4LF8C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 54
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf8C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf8C02
3J80D 4X65C 4B3SC 4LFBC 1HNWC 3CJEA 5LMUC 1N32C 4LFCC 2UXDC 4DR4C 4DV0C 1WF3A 1XMOC 4JV5C 4B3TC 4B3MC 2E8FA 3T1YC 4YY3C 4LFAC 4DV1C 2UU9C 4JYAC 3IEUA 4JI5C 4KHPC 2YCBA 2KZFA 1IBMC 5A2QD 4DR1C 1KKGA 4DCVA 4DV4C 4K0KC 1USPA 4BSZA 1N34C 3R9XA 2CY1A 1JOSA 2E8EA 1USPB 4JI1C 4NXNC 1HH2P 3OTOC 1ZB8A 3AF6A 1XNRC 3T1HC 4LF4C 4MTNA 4NXMC 1J5EC 3I07A 2HHHC 4JI7C 2XR1A 4JI4C 4DCUA 2PT7G 4DUYC 1WH9A 2F4VC 1HR0C 4DV6C 2JMPA 3JAMD 2BJOA 1K0RA 2QL8A 4LF5C 1N33C 4MH4A 4XX2A 4DUZC 1N2FA 4B3RC 1NYEA 2ONFA 4X62C 3J81D 1IBKC 4JI2C 4DR6C 5IT9D 2VQFC 5LMNC 4JI6C 4X64C 4DV5C 4LF8C 2HJGA 1MKYA 2D7VA 2ASBA 1PA4A 2EGTA 1ML8A 2DYJA 4NOZA 2OPLA 1QWIA 2E8CA 2UXCC 4JI3C 4LF9C 2ZM6C 1ZB9A 4DR2C 4DCTA 1N36C 4AQYC 4JI0C 4LF6C 4DR7C 1HNZC 1I94C 4DV7C 4JI8C 3GKUA 1VLAA 4X66C 2E7GA 3LUSA 1L2FA 2UUBC 4DR3C 1FJGC 4GKKC 2E5LC 4DV2C 2UUCC 1HNXC 2UXBC 1XMQC 1EGAA 2PN2A 5BR8C 1IBLC 3J7AD 4DV3C 5IWAC 1LQLA 3IEVA 4GKJC 5FLXD 2ATWA 1UKKA 4DCSA 4OX9C 2OPLB 2CXCA 2VQEC 2UUAC 3EERA 4YHHC 3AF5A 4DR5C 4LF7C 3R9WA 1XNQC
chains in the Genus database with same CATH superfamily
3J80D 1YGTA 4ZJZA 2PG1E 4DV0C 5K85A 4PHTA 3T1YC 5ADZA 4DG9A 2D1SA 1RY2A 2KZFA 2DHMA 1PG4A 3R9XA 3N54B 1JOSA 1MXBA 3LAXA 3OTOC 3AF6A 1M6XA 3T1HC 5DV9A 4K0BA 4NXMC 4JI7C 5AE2A 2D27A 1T5HX 1HR0C 2Y27A 4LF5C 1FLOA 2WP0C 4DUZC 1N2FA 3E7WA 2ONFA 4D57A 3J81D 4JI2C 5CZVA 5IT9D 4IR7A 3TQIA 4X64C 3A9UA 4LF8C 4WV3A 1MKYA 3G7SA 5GTDA 2MM9A 5BSUA 2E8CA 2UXCC 4DR2C 4DCTA 3RV2A 4JI0C 4LF6C 1XRCA 4GXQA 2ZTBA 4X66C 1L2FA 3K6RA 1T5DX 5T8SA 3EQ6A 1QM4A 2D28C 2AYAA 4RMNA 4ZLPA 3GR1A 2PN2A 4FTFA 4PUGA 4BCAA 1VEHA 3VNSA 4GKJC 4OX9C 5CZXA 1WCJA 2CXCA 1XHJA 4LF7C 2E0GA 4X65C 3CJEA 4L4QA 5LMUC 2UXDC 4LFCC 4DR4C 4NDNA 1MXAA 4LFAC 2M5HA 2QW0X 2UU9C 3IEUA 4JI5C 1LCIA 4IZ6A 1BA3A 2YCBA 1UWDA 5KEIA 1KKGA 4K0KC 5IFIA 3VNRA 4OYCA 1USPB 3PROC 4NXNC 1HH2P 1ZB8A 5AE1A 2PROA 1AMUA 3I07A 2HHHC 3KXWA 3SO4A 4I9FA 3GPCA 4DCUA 3R44A 3H2TA 4DUYC 4RM3A 2JMPA 2YX1A 4PUIA 2BJOA 3CW9A 2D1TA 4B3RC 3TDEA 1XRAA 3UEBA 1YJ7A 2OO4A 2P2FA 4R1MA 1IBKC 4DR6C 4PUHA 1FUGA 3ETOA 4DV5C 2YWCA 2CU6A 1MD9A 4G37A 1ML8A 2DYJA 4NOZA 4BBYA 4LF9C 4BC7A 1N36C 4RLFA 4DR7C 3GKUA 3N2QA 1VLAA 4I9GA 4GKKC 2UXBC 1XMQC 2P20A 2KDNA 3A4IA 3J7AD 3E7XA 3I08A 3CQ1A 2JNVA 3L95X 3NI2A 3EERA 3GR0A 4R0MA 4YHHC 4DR5C 5BUQA 4B3SC 4TPSB 1HNWC 5A19A 1N32C 5BUSA 1XMOC 4JV5C 4KTVA 4RLQA 4OXIA 4FUQA 4D4GA 4YY3C 2P2JA 2WD9A 2MMAB 5A1GA 3C5EA 1IBMC 5A2QD 4DR1C 4DV4C 4PZPA 2CY1A 2NCLA 2E8EA 4JI1C 1XNRC 3IMLA 4G36A 3LNVA 2QVYX 4MTNA 1J5EC 2XR1A 3CQ2A 4JI4C 2QVXX 4GXRA 4HPVA 2F4VC 4DV6C 3JAMD 3S82A 1K0RA 2QL8A 1MXCA 5E7QA 1XRBA 1O9TA 1P4EC 1NYEA 3DAYA 3VNQA 3DHVA 1XDXA 2DPLA 2BH1X 4ODJA 4X62C 5BSTA 1MDFA 2VQFC 5A1IA 4EATA 3A9VA 2HJGA 4WS9A 2D1RA 2D7VA 3UZ0A 3UX3A 2EGTA 2QVZX 1PG3A 1QWIA 3PBKA 2ZM6C 5BSWA 1ULTA 3A26A 1I94C 4DV7C 2E7GA 3UOWA 4DR3C 2ZZNA 1FJGC 3AY0A 4L7IA 4DV2C 5K8FA 1HNXC 2P2MA 1EGAA 3IPLA 4PROC 5BR8C 1O92A 2KZ0A 4DV3C 2VZEA 2Z51A 4RVOA 4LE5A 5FLXD 2ATWA 2VSQA 3LNOA 5AE3A 2OPLB 4R1LA 3NYRA 3NYQA 4ISBA 4DG8A 3AF5A 1XNQC 4LFBC 2YWBA 2OBVA 3FCCA 1RG9A 1WF3A 3CW8X 4B3TC 3PESA 4B3MC 2E8FA 3CQ3A 1MDBA 5H9UA 4DV1C 4JYAC 4KHPC 4U5YD 5BSRA 5BSVA 1P7LA 4DCVA 1USPA 4BSZA 1N34C 1PU1A 4BC9A 4RM2A 4KTTA 4LF4C 3TUFA 5JRHA 3DLPX 2PT7G 1WH9A 5BURA 3A25A 3B7WA 2MCQA 4MH4A 4XX2A 1N33C 3ETCA 4D56A 4L2ZA 1GPMA 4JM1A 1TH5A 5LMNC 5KYTA 4JI6C 4D4IA 1V60A 4RVNA 2D1QA 3L8CA 2ASBA 1PA4A 1XS3A 2OPLA 4JI3C 3RG2A 1ZB9A 4AQYC 3TR3A 1HNZC 4JI8C 5LCIA 3LUSA 2M5OA 2UUBC 3LGXA 4FUTA 2P02A 1O93A 2Y4OA 3FM7A 2E5LC 2UUCC 5BSMA 2P2QA 2Y4NA 2P2BA 1V26A 1IB8A 3UX2A 2V7BA 1IBLC 5IWAC 1LQLA 3IEVA 1O90A 1UKKA 4DCSA 3FCEA 1NY8A 3NPDA 3O2EA 2VQEC 2UUAC 1P4EA 5KYVA 5T8TA 4GS5A 1M6XC 1V25A 3R9WA 4G1IA 2ZZMA
chains in the Genus database with same CATH topology
3J80D 4ZJZA 4DV0C 5K85A 4PHTA 3T1YC 5ADZA 4DG9A 2D1SA 1RY2A 2KZFA 1PG4A 3R9XA 3N54B 1JOSA 1MXBA 3LAXA 3OTOC 3AF6A 3T1HC 5DV9A 4K0BA 4NXMC 4JI7C 5AE2A 2D27A 1T5HX 1HR0C 2Y27A 4LF5C 2WP0C 4DUZC 1N2FA 3E7WA 2ONFA 4D57A 3J81D 4JI2C 5CZVA 5IT9D 4IR7A 3TQIA 4X64C 3A9UA 4LF8C 4WV3A 1MKYA 3G7SA 5GTDA 5BSUA 2UXCC 2E8CA 4DR2C 4DCTA 3RV2A 4JI0C 4LF6C 1XRCA 4GXQA 4X66C 1L2FA 1T5DX 5T8SA 3EQ6A 1QM4A 2D28C 2AYAA 4RMNA 4ZLPA 3GR1A 2PN2A 4FTFA 3VNSA 4BCAA 4GKJC 4OX9C 5CZXA 2CXCA 4LF7C 2E0GA 4X65C 3CJEA 4L4QA 5LMUC 2UXDC 4LFCC 4DR4C 4NDNA 1MXAA 4LFAC 2QW0X 2UU9C 3IEUA 4JI5C 1LCIA 4IZ6A 1BA3A 2YCBA 5KEIA 1KKGA 4K0KC 5IFIA 3VNRA 4OYCA 1USPB 3PROC 4NXNC 1HH2P 1ZB8A 5AE1A 2PROA 1AMUA 3I07A 2HHHC 3KXWA 3SO4A 4I9FA 3GPCA 4DCUA 3R44A 3H2TA 4DUYC 4RM3A 2JMPA 2BJOA 3CW9A 2D1TA 4B3RC 3TDEA 1XRAA 2OO4A 1YJ7A 2P2FA 4R1MA 1IBKC 4DR6C 1FUGA 3ETOA 4DV5C 2YWCA 1MD9A 4G37A 1ML8A 2DYJA 4NOZA 4BBYA 4LF9C 4BC7A 1N36C 4RLFA 4DR7C 3GKUA 3N2QA 1VLAA 4I9GA 4GKKC 2UXBC 1XMQC 2P20A 3A4IA 3J7AD 3E7XA 3I08A 3L95X 3NI2A 3EERA 3GR0A 4R0MA 4YHHC 4DR5C 5BUQA 4B3SC 4TPSB 1HNWC 5A19A 1N32C 5BUSA 1XMOC 4JV5C 4KTVA 4RLQA 4OXIA 4FUQA 4D4GA 4YY3C 2P2JA 2WD9A 5A1GA 3C5EA 1IBMC 5A2QD 4DR1C 4DV4C 4PZPA 2CY1A 2E8EA 4JI1C 1XNRC 3IMLA 4G36A 3LNVA 2QVYX 4MTNA 1J5EC 2XR1A 4JI4C 2QVXX 4GXRA 4HPVA 2F4VC 4DV6C 3JAMD 3S82A 1K0RA 2QL8A 1MXCA 5E7QA 1XRBA 1O9TA 1NYEA 3DAYA 3VNQA 3DHVA 2DPLA 2BH1X 4ODJA 4X62C 5BSTA 1MDFA 2VQFC 5A1IA 4EATA 3A9VA 2HJGA 4WS9A 2D1RA 2D7VA 3UZ0A 2EGTA 2QVZX 1PG3A 1QWIA 3PBKA 2ZM6C 5BSWA 1ULTA 1I94C 4DV7C 2E7GA 3UOWA 4DR3C 1FJGC 4L7IA 4DV2C 5K8FA 1HNXC 2P2MA 1EGAA 3IPLA 4PROC 5BR8C 1O92A 4DV3C 2VZEA 4RVOA 4LE5A 5FLXD 2ATWA 2VSQA 2OPLB 5AE3A 4R1LA 3NYRA 3NYQA 4ISBA 4DG8A 3AF5A 1XNQC 4LFBC 2YWBA 2OBVA 3FCCA 1RG9A 1WF3A 3CW8X 4B3TC 3PESA 4B3MC 2E8FA 1MDBA 5H9UA 4DV1C 4JYAC 4KHPC 4U5YD 5BSRA 5BSVA 1P7LA 4DCVA 1USPA 4BSZA 1N34C 4BC9A 4RM2A 4KTTA 4LF4C 3TUFA 5JRHA 3DLPX 2PT7G 1WH9A 5BURA 3B7WA 1N33C 4MH4A 4XX2A 3ETCA 4D56A 4L2ZA 1GPMA 4JM1A 5LMNC 5KYTA 4JI6C 4D4IA 4RVNA 2D1QA 3L8CA 2ASBA 1PA4A 2OPLA 4JI3C 3RG2A 1ZB9A 4AQYC 1HNZC 4JI8C 3LUSA 2UUBC 3LGXA 4FUTA 2P02A 1O93A 2Y4OA 2E5LC 2UUCC 5BSMA 2P2QA 2Y4NA 2P2BA 1V26A 2V7BA 1IBLC 5IWAC 1LQLA 3IEVA 1O90A 1UKKA 4DCSA 3FCEA 3NPDA 2VQEC 2UUAC 5KYVA 5T8TA 4GS5A 1V25A 3R9WA 4G1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 D;  4X65 C;  4B3S C;  4LFB C;  1HNW C;  3CJE A;  5LMU C;  1N32 C;  4LFC C;  2UXD C;  4DR4 C;  4DV0 C;  1WF3 A;  1XMO C;  4JV5 C;  4B3T C;  4B3M C;  2E8F A;  3T1Y C;  4YY3 C;  4LFA C;  4DV1 C;  2UU9 C;  4JYA C;  3IEU A;  4JI5 C;  4KHP C;  2YCB A;  2KZF A;  1IBM C;  5A2Q D;  4DR1 C;  1KKG A;  4DCV A;  4DV4 C;  4K0K C;  1USP A;  4BSZ A;  1N34 C;  3R9X A;  2CY1 A;  1JOS A;  2E8E A;  1USP B;  4JI1 C;  4NXN C;  1HH2 P;  3OTO C;  1ZB8 A;  3AF6 A;  1XNR C;  3T1H C;  4LF4 C;  4MTN A;  4NXM C;  1J5E C;  3I07 A;  2HHH C;  4JI7 C;  2XR1 A;  4JI4 C;  4DCU A;  2PT7 G;  4DUY C;  1WH9 A;  2F4V C;  1HR0 C;  4DV6 C;  2JMP A;  3JAM D;  2BJO A;  1K0R A;  2QL8 A;  4LF5 C;  1N33 C;  4MH4 A;  4XX2 A;  4DUZ C;  1N2F A;  4B3R C;  1NYE A;  2ONF A;  4X62 C;  3J81 D;  1IBK C;  4JI2 C;  4DR6 C;  5IT9 D;  2VQF C;  5LMN C;  4JI6 C;  4X64 C;  4DV5 C;  4LF8 C;  2HJG A;  1MKY A;  2D7V A;  2ASB A;  1PA4 A;  2EGT A;  1ML8 A;  2DYJ A;  4NOZ A;  2OPL A;  1QWI A;  2E8C A;  2UXC C;  4JI3 C;  4LF9 C;  2ZM6 C;  1ZB9 A;  4DR2 C;  4DCT A;  1N36 C;  4AQY C;  4JI0 C;  4LF6 C;  4DR7 C;  1HNZ C;  1I94 C;  4DV7 C;  4JI8 C;  3GKU A;  1VLA A;  4X66 C;  2E7G A;  3LUS A;  1L2F A;  2UUB C;  4DR3 C;  1FJG C;  4GKK C;  2E5L C;  4DV2 C;  2UUC C;  1HNX C;  2UXB C;  1XMQ C;  1EGA A;  2PN2 A;  5BR8 C;  1IBL C;  3J7A D;  4DV3 C;  5IWA C;  1LQL A;  3IEV A;  4GKJ C;  5FLX D;  2ATW A;  1UKK A;  4DCS A;  4OX9 C;  2OPL B;  2CXC A;  2VQE C;  2UUA C;  3EER A;  4YHH C;  3AF5 A;  4DR5 C;  4LF7 C;  3R9W A;  1XNQ C; 
#chains in the Genus database with same CATH topology
 3J80 D;  1YGT A;  4ZJZ A;  2PG1 E;  4DV0 C;  5K85 A;  4PHT A;  3T1Y C;  5ADZ A;  4DG9 A;  2D1S A;  1RY2 A;  2KZF A;  2DHM A;  1PG4 A;  3R9X A;  3N54 B;  1JOS A;  1MXB A;  3LAX A;  3OTO C;  3AF6 A;  1M6X A;  3T1H C;  5DV9 A;  4K0B A;  4NXM C;  4JI7 C;  5AE2 A;  2D27 A;  1T5H X;  1HR0 C;  2Y27 A;  4LF5 C;  1FLO A;  2WP0 C;  4DUZ C;  1N2F A;  3E7W A;  2ONF A;  4D57 A;  3J81 D;  4JI2 C;  5CZV A;  5IT9 D;  4IR7 A;  3TQI A;  4X64 C;  3A9U A;  4LF8 C;  4WV3 A;  1MKY A;  3G7S A;  5GTD A;  2MM9 A;  5BSU A;  2E8C A;  2UXC C;  4DR2 C;  4DCT A;  3RV2 A;  4JI0 C;  4LF6 C;  1XRC A;  4GXQ A;  2ZTB A;  4X66 C;  1L2F A;  3K6R A;  1T5D X;  5T8S A;  3EQ6 A;  1QM4 A;  2D28 C;  2AYA A;  4RMN A;  4ZLP A;  3GR1 A;  2PN2 A;  4FTF A;  4PUG A;  4BCA A;  1VEH A;  3VNS A;  4GKJ C;  4OX9 C;  5CZX A;  1WCJ A;  2CXC A;  1XHJ A;  4LF7 C;  2E0G A;  4X65 C;  3CJE A;  4L4Q A;  5LMU C;  2UXD C;  4LFC C;  4DR4 C;  4NDN A;  1MXA A;  4LFA C;  2M5H A;  2QW0 X;  2UU9 C;  3IEU A;  4JI5 C;  1LCI A;  4IZ6 A;  1BA3 A;  2YCB A;  1UWD A;  5KEI A;  1KKG A;  4K0K C;  5IFI A;  3VNR A;  4OYC A;  1USP B;  3PRO C;  4NXN C;  1HH2 P;  1ZB8 A;  5AE1 A;  2PRO A;  1AMU A;  3I07 A;  2HHH C;  3KXW A;  3SO4 A;  4I9F A;  3GPC A;  4DCU A;  3R44 A;  3H2T A;  4DUY C;  4RM3 A;  2JMP A;  2YX1 A;  4PUI A;  2BJO A;  3CW9 A;  2D1T A;  4B3R C;  3TDE A;  1XRA A;  3UEB A;  1YJ7 A;  2OO4 A;  2P2F A;  4R1M A;  1IBK C;  4DR6 C;  4PUH A;  1FUG A;  3ETO A;  4DV5 C;  2YWC A;  2CU6 A;  1MD9 A;  4G37 A;  1ML8 A;  2DYJ A;  4NOZ A;  4BBY A;  4LF9 C;  4BC7 A;  1N36 C;  4RLF A;  4DR7 C;  3GKU A;  3N2Q A;  1VLA A;  4I9G A;  4GKK C;  2UXB C;  1XMQ C;  2P20 A;  2KDN A;  3A4I A;  3J7A D;  3E7X A;  3I08 A;  3CQ1 A;  2JNV A;  3L95 X;  3NI2 A;  3EER A;  3GR0 A;  4R0M A;  4YHH C;  4DR5 C;  5BUQ A;  4B3S C;  4TPS B;  1HNW C;  5A19 A;  1N32 C;  5BUS A;  1XMO C;  4JV5 C;  4KTV A;  4RLQ A;  4OXI A;  4FUQ A;  4D4G A;  4YY3 C;  2P2J A;  2WD9 A;  2MMA B;  5A1G A;  3C5E A;  1IBM C;  5A2Q D;  4DR1 C;  4DV4 C;  4PZP A;  2CY1 A;  2NCL A;  2E8E A;  4JI1 C;  1XNR C;  3IML A;  4G36 A;  3LNV A;  2QVY X;  4MTN A;  1J5E C;  2XR1 A;  3CQ2 A;  4JI4 C;  2QVX X;  4GXR A;  4HPV A;  2F4V C;  4DV6 C;  3JAM D;  3S82 A;  1K0R A;  2QL8 A;  1MXC A;  5E7Q A;  1XRB A;  1O9T A;  1P4E C;  1NYE A;  3DAY A;  3VNQ A;  3DHV A;  1XDX A;  2DPL A;  2BH1 X;  4ODJ A;  4X62 C;  5BST A;  1MDF A;  2VQF C;  5A1I A;  4EAT A;  3A9V A;  2HJG A;  4WS9 A;  2D1R A;  2D7V A;  3UZ0 A;  3UX3 A;  2EGT A;  2QVZ X;  1PG3 A;  1QWI A;  3PBK A;  2ZM6 C;  5BSW A;  1ULT A;  3A26 A;  1I94 C;  4DV7 C;  2E7G A;  3UOW A;  4DR3 C;  2ZZN A;  1FJG C;  3AY0 A;  4L7I A;  4DV2 C;  5K8F A;  1HNX C;  2P2M A;  1EGA A;  3IPL A;  4PRO C;  5BR8 C;  1O92 A;  2KZ0 A;  4DV3 C;  2VZE A;  2Z51 A;  4RVO A;  4LE5 A;  5FLX D;  2ATW A;  2VSQ A;  3LNO A;  5AE3 A;  2OPL B;  4R1L A;  3NYR A;  3NYQ A;  4ISB A;  4DG8 A;  3AF5 A;  1XNQ C;  4LFB C;  2YWB A;  2OBV A;  3FCC A;  1RG9 A;  1WF3 A;  3CW8 X;  4B3T C;  3PES A;  4B3M C;  2E8F A;  3CQ3 A;  1MDB A;  5H9U A;  4DV1 C;  4JYA C;  4KHP C;  4U5Y D;  5BSR A;  5BSV A;  1P7L A;  4DCV A;  1USP A;  4BSZ A;  1N34 C;  1PU1 A;  4BC9 A;  4RM2 A;  4KTT A;  4LF4 C;  3TUF A;  5JRH A;  3DLP X;  2PT7 G;  1WH9 A;  5BUR A;  3A25 A;  3B7W A;  2MCQ A;  4MH4 A;  4XX2 A;  1N33 C;  3ETC A;  4D56 A;  4L2Z A;  1GPM A;  4JM1 A;  1TH5 A;  5LMN C;  5KYT A;  4JI6 C;  4D4I A;  1V60 A;  4RVN A;  2D1Q A;  3L8C A;  2ASB A;  1PA4 A;  1XS3 A;  2OPL A;  4JI3 C;  3RG2 A;  1ZB9 A;  4AQY C;  3TR3 A;  1HNZ C;  4JI8 C;  5LCI A;  3LUS A;  2M5O A;  2UUB C;  3LGX A;  4FUT A;  2P02 A;  1O93 A;  2Y4O A;  3FM7 A;  2E5L C;  2UUC C;  5BSM A;  2P2Q A;  2Y4N A;  2P2B A;  1V26 A;  1IB8 A;  3UX2 A;  2V7B A;  1IBL C;  5IWA C;  1LQL A;  3IEV A;  1O90 A;  1UKK A;  4DCS A;  3FCE A;  1NY8 A;  3NPD A;  3O2E A;  2VQE C;  2UUA C;  1P4E A;  5KYV A;  5T8T A;  4GS5 A;  1M6X C;  1V25 A;  3R9W A;  4G1I A;  2ZZM A; 
#chains in the Genus database with same CATH homology
 3J80 D;  4ZJZ A;  4DV0 C;  5K85 A;  4PHT A;  3T1Y C;  5ADZ A;  4DG9 A;  2D1S A;  1RY2 A;  2KZF A;  1PG4 A;  3R9X A;  3N54 B;  1JOS A;  1MXB A;  3LAX A;  3OTO C;  3AF6 A;  3T1H C;  5DV9 A;  4K0B A;  4NXM C;  4JI7 C;  5AE2 A;  2D27 A;  1T5H X;  1HR0 C;  2Y27 A;  4LF5 C;  2WP0 C;  4DUZ C;  1N2F A;  3E7W A;  2ONF A;  4D57 A;  3J81 D;  4JI2 C;  5CZV A;  5IT9 D;  4IR7 A;  3TQI A;  4X64 C;  3A9U A;  4LF8 C;  4WV3 A;  1MKY A;  3G7S A;  5GTD A;  5BSU A;  2UXC C;  2E8C A;  4DR2 C;  4DCT A;  3RV2 A;  4JI0 C;  4LF6 C;  1XRC A;  4GXQ A;  4X66 C;  1L2F A;  1T5D X;  5T8S A;  3EQ6 A;  1QM4 A;  2D28 C;  2AYA A;  4RMN A;  4ZLP A;  3GR1 A;  2PN2 A;  4FTF A;  3VNS A;  4BCA A;  4GKJ C;  4OX9 C;  5CZX A;  2CXC A;  4LF7 C;  2E0G A;  4X65 C;  3CJE A;  4L4Q A;  5LMU C;  2UXD C;  4LFC C;  4DR4 C;  4NDN A;  1MXA A;  4LFA C;  2QW0 X;  2UU9 C;  3IEU A;  4JI5 C;  1LCI A;  4IZ6 A;  1BA3 A;  2YCB A;  5KEI A;  1KKG A;  4K0K C;  5IFI A;  3VNR A;  4OYC A;  1USP B;  3PRO C;  4NXN C;  1HH2 P;  1ZB8 A;  5AE1 A;  2PRO A;  1AMU A;  3I07 A;  2HHH C;  3KXW A;  3SO4 A;  4I9F A;  3GPC A;  4DCU A;  3R44 A;  3H2T A;  4DUY C;  4RM3 A;  2JMP A;  2BJO A;  3CW9 A;  2D1T A;  4B3R C;  3TDE A;  1XRA A;  2OO4 A;  1YJ7 A;  2P2F A;  4R1M A;  1IBK C;  4DR6 C;  1FUG A;  3ETO A;  4DV5 C;  2YWC A;  1MD9 A;  4G37 A;  1ML8 A;  2DYJ A;  4NOZ A;  4BBY A;  4LF9 C;  4BC7 A;  1N36 C;  4RLF A;  4DR7 C;  3GKU A;  3N2Q A;  1VLA A;  4I9G A;  4GKK C;  2UXB C;  1XMQ C;  2P20 A;  3A4I A;  3J7A D;  3E7X A;  3I08 A;  3L95 X;  3NI2 A;  3EER A;  3GR0 A;  4R0M A;  4YHH C;  4DR5 C;  5BUQ A;  4B3S C;  4TPS B;  1HNW C;  5A19 A;  1N32 C;  5BUS A;  1XMO C;  4JV5 C;  4KTV A;  4RLQ A;  4OXI A;  4FUQ A;  4D4G A;  4YY3 C;  2P2J A;  2WD9 A;  5A1G A;  3C5E A;  1IBM C;  5A2Q D;  4DR1 C;  4DV4 C;  4PZP A;  2CY1 A;  2E8E A;  4JI1 C;  1XNR C;  3IML A;  4G36 A;  3LNV A;  2QVY X;  4MTN A;  1J5E C;  2XR1 A;  4JI4 C;  2QVX X;  4GXR A;  4HPV A;  2F4V C;  4DV6 C;  3JAM D;  3S82 A;  1K0R A;  2QL8 A;  1MXC A;  5E7Q A;  1XRB A;  1O9T A;  1NYE A;  3DAY A;  3VNQ A;  3DHV A;  2DPL A;  2BH1 X;  4ODJ A;  4X62 C;  5BST A;  1MDF A;  2VQF C;  5A1I A;  4EAT A;  3A9V A;  2HJG A;  4WS9 A;  2D1R A;  2D7V A;  3UZ0 A;  2EGT A;  2QVZ X;  1PG3 A;  1QWI A;  3PBK A;  2ZM6 C;  5BSW A;  1ULT A;  1I94 C;  4DV7 C;  2E7G A;  3UOW A;  4DR3 C;  1FJG C;  4L7I A;  4DV2 C;  5K8F A;  1HNX C;  2P2M A;  1EGA A;  3IPL A;  4PRO C;  5BR8 C;  1O92 A;  4DV3 C;  2VZE A;  4RVO A;  4LE5 A;  5FLX D;  2ATW A;  2VSQ A;  2OPL B;  5AE3 A;  4R1L A;  3NYR A;  3NYQ A;  4ISB A;  4DG8 A;  3AF5 A;  1XNQ C;  4LFB C;  2YWB A;  2OBV A;  3FCC A;  1RG9 A;  1WF3 A;  3CW8 X;  4B3T C;  3PES A;  4B3M C;  2E8F A;  1MDB A;  5H9U A;  4DV1 C;  4JYA C;  4KHP C;  4U5Y D;  5BSR A;  5BSV A;  1P7L A;  4DCV A;  1USP A;  4BSZ A;  1N34 C;  4BC9 A;  4RM2 A;  4KTT A;  4LF4 C;  3TUF A;  5JRH A;  3DLP X;  2PT7 G;  1WH9 A;  5BUR A;  3B7W A;  1N33 C;  4MH4 A;  4XX2 A;  3ETC A;  4D56 A;  4L2Z A;  1GPM A;  4JM1 A;  5LMN C;  5KYT A;  4JI6 C;  4D4I A;  4RVN A;  2D1Q A;  3L8C A;  2ASB A;  1PA4 A;  2OPL A;  4JI3 C;  3RG2 A;  1ZB9 A;  4AQY C;  1HNZ C;  4JI8 C;  3LUS A;  2UUB C;  3LGX A;  4FUT A;  2P02 A;  1O93 A;  2Y4O A;  2E5L C;  2UUC C;  5BSM A;  2P2Q A;  2Y4N A;  2P2B A;  1V26 A;  2V7B A;  1IBL C;  5IWA C;  1LQL A;  3IEV A;  1O90 A;  1UKK A;  4DCS A;  3FCE A;  3NPD A;  2VQE C;  2UUA C;  5KYV A;  5T8T A;  4GS5 A;  1V25 A;  3R9W A;  4G1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...