3UEB A;  2JMP A;  2HHH C;  4R0M A;  2UUC C;  4FTF A;  3OTO C;  4L4Q A;  4ODJ A;  2UU9 C;  4GXR A;  4PUG A;  4BC9 A;  4RM3 A;  3L8C A;  2D1T A;  1ZB9 A;  3VNR A;  4I9G A;  1FLO A;  3J80 D;  2Z51 A;  4BC7 A;  4GKJ C;  2MCQ A;  2OBV A;  2P2J A;  4LFA C;  1XHJ A;  2P2M A;  4PRO C;  2WD9 A;  3C5E A;  5ADZ A;  4R1M A;  3UX3 A;  1P4E A;  2ZZM A;  4U5Y D;  2VQF C;  2QVY X;  3TDE A;  1V25 A;  5BUR A;  4YHH C;  4B3T C;  1N33 C;  3I08 A;  4PUI A;  5KEI A;  1HNZ C;  3PRO C;  1MDB A;  4D4I A;  2OPL A;  5A1I A;  3LGX A;  4DR3 C;  4YY3 C;  1LCI A;  3NYR A;  3VNQ A;  1YJ7 A;  4JI2 C;  4BSZ A;  3CQ2 A;  3NI2 A;  5IFI A;  3LAX A;  1PU1 A;  2P2B A;  2M5O A;  4X64 C;  2UXD C;  1N36 C;  1FUG A;  4FUQ A;  1WF3 A;  1HH2 P;  2ASB A;  1M6X A;  3NPD A;  1QWI A;  1MXA A;  2BJO A;  2KZ0 A;  3CJE A;  1MXC A;  2QL8 A;  1TH5 A;  4DCT A;  4LF8 C;  3IEU A;  5DV9 A;  2ZTB A;  1XNR C;  4G37 A;  3A9V A;  5KYT A;  4X65 C;  2D1S A;  3FCE A;  5BSV A;  4DV6 C;  4ZLP A;  5BR8 C;  5GTD A;  1XRC A;  1O93 A;  4ZJZ A;  3B7W A;  4DV5 C;  3ETC A;  3E7X A;  5A19 A;  2MM9 A;  4X66 C;  2UXB C;  1ZB8 A;  1N34 C;  3H2T A;  4DR2 C;  3CQ3 A;  1ULT A;  4FUT A;  1O92 A;  4LFC C;  4XX2 A;  5CZX A;  2KZF A;  2P20 A;  4DR7 C;  2HJG A;  4OYC A;  1O9T A;  1RY2 A;  2P2Q A;  2UUB C;  5AE3 A;  2QVZ X;  2Y4O A;  4R1L A;  2YWB A;  4L2Z A;  2PN2 A;  4G1I A;  4G36 A;  3UX2 A;  2YCB A;  4X62 C;  2DPL A;  1O90 A;  4OX9 C;  5FLX D;  3TQI A;  4DR1 C;  3CW9 A;  3G7S A;  5CZV A;  2EGT A;  3GR1 A;  5T8T A;  1IB8 A;  4K0B A;  2D1Q A;  4DV7 C;  3IEV A;  4DV4 C;  2D28 C;  3RG2 A;  3N2Q A;  3DHV A;  4EAT A;  5BSM A;  3TR3 A;  1WH9 A;  4ISB A;  3ETO A;  1MKY A;  5AE2 A;  2Y27 A;  4OXI A;  5JRH A;  3DAY A;  2QW0 X;  2OPL B;  2E5L C;  4WS9 A;  4MTN A;  1FJG C;  1V60 A;  1WCJ A;  3DLP X;  1EGA A;  4DG9 A;  1I94 C;  3A4I A;  5T8S A;  2E7G A;  1PG3 A;  3UZ0 A;  3J81 D;  1N32 C;  1NY8 A;  2PT7 G;  3T1H C;  4PUH A;  1USP A;  3GR0 A;  3PES A;  1USP B;  2CXC A;  5IT9 D;  1UKK A;  4PZP A;  2V7B A;  4RLF A;  3J7A D;  5BSU A;  4D56 A;  2ZZN A;  3TUF A;  5BSR A;  2E8C A;  3CW8 X;  1GPM A;  2Y4N A;  1RG9 A;  3RV2 A;  2NCL A;  3CQ1 A;  3R9W A;  1MD9 A;  1XMQ C;  1XNQ C;  2ATW A;  1HR0 C;  3LUS A;  4DR4 C;  4DCV A;  4LF7 C;  3IPL A;  4JI8 C;  3K6R A;  4B3M C;  4D57 A;  4NDN A;  2QVX X;  1XS3 A;  2D1R A;  1VLA A;  3EQ6 A;  2MMA B;  2JNV A;  2DYJ A;  3A9U A;  3AF6 A;  1IBM C;  4IR7 A;  2VSQ A;  4LE5 A;  3JAM D;  3EER A;  1PG4 A;  4NXN C;  4RM2 A;  2BH1 X;  4TPS B;  1NYE A;  2UUA C;  3AY0 A;  4DV1 C;  2WP0 C;  1K0R A;  5LMU C;  4RLQ A;  2PRO A;  4LF9 C;  2AYA A;  5H9U A;  1L2F A;  2DHM A;  1VEH A;  4JI6 C;  2CY1 A;  4GS5 A;  5A2Q D;  1XDX A;  1XRB A;  2E0G A;  4D4G A;  3N54 B;  3GKU A;  5A1G A;  4JV5 C;  3PBK A;  4JI3 C;  4DR6 C;  2E8F A;  4DV2 C;  3I07 A;  1MXB A;  1UWD A;  4PHT A;  2KDN A;  5LCI A;  4RVO A;  1HNX C;  4BBY A;  3FM7 A;  2VQE C;  4JM1 A;  1T5D X;  5BST A;  4DUY C;  4B3S C;  4I9F A;  5K8F A;  4GXQ A;  2XR1 A;  3FCC A;  3LNV A;  4DUZ C;  1LQL A;  4HPV A;  2P02 A;  4BCA A;  5E7Q A;  1QM4 A;  2E8E A;  2F4V C;  1T5H X;  3L95 X;  2YX1 A;  3IML A;  5AE1 A;  4LF6 C;  4LF4 C;  4K0K C;  3S82 A;  1IBL C;  2PG1 E;  5IWA C;  4B3R C;  3E7W A;  5LMN C;  4RMN A;  1KKG A;  2ZM6 C;  3R44 A;  1P7L A;  3VNS A;  4L7I A;  4DR5 C;  4RVN A;  4JI5 C;  4JYA C;  2D7V A;  3SO4 A;  2CU6 A;  1IBK C;  4DCS A;  4IZ6 A;  5BUQ A;  2OO4 A;  4WV3 A;  4NXM C;  1J5E C;  1ML8 A;  3UOW A;  4AQY C;  3KXW A;  5BSW A;  3LNO A;  1XRA A;  4DV3 C;  5KYV A;  1JOS A;  1M6X C;  4LFB C;  3NYQ A;  4JI0 C;  4GKK C;  4KTV A;  4JI4 C;  2M5H A;  5K85 A;  3T1Y C;  2VZE A;  1XMO C;  1MDF A;  5BUS A;  1YGT A;  2ONF A;  4DV0 C;  1V26 A;  1PA4 A;  1BA3 A;  4KHP C;  2P2F A; 
#chains in the Genus database with same CATH homology
 1N2F A;  3R9X A;  1HNW C;  1AMU A;  4DG8 A;  2D27 A;  4LF5 C;  4KTT A;  4MH4 A;  2YWC A;  3GPC A;  4JI7 C;  2UXC C;  4NOZ A;  4DCU A;  3AF5 A;  4JI1 C;  2HHH C;  2JMP A;  4R0M A;  2UUC C;  4FTF A;  3OTO C;  4L4Q A;  4ODJ A;  2UU9 C;  4GXR A;  4BC9 A;  4RM3 A;  3L8C A;  2D1T A;  1ZB9 A;  3VNR A;  4I9G A;  3J80 D;  4BC7 A;  4GKJ C;  2OBV A;  2P2J A;  4LFA C;  2P2M A;  4PRO C;  2WD9 A;  3C5E A;  5ADZ A;  4R1M A;  4U5Y D;  2VQF C;  2QVY X;  3TDE A;  1V25 A;  5BUR A;  4YHH C;  4B3T C;  1N33 C;  3I08 A;  5KEI A;  1HNZ C;  3PRO C;  1MDB A;  4D4I A;  2OPL A;  5A1I A;  3LGX A;  4DR3 C;  4YY3 C;  1LCI A;  3NYR A;  3VNQ A;  1YJ7 A;  4JI2 C;  4BSZ A;  3NI2 A;  5IFI A;  3LAX A;  2P2B A;  4X64 C;  2UXD C;  1N36 C;  1FUG A;  1HH2 P;  4FUQ A;  1WF3 A;  2ASB A;  3NPD A;  1QWI A;  1MXA A;  2BJO A;  3CJE A;  1MXC A;  2QL8 A;  4DCT A;  4LF8 C;  3IEU A;  5DV9 A;  1XNR C;  4G37 A;  3A9V A;  5KYT A;  4X65 C;  2D1S A;  3FCE A;  5BSV A;  4DV6 C;  4ZLP A;  5BR8 C;  5GTD A;  1XRC A;  1O93 A;  4ZJZ A;  3B7W A;  4DV5 C;  3ETC A;  3E7X A;  5A19 A;  4X66 C;  2UXB C;  1ZB8 A;  1N34 C;  3H2T A;  4DR2 C;  1ULT A;  4FUT A;  1O92 A;  4LFC C;  4XX2 A;  5CZX A;  2KZF A;  2P20 A;  4DR7 C;  2HJG A;  4OYC A;  1O9T A;  1RY2 A;  2P2Q A;  2UUB C;  5AE3 A;  2QVZ X;  2Y4O A;  4R1L A;  2YWB A;  4L2Z A;  2PN2 A;  4G1I A;  4G36 A;  2YCB A;  4X62 C;  2DPL A;  1O90 A;  4OX9 C;  5FLX D;  3TQI A;  4DR1 C;  3CW9 A;  3G7S A;  5CZV A;  2EGT A;  3GR1 A;  5T8T A;  4K0B A;  2D1Q A;  4DV7 C;  3IEV A;  4DV4 C;  2D28 C;  3RG2 A;  3N2Q A;  3DHV A;  4EAT A;  5BSM A;  1WH9 A;  4ISB A;  3ETO A;  1MKY A;  5AE2 A;  2Y27 A;  4OXI A;  5JRH A;  3DAY A;  2QW0 X;  2OPL B;  2E5L C;  4WS9 A;  4MTN A;  1FJG C;  3DLP X;  1EGA A;  4DG9 A;  1I94 C;  3A4I A;  5T8S A;  2E7G A;  1PG3 A;  3UZ0 A;  3J81 D;  1N32 C;  2PT7 G;  3T1H C;  1USP A;  3GR0 A;  3PES A;  1USP B;  2CXC A;  5IT9 D;  1UKK A;  4PZP A;  2V7B A;  4RLF A;  3J7A D;  5BSU A;  4D56 A;  3TUF A;  5BSR A;  2E8C A;  3CW8 X;  1GPM A;  2Y4N A;  1RG9 A;  3RV2 A;  3R9W A;  1MD9 A;  1XMQ C;  1XNQ C;  2ATW A;  1HR0 C;  3LUS A;  4DR4 C;  4DCV A;  4LF7 C;  3IPL A;  4JI8 C;  4B3M C;  4D57 A;  4NDN A;  2QVX X;  2D1R A;  1VLA A;  3EQ6 A;  3AF6 A;  2DYJ A;  3A9U A;  1IBM C;  4IR7 A;  2VSQ A;  4LE5 A;  3JAM D;  3EER A;  1PG4 A;  4NXN C;  4RM2 A;  2BH1 X;  4TPS B;  1NYE A;  2UUA C;  4DV1 C;  2WP0 C;  1K0R A;  5LMU C;  4RLQ A;  2PRO A;  4LF9 C;  2AYA A;  5H9U A;  1L2F A;  4JI6 C;  2CY1 A;  4GS5 A;  5A2Q D;  1XRB A;  2E0G A;  4D4G A;  3N54 B;  3GKU A;  5A1G A;  4JV5 C;  3PBK A;  4JI3 C;  4DR6 C;  2E8F A;  4DV2 C;  3I07 A;  1MXB A;  4PHT A;  4RVO A;  1HNX C;  4BBY A;  2VQE C;  4JM1 A;  1T5D X;  5BST A;  4DUY C;  4B3S C;  4I9F A;  5K8F A;  4GXQ A;  2XR1 A;  3FCC A;  3LNV A;  4DUZ C;  1LQL A;  4HPV A;  2P02 A;  4BCA A;  5E7Q A;  1QM4 A;  2E8E A;  2F4V C;  1T5H X;  3L95 X;  3IML A;  5AE1 A;  4LF6 C;  4LF4 C;  4K0K C;  3S82 A;  1IBL C;  5IWA C;  4B3R C;  3E7W A;  5LMN C;  4RMN A;  1KKG A;  2ZM6 C;  3R44 A;  1P7L A;  3VNS A;  4L7I A;  4DR5 C;  4JI5 C;  4RVN A;  4JYA C;  2D7V A;  3SO4 A;  1IBK C;  4DCS A;  4IZ6 A;  5BUQ A;  2OO4 A;  4WV3 A;  4NXM C;  1J5E C;  1ML8 A;  3UOW A;  4AQY C;  3KXW A;  5BSW A;  1XRA A;  4DV3 C;  5KYV A;  1JOS A;  4LFB C;  3NYQ A;  4JI0 C;  4GKK C;  4KTV A;  4JI4 C;  5K85 A;  3T1Y C;  2VZE A;  1XMO C;  1MDF A;  5BUS A;  2ONF A;  4DV0 C;  1V26 A;  1PA4 A;  1BA3 A;  4KHP C;  2P2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...