4LF8C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 54
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf8C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf8C02
2PT7G 4AQYC 1N36C 2UU9C 4BSZA 3IEVA 4B3SC 2F4VC 1XMQC 4DCSA 2UXBC 4LFBC 4X62C 4DR6C 2E8CA 4DR4C 1N33C 4JI1C 1KKGA 1HR0C 2E8FA 2E8EA 5IWAC 1N2FA 2KZFA 1ML8A 4JI3C 1QWIA 3J80D 5LMNC 1N34C 3EERA 4DR5C 1WF3A 4KHPC 4JI4C 3R9WA 1N32C 4DV4C 1LQLA 4JV5C 4DCTA 4B3RC 3CJEA 4LF9C 4LF8C 4LF5C 2VQFC 4JI5C 1MKYA 2QL8A 1ZB9A 2CXCA 4DV0C 3J7AD 1FJGC 4OX9C 2ATWA 1ZB8A 2HJGA 4NXMC 3I07A 4X65C 3T1HC 4DV6C 4X66C 4LFCC 1USPA 2YCBA 3T1YC 2UUAC 1WH9A 4XX2A 1XNQC 2OPLB 2HHHC 1VLAA 4DR7C 1UKKA 4JI6C 2EGTA 5LMUC 4DCUA 2ZM6C 1PA4A 1J5EC 1IBKC 2CY1A 4LF6C 2UXDC 1HNWC 1JOSA 1HNXC 2ASBA 1XNRC 4JYAC 3OTOC 3JAMD 4DUYC 2ONFA 4DUZC 4B3MC 1HH2P 3IEUA 4NOZA 2DYJA 4JI2C 1L2FA 4JI8C 4DV2C 3R9XA 4YY3C 1EGAA 4DR1C 3AF6A 4K0KC 4LFAC 1HNZC 5A2QD 4DR2C 5IT9D 4B3TC 2E7GA 5FLXD 4DR3C 4NXNC 2BJOA 4LF4C 4GKKC 1USPB 3GKUA 2OPLA 4GKJC 5BR8C 4JI0C 4DV7C 2D7VA 4JI7C 1I94C 1IBLC 1IBMC 2UXCC 2UUBC 4X64C 1XMOC 2E5LC 2JMPA 2XR1A 3J81D 4DV3C 4DCVA 4MTNA 2UUCC 1NYEA 1K0RA 3AF5A 3LUSA 4YHHC 4LF7C 4MH4A 4DV1C 4DV5C 2VQEC 2PN2A
chains in the Genus database with same CATH superfamily
3TQIA 1MDFA 5BUSA 4BSZA 3VNSA 5BSVA 2UXBC 2D1SA 4DR6C 5IFIA 4BC9A 4JI1C 1KKGA 2CU6A 5E7QA 3UZ0A 5LMNC 3A9UA 4KHPC 4PUIA 3TUFA 3R9WA 1N32C 2P2JA 4DCTA 5BSWA 4LF5C 3A4IA 1XRBA 2VQFC 4JI5C 1O93A 1MKYA 1ZB9A 2MMAB 1PU1A 1MXCA 2ATWA 3CW8X 5T8TA 4X66C 2M5OA 4L4QA 1USPA 5BURA 2UUAC 5KEIA 1FUGA 2HHHC 1VLAA 4DR7C 2QVZX 4JI6C 1XHJA 2ZM6C 1PA4A 1IBKC 3UX3A 2UXDC 1YJ7A 2DHMA 4BC7A 1T5DX 1ULTA 3LNVA 2ASBA 4ZLPA 4JYAC 3OTOC 1QM4A 3JAMD 4OXIA 3IPLA 5AE2A 4RM3A 4NOZA 4JI2C 3VNRA 4DV2C 1VEHA 3ETCA 4GXQA 1MDBA 5AE1A 2ZZMA 4YY3C 4R1MA 3NPDA 4DR1C 4ODJA 5K85A 1HNZC 1GPMA 3DHVA 1M6XC 4RMNA 1MD9A 4DR3C 3NYQA 2MM9A 2BJOA 4I9FA 4NXNC 2NCLA 3S82A 4FUTA 4LE5A 2ZTBA 1I94C 1IBMC 2UXCC 2P2MA 3TDEA 5H9UA 3LAXA 4RLFA 4DCVA 2UUCC 3SO4A 3LUSA 1P4EA 4GXRA 4LF7C 2P2FA 4DV5C 1PG3A 2PN2A 2PT7G 4AQYC 2UU9C 3IEVA 5A19A 4B3SC 5AE3A 1XMQC 4DCSA 4X62C 1HR0C 2E8FA 2E8EA 5JRHA 2KZFA 5A1IA 1QWIA 3RG2A 3E7XA 3G7SA 1N34C 3EERA 4DR5C 4JI4C 3FM7A 4DV4C 3DLPX 3FCEA 2QL8A 2WD9A 4DV0C 1FJGC 4OX9C 1ZB8A 1M6XA 4X65C 3GPCA 3T1YC 3LNOA 4XX2A 1XNQC 4I9GA 1UKKA 3PESA 2Y27A 2EGTA 1J5EC 4PROC 4RVOA 2CY1A 4LF6C 1V25A 1XDXA 5BUQA 1HNXC 2Y4OA 4NDNA 2P2BA 4DUYC 5BSTA 3IEUA 2DYJA 2Z51A 4PUHA 3VNQA 3UEBA 3A9VA 3R9XA 3RV2A 3C5EA 3H2TA 2PROA 4LFAC 5A2QD 4DG8A 2P20A 2YWCA 4GKKC 4OYCA 4RVNA 5T8SA 5KYTA 4G36A 2WP0C 4JI7C 3L8CA 2YWBA 4GS5A 4X64C 2P02A 2E5LC 3CQ1A 1NYEA 2JNVA 1K0RA 3GR0A 4FTFA 5BSRA 3AF5A 3CW9A 4DR4C 2QVXX 3CQ3A 2KZ0A 1N36C 2E0GA 2F4VC 5KYVA 5CZVA 5ADZA 4R0MA 1O90A 4LFBC 4IZ6A 1NY8A 3L95X 3B7WA 1BA3A 4WS9A 2OO4A 1N2FA 1XS3A 1ML8A 4JI3C 2D1RA 3J80D 1WF3A 3LGXA 4IR7A 1LQLA 4B3RC 3CJEA 2D1QA 2KDNA 2D1TA 4PZPA 1TH5A 2HJGA 1RG9A 3T1HC 4WV3A 4DV6C 2ZZNA 1MXAA 1V60A 3PBKA 3A26A 2AYAA 2OPLB 5K8FA 1V26A 5LMUC 1WCJA 1JOSA 3CQ2A 5DV9A 4ISBA 1XNRC 3K6RA 5GTDA 4D4GA 2PG1E 1P4EC 4DUZC 1FLOA 1L2FA 4U5YD 4RM2A 2VSQA 2YX1A 1XRAA 3R44A 1P7LA 4ZJZA 2QW0X 1XRCA 4B3TC 5IT9D 2E7GA 1MXBA 3GKUA 3UX2A 2OPLA 4GKJC 4KTTA 5BR8C 2D27A 2M5HA 1RY2A 2BH1X 3O2EA 4RLQA 3IMLA 1LCIA 4KTVA 4R1LA 2UUBC 4L7IA 2P2QA 4TPSB 2JMPA 4DV3C 4MTNA 1UWDA 3TR3A 4HPVA 1IB8A 2VQEC 4G37A 3NI2A 4JM1A 2E8CA 3A25A 5LCIA 1N33C 5A1GA 3UOWA 3E7WA 5IWAC 1O92A 5CZXA 2D28C 1AMUA 2OBVA 4K0BA 2Y4NA 4JV5C 4LF9C 4LF8C 3I08A 3J7AD 2CXCA 4D4IA 4NXMC 3I07A 4PHTA 4G1IA 4PUGA 4LFCC 2YCBA 4BCAA 1WH9A 3KXWA 2V7BA 4DCUA 3DAYA 1HNWC 4EATA 3FCCA 1O9TA 2ONFA 3GR1A 4B3MC 1HH2P 4JI8C 3NYRA 1EGAA 4D56A 3AF6A 4K0KC 5BSMA 3N2QA 4DR2C 2VZEA 5FLXD 4BBYA 4LF4C 1PG4A 1USPB 2DPLA 1T5HX 3AY0A 4JI0C 4DV7C 5BSUA 2D7VA 4D57A 1IBLC 2QVYX 2MCQA 1XMOC 2XR1A 3J81D 3PROC 4FUQA 3ETOA 4L2ZA 3EQ6A 1YGTA 4YHHC 4MH4A 4DV1C 4DG9A 3N54B
chains in the Genus database with same CATH topology
3TQIA 1MDFA 5BUSA 4BSZA 3VNSA 5BSVA 2UXBC 2D1SA 4DR6C 5IFIA 4BC9A 4JI1C 1KKGA 5E7QA 3UZ0A 5LMNC 3A9UA 4KHPC 3TUFA 3R9WA 1N32C 2P2JA 4DCTA 5BSWA 4LF5C 3A4IA 1XRBA 2VQFC 4JI5C 1O93A 1MKYA 1ZB9A 1MXCA 2ATWA 3CW8X 5T8TA 4X66C 4L4QA 1USPA 5BURA 2UUAC 5KEIA 1FUGA 2HHHC 1VLAA 4DR7C 2QVZX 4JI6C 2ZM6C 1PA4A 1IBKC 2UXDC 1YJ7A 4BC7A 1T5DX 1ULTA 3LNVA 2ASBA 4ZLPA 4JYAC 1QM4A 3OTOC 3JAMD 4OXIA 3IPLA 5AE2A 4RM3A 4NOZA 4JI2C 3VNRA 4DV2C 4GXQA 3ETCA 1MDBA 5AE1A 4YY3C 4R1MA 3NPDA 4DR1C 4ODJA 5K85A 1HNZC 1GPMA 3DHVA 4RMNA 1MD9A 4DR3C 3NYQA 4I9FA 2BJOA 4NXNC 3S82A 4FUTA 4LE5A 1I94C 1IBMC 2UXCC 2P2MA 3TDEA 5H9UA 3LAXA 4RLFA 4DCVA 2UUCC 3SO4A 3LUSA 4GXRA 4LF7C 2P2FA 4DV5C 1PG3A 2PN2A 2PT7G 4AQYC 2UU9C 3IEVA 5A19A 4B3SC 5AE3A 1XMQC 4DCSA 4X62C 1HR0C 2E8FA 2E8EA 5JRHA 2KZFA 5A1IA 1QWIA 3RG2A 3E7XA 3G7SA 1N34C 3EERA 4DR5C 4JI4C 4DV4C 3DLPX 3FCEA 2QL8A 2WD9A 4DV0C 1FJGC 4OX9C 1ZB8A 4X65C 3GPCA 3T1YC 4XX2A 1XNQC 4I9GA 1UKKA 3PESA 2Y27A 2EGTA 1J5EC 4PROC 4RVOA 2CY1A 4LF6C 1V25A 5BUQA 1HNXC 2Y4OA 4NDNA 2P2BA 4DUYC 5BSTA 3IEUA 2DYJA 3VNQA 3A9VA 3R9XA 3RV2A 3C5EA 3H2TA 2PROA 4LFAC 5A2QD 4DG8A 2P20A 2YWCA 4GKKC 4OYCA 4RVNA 5T8SA 5KYTA 4G36A 2WP0C 4JI7C 3L8CA 2YWBA 4GS5A 4X64C 2P02A 2E5LC 1NYEA 1K0RA 3GR0A 4FTFA 5BSRA 3AF5A 3CW9A 4DR4C 2QVXX 1N36C 2E0GA 2F4VC 5KYVA 5CZVA 5ADZA 4R0MA 1O90A 4LFBC 4IZ6A 3L95X 3B7WA 1BA3A 4WS9A 2OO4A 1N2FA 1ML8A 4JI3C 2D1RA 3J80D 1WF3A 3LGXA 4IR7A 1LQLA 4B3RC 3CJEA 2D1QA 2D1TA 4PZPA 2HJGA 1RG9A 3T1HC 4WV3A 4DV6C 1MXAA 3PBKA 2AYAA 2OPLB 5K8FA 1V26A 5LMUC 1JOSA 5DV9A 4ISBA 1XNRC 5GTDA 4D4GA 4DUZC 1L2FA 4U5YD 4RM2A 2VSQA 1XRAA 3R44A 1P7LA 4ZJZA 2QW0X 1XRCA 4B3TC 5IT9D 2E7GA 1MXBA 3GKUA 2OPLA 4GKJC 4KTTA 5BR8C 2D27A 1RY2A 2BH1X 4RLQA 3IMLA 1LCIA 4KTVA 4R1LA 2UUBC 4L7IA 2P2QA 4TPSB 2JMPA 4DV3C 4MTNA 4HPVA 2VQEC 4G37A 3NI2A 4JM1A 2E8CA 1N33C 5A1GA 3UOWA 3E7WA 5IWAC 1O92A 5CZXA 2D28C 1AMUA 2OBVA 4K0BA 2Y4NA 4JV5C 4LF9C 4LF8C 3I08A 3J7AD 2CXCA 4D4IA 4NXMC 3I07A 4PHTA 4G1IA 4LFCC 2YCBA 4BCAA 1WH9A 3KXWA 2V7BA 4DCUA 3DAYA 1HNWC 4EATA 3FCCA 1O9TA 2ONFA 3GR1A 4B3MC 1HH2P 4JI8C 3NYRA 1EGAA 4D56A 3AF6A 4K0KC 5BSMA 3N2QA 4DR2C 2VZEA 5FLXD 4BBYA 4LF4C 1PG4A 1USPB 2DPLA 1T5HX 4JI0C 4DV7C 5BSUA 2D7VA 4D57A 1IBLC 2QVYX 1XMOC 2XR1A 3J81D 3PROC 4FUQA 3ETOA 4L2ZA 3EQ6A 4YHHC 4MH4A 4DV1C 4DG9A 3N54B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PT7 G;  4AQY C;  1N36 C;  2UU9 C;  4BSZ A;  3IEV A;  4B3S C;  2F4V C;  1XMQ C;  4DCS A;  2UXB C;  4LFB C;  4X62 C;  4DR6 C;  2E8C A;  4DR4 C;  1N33 C;  4JI1 C;  1KKG A;  1HR0 C;  2E8F A;  2E8E A;  5IWA C;  1N2F A;  2KZF A;  1ML8 A;  4JI3 C;  1QWI A;  3J80 D;  5LMN C;  1N34 C;  3EER A;  4DR5 C;  1WF3 A;  4KHP C;  4JI4 C;  3R9W A;  1N32 C;  4DV4 C;  1LQL A;  4JV5 C;  4DCT A;  4B3R C;  3CJE A;  4LF9 C;  4LF8 C;  4LF5 C;  2VQF C;  4JI5 C;  1MKY A;  2QL8 A;  1ZB9 A;  2CXC A;  4DV0 C;  3J7A D;  1FJG C;  4OX9 C;  2ATW A;  1ZB8 A;  2HJG A;  4NXM C;  3I07 A;  4X65 C;  3T1H C;  4DV6 C;  4X66 C;  4LFC C;  1USP A;  2YCB A;  3T1Y C;  2UUA C;  1WH9 A;  4XX2 A;  1XNQ C;  2OPL B;  2HHH C;  1VLA A;  4DR7 C;  1UKK A;  4JI6 C;  2EGT A;  5LMU C;  4DCU A;  2ZM6 C;  1PA4 A;  1J5E C;  1IBK C;  2CY1 A;  4LF6 C;  2UXD C;  1HNW C;  1JOS A;  1HNX C;  2ASB A;  1XNR C;  4JYA C;  3OTO C;  3JAM D;  4DUY C;  2ONF A;  4DUZ C;  4B3M C;  1HH2 P;  3IEU A;  4NOZ A;  2DYJ A;  4JI2 C;  1L2F A;  4JI8 C;  4DV2 C;  3R9X A;  4YY3 C;  1EGA A;  4DR1 C;  3AF6 A;  4K0K C;  4LFA C;  1HNZ C;  5A2Q D;  4DR2 C;  5IT9 D;  4B3T C;  2E7G A;  5FLX D;  4DR3 C;  4NXN C;  2BJO A;  4LF4 C;  4GKK C;  1USP B;  3GKU A;  2OPL A;  4GKJ C;  5BR8 C;  4JI0 C;  4DV7 C;  2D7V A;  4JI7 C;  1I94 C;  1IBL C;  1IBM C;  2UXC C;  2UUB C;  4X64 C;  1XMO C;  2E5L C;  2JMP A;  2XR1 A;  3J81 D;  4DV3 C;  4DCV A;  4MTN A;  2UUC C;  1NYE A;  1K0R A;  3AF5 A;  3LUS A;  4YHH C;  4LF7 C;  4MH4 A;  4DV1 C;  4DV5 C;  2VQE C;  2PN2 A; 
#chains in the Genus database with same CATH topology
 3TQI A;  1MDF A;  5BUS A;  4BSZ A;  3VNS A;  5BSV A;  2UXB C;  2D1S A;  4DR6 C;  5IFI A;  4BC9 A;  4JI1 C;  1KKG A;  2CU6 A;  5E7Q A;  3UZ0 A;  5LMN C;  3A9U A;  4KHP C;  4PUI A;  3TUF A;  3R9W A;  1N32 C;  2P2J A;  4DCT A;  5BSW A;  4LF5 C;  3A4I A;  1XRB A;  2VQF C;  4JI5 C;  1O93 A;  1MKY A;  1ZB9 A;  2MMA B;  1PU1 A;  1MXC A;  2ATW A;  3CW8 X;  5T8T A;  4X66 C;  2M5O A;  4L4Q A;  1USP A;  5BUR A;  2UUA C;  5KEI A;  1FUG A;  2HHH C;  1VLA A;  4DR7 C;  2QVZ X;  4JI6 C;  1XHJ A;  2ZM6 C;  1PA4 A;  1IBK C;  3UX3 A;  2UXD C;  1YJ7 A;  2DHM A;  4BC7 A;  1T5D X;  1ULT A;  3LNV A;  2ASB A;  4ZLP A;  4JYA C;  3OTO C;  1QM4 A;  3JAM D;  4OXI A;  3IPL A;  5AE2 A;  4RM3 A;  4NOZ A;  4JI2 C;  3VNR A;  4DV2 C;  1VEH A;  3ETC A;  4GXQ A;  1MDB A;  5AE1 A;  2ZZM A;  4YY3 C;  4R1M A;  3NPD A;  4DR1 C;  4ODJ A;  5K85 A;  1HNZ C;  1GPM A;  3DHV A;  1M6X C;  4RMN A;  1MD9 A;  4DR3 C;  3NYQ A;  2MM9 A;  2BJO A;  4I9F A;  4NXN C;  2NCL A;  3S82 A;  4FUT A;  4LE5 A;  2ZTB A;  1I94 C;  1IBM C;  2UXC C;  2P2M A;  3TDE A;  5H9U A;  3LAX A;  4RLF A;  4DCV A;  2UUC C;  3SO4 A;  3LUS A;  1P4E A;  4GXR A;  4LF7 C;  2P2F A;  4DV5 C;  1PG3 A;  2PN2 A;  2PT7 G;  4AQY C;  2UU9 C;  3IEV A;  5A19 A;  4B3S C;  5AE3 A;  1XMQ C;  4DCS A;  4X62 C;  1HR0 C;  2E8F A;  2E8E A;  5JRH A;  2KZF A;  5A1I A;  1QWI A;  3RG2 A;  3E7X A;  3G7S A;  1N34 C;  3EER A;  4DR5 C;  4JI4 C;  3FM7 A;  4DV4 C;  3DLP X;  3FCE A;  2QL8 A;  2WD9 A;  4DV0 C;  1FJG C;  4OX9 C;  1ZB8 A;  1M6X A;  4X65 C;  3GPC A;  3T1Y C;  3LNO A;  4XX2 A;  1XNQ C;  4I9G A;  1UKK A;  3PES A;  2Y27 A;  2EGT A;  1J5E C;  4PRO C;  4RVO A;  2CY1 A;  4LF6 C;  1V25 A;  1XDX A;  5BUQ A;  1HNX C;  2Y4O A;  4NDN A;  2P2B A;  4DUY C;  5BST A;  3IEU A;  2DYJ A;  2Z51 A;  4PUH A;  3VNQ A;  3UEB A;  3A9V A;  3R9X A;  3RV2 A;  3C5E A;  3H2T A;  2PRO A;  4LFA C;  5A2Q D;  4DG8 A;  2P20 A;  2YWC A;  4GKK C;  4OYC A;  4RVN A;  5T8S A;  5KYT A;  4G36 A;  2WP0 C;  4JI7 C;  3L8C A;  2YWB A;  4GS5 A;  4X64 C;  2P02 A;  2E5L C;  3CQ1 A;  1NYE A;  2JNV A;  1K0R A;  3GR0 A;  4FTF A;  5BSR A;  3AF5 A;  3CW9 A;  4DR4 C;  2QVX X;  3CQ3 A;  2KZ0 A;  1N36 C;  2E0G A;  2F4V C;  5KYV A;  5CZV A;  5ADZ A;  4R0M A;  1O90 A;  4LFB C;  4IZ6 A;  1NY8 A;  3L95 X;  3B7W A;  1BA3 A;  4WS9 A;  2OO4 A;  1N2F A;  1XS3 A;  1ML8 A;  4JI3 C;  2D1R A;  3J80 D;  1WF3 A;  3LGX A;  4IR7 A;  1LQL A;  4B3R C;  3CJE A;  2D1Q A;  2KDN A;  2D1T A;  4PZP A;  1TH5 A;  2HJG A;  1RG9 A;  3T1H C;  4WV3 A;  4DV6 C;  2ZZN A;  1MXA A;  1V60 A;  3PBK A;  3A26 A;  2AYA A;  2OPL B;  5K8F A;  1V26 A;  5LMU C;  1WCJ A;  1JOS A;  3CQ2 A;  5DV9 A;  4ISB A;  1XNR C;  3K6R A;  5GTD A;  4D4G A;  2PG1 E;  1P4E C;  4DUZ C;  1FLO A;  1L2F A;  4U5Y D;  4RM2 A;  2VSQ A;  2YX1 A;  1XRA A;  3R44 A;  1P7L A;  4ZJZ A;  2QW0 X;  1XRC A;  4B3T C;  5IT9 D;  2E7G A;  1MXB A;  3GKU A;  3UX2 A;  2OPL A;  4GKJ C;  4KTT A;  5BR8 C;  2D27 A;  2M5H A;  1RY2 A;  2BH1 X;  3O2E A;  4RLQ A;  3IML A;  1LCI A;  4KTV A;  4R1L A;  2UUB C;  4L7I A;  2P2Q A;  4TPS B;  2JMP A;  4DV3 C;  4MTN A;  1UWD A;  3TR3 A;  4HPV A;  1IB8 A;  2VQE C;  4G37 A;  3NI2 A;  4JM1 A;  2E8C A;  3A25 A;  5LCI A;  1N33 C;  5A1G A;  3UOW A;  3E7W A;  5IWA C;  1O92 A;  5CZX A;  2D28 C;  1AMU A;  2OBV A;  4K0B A;  2Y4N A;  4JV5 C;  4LF9 C;  4LF8 C;  3I08 A;  3J7A D;  2CXC A;  4D4I A;  4NXM C;  3I07 A;  4PHT A;  4G1I A;  4PUG A;  4LFC C;  2YCB A;  4BCA A;  1WH9 A;  3KXW A;  2V7B A;  4DCU A;  3DAY A;  1HNW C;  4EAT A;  3FCC A;  1O9T A;  2ONF A;  3GR1 A;  4B3M C;  1HH2 P;  4JI8 C;  3NYR A;  1EGA A;  4D56 A;  3AF6 A;  4K0K C;  5BSM A;  3N2Q A;  4DR2 C;  2VZE A;  5FLX D;  4BBY A;  4LF4 C;  1PG4 A;  1USP B;  2DPL A;  1T5H X;  3AY0 A;  4JI0 C;  4DV7 C;  5BSU A;  2D7V A;  4D57 A;  1IBL C;  2QVY X;  2MCQ A;  1XMO C;  2XR1 A;  3J81 D;  3PRO C;  4FUQ A;  3ETO A;  4L2Z A;  3EQ6 A;  1YGT A;  4YHH C;  4MH4 A;  4DV1 C;  4DG9 A;  3N54 B; 
#chains in the Genus database with same CATH homology
 3TQI A;  1MDF A;  5BUS A;  4BSZ A;  3VNS A;  5BSV A;  2UXB C;  2D1S A;  4DR6 C;  5IFI A;  4BC9 A;  4JI1 C;  1KKG A;  5E7Q A;  3UZ0 A;  5LMN C;  3A9U A;  4KHP C;  3TUF A;  3R9W A;  1N32 C;  2P2J A;  4DCT A;  5BSW A;  4LF5 C;  3A4I A;  1XRB A;  2VQF C;  4JI5 C;  1O93 A;  1MKY A;  1ZB9 A;  1MXC A;  2ATW A;  3CW8 X;  5T8T A;  4X66 C;  4L4Q A;  1USP A;  5BUR A;  2UUA C;  5KEI A;  1FUG A;  2HHH C;  1VLA A;  4DR7 C;  2QVZ X;  4JI6 C;  2ZM6 C;  1PA4 A;  1IBK C;  2UXD C;  1YJ7 A;  4BC7 A;  1T5D X;  1ULT A;  3LNV A;  2ASB A;  4ZLP A;  4JYA C;  1QM4 A;  3OTO C;  3JAM D;  4OXI A;  3IPL A;  5AE2 A;  4RM3 A;  4NOZ A;  4JI2 C;  3VNR A;  4DV2 C;  4GXQ A;  3ETC A;  1MDB A;  5AE1 A;  4YY3 C;  4R1M A;  3NPD A;  4DR1 C;  4ODJ A;  5K85 A;  1HNZ C;  1GPM A;  3DHV A;  4RMN A;  1MD9 A;  4DR3 C;  3NYQ A;  4I9F A;  2BJO A;  4NXN C;  3S82 A;  4FUT A;  4LE5 A;  1I94 C;  1IBM C;  2UXC C;  2P2M A;  3TDE A;  5H9U A;  3LAX A;  4RLF A;  4DCV A;  2UUC C;  3SO4 A;  3LUS A;  4GXR A;  4LF7 C;  2P2F A;  4DV5 C;  1PG3 A;  2PN2 A;  2PT7 G;  4AQY C;  2UU9 C;  3IEV A;  5A19 A;  4B3S C;  5AE3 A;  1XMQ C;  4DCS A;  4X62 C;  1HR0 C;  2E8F A;  2E8E A;  5JRH A;  2KZF A;  5A1I A;  1QWI A;  3RG2 A;  3E7X A;  3G7S A;  1N34 C;  3EER A;  4DR5 C;  4JI4 C;  4DV4 C;  3DLP X;  3FCE A;  2QL8 A;  2WD9 A;  4DV0 C;  1FJG C;  4OX9 C;  1ZB8 A;  4X65 C;  3GPC A;  3T1Y C;  4XX2 A;  1XNQ C;  4I9G A;  1UKK A;  3PES A;  2Y27 A;  2EGT A;  1J5E C;  4PRO C;  4RVO A;  2CY1 A;  4LF6 C;  1V25 A;  5BUQ A;  1HNX C;  2Y4O A;  4NDN A;  2P2B A;  4DUY C;  5BST A;  3IEU A;  2DYJ A;  3VNQ A;  3A9V A;  3R9X A;  3RV2 A;  3C5E A;  3H2T A;  2PRO A;  4LFA C;  5A2Q D;  4DG8 A;  2P20 A;  2YWC A;  4GKK C;  4OYC A;  4RVN A;  5T8S A;  5KYT A;  4G36 A;  2WP0 C;  4JI7 C;  3L8C A;  2YWB A;  4GS5 A;  4X64 C;  2P02 A;  2E5L C;  1NYE A;  1K0R A;  3GR0 A;  4FTF A;  5BSR A;  3AF5 A;  3CW9 A;  4DR4 C;  2QVX X;  1N36 C;  2E0G A;  2F4V C;  5KYV A;  5CZV A;  5ADZ A;  4R0M A;  1O90 A;  4LFB C;  4IZ6 A;  3L95 X;  3B7W A;  1BA3 A;  4WS9 A;  2OO4 A;  1N2F A;  1ML8 A;  4JI3 C;  2D1R A;  3J80 D;  1WF3 A;  3LGX A;  4IR7 A;  1LQL A;  4B3R C;  3CJE A;  2D1Q A;  2D1T A;  4PZP A;  2HJG A;  1RG9 A;  3T1H C;  4WV3 A;  4DV6 C;  1MXA A;  3PBK A;  2AYA A;  2OPL B;  5K8F A;  1V26 A;  5LMU C;  1JOS A;  5DV9 A;  4ISB A;  1XNR C;  5GTD A;  4D4G A;  4DUZ C;  1L2F A;  4U5Y D;  4RM2 A;  2VSQ A;  1XRA A;  3R44 A;  1P7L A;  4ZJZ A;  2QW0 X;  1XRC A;  4B3T C;  5IT9 D;  2E7G A;  1MXB A;  3GKU A;  2OPL A;  4GKJ C;  4KTT A;  5BR8 C;  2D27 A;  1RY2 A;  2BH1 X;  4RLQ A;  3IML A;  1LCI A;  4KTV A;  4R1L A;  2UUB C;  4L7I A;  2P2Q A;  4TPS B;  2JMP A;  4DV3 C;  4MTN A;  4HPV A;  2VQE C;  4G37 A;  3NI2 A;  4JM1 A;  2E8C A;  1N33 C;  5A1G A;  3UOW A;  3E7W A;  5IWA C;  1O92 A;  5CZX A;  2D28 C;  1AMU A;  2OBV A;  4K0B A;  2Y4N A;  4JV5 C;  4LF9 C;  4LF8 C;  3I08 A;  3J7A D;  2CXC A;  4D4I A;  4NXM C;  3I07 A;  4PHT A;  4G1I A;  4LFC C;  2YCB A;  4BCA A;  1WH9 A;  3KXW A;  2V7B A;  4DCU A;  3DAY A;  1HNW C;  4EAT A;  3FCC A;  1O9T A;  2ONF A;  3GR1 A;  4B3M C;  1HH2 P;  4JI8 C;  3NYR A;  1EGA A;  4D56 A;  3AF6 A;  4K0K C;  5BSM A;  3N2Q A;  4DR2 C;  2VZE A;  5FLX D;  4BBY A;  4LF4 C;  1PG4 A;  1USP B;  2DPL A;  1T5H X;  4JI0 C;  4DV7 C;  5BSU A;  2D7V A;  4D57 A;  1IBL C;  2QVY X;  1XMO C;  2XR1 A;  3J81 D;  3PRO C;  4FUQ A;  3ETO A;  4L2Z A;  3EQ6 A;  4YHH C;  4MH4 A;  4DV1 C;  4DG9 A;  3N54 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...