4LF8C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 54
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf8C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf8C02
2UXBC 1N36C 4X66C 4NOZA 3J7AD 2CXCA 1USPA 1LQLA 2QL8A 2UXDC 4MH4A 1KKGA 4JI3C 1HNZC 4B3TC 4KHPC 3I07A 1USPB 1WH9A 4B3SC 1IBMC 1QWIA 4DCTA 2KZFA 2JMPA 5LMUC 3LUSA 3J81D 4X64C 1MKYA 1N34C 1VLAA 4DV2C 1ZB9A 2ATWA 4YY3C 1XNRC 2VQEC 1L2FA 4XX2A 1UKKA 1HNXC 2UU9C 4DR6C 1WF3A 4DV0C 1HNWC 1EGAA 4X62C 2HHHC 1JOSA 4DUYC 4DV1C 5IT9D 1ZB8A 3CJEA 4LF9C 4JI7C 4DR7C 3R9WA 2D7VA 4MTNA 1J5EC 1IBKC 4DV7C 4JI8C 1PA4A 4DR3C 5IWAC 2YCBA 5FLXD 4LFAC 4GKJC 1FJGC 1IBLC 2UXCC 2UUAC 5BR8C 2CY1A 3AF6A 3T1HC 2F4VC 2E8CA 4OX9C 4YHHC 2UUBC 4DR2C 4JI1C 2E8EA 2EGTA 4JI0C 1I94C 3GKUA 4JYAC 1K0RA 4GKKC 4JV5C 3IEVA 4LFBC 2E8FA 1N2FA 3OTOC 2ASBA 2HJGA 4LF5C 2PT7G 1XMOC 1ML8A 2VQFC 4DV3C 4K0KC 4B3RC 4X65C 4DCUA 4BSZA 2ZM6C 2BJOA 4AQYC 4DR4C 4NXMC 1NYEA 4B3MC 4DV6C 2XR1A 2E5LC 2OPLA 1HH2P 1HR0C 3J80D 4DUZC 4LF8C 4JI6C 4LF4C 4LF6C 2OPLB 2PN2A 1N33C 3JAMD 4JI2C 2DYJA 4JI4C 1XNQC 2E7GA 3EERA 4DR5C 4NXNC 4DV5C 1XMQC 2ONFA 3AF5A 4DV4C 3R9XA 4JI5C 3IEUA 4DCSA 4DR1C 4LFCC 5LMNC 4DCVA 5A2QD 3T1YC 4LF7C 2UUCC 1N32C
chains in the Genus database with same CATH superfamily
2Z51A 4TPSB 1USPA 2YWBA 1LQLA 3ETOA 4JI3C 1MXCA 4RLQA 3RG2A 4B3SC 1UWDA 2AYAA 5BUSA 1MXAA 4DCTA 3LGXA 1MKYA 3RV2A 4X64C 2ATWA 1ZB9A 5KYVA 4OYCA 5T8TA 1FLOA 1UKKA 2D27A 1HNWC 1EGAA 3B7WA 4X62C 4DUYC 3CQ1A 1MDBA 3L95X 2QVZX 4MTNA 2M5HA 2P2FA 1J5EC 4JI8C 4RMNA 4BC7A 3UZ0A 5AE3A 2P02A 1IB8A 4RLFA 3T1HC 2F4VC 1O92A 4FUQA 1VEHA 4YHHC 4JI1C 4I9FA 2Y4NA 2E8EA 2EGTA 4D56A 4JV5C 5ADZA 4LFBC 3SO4A 5CZXA 2E8FA 3PROC 1V60A 3EQ6A 2HJGA 4HPVA 4LF5C 2PT7G 5DV9A 1ML8A 2VQFC 4DV3C 3A9VA 4FUTA 4KTTA 3UX3A 4R0MA 2BJOA 3TDEA 4AQYC 4NXMC 3A26A 2E5LC 3NYRA 4RM2A 1P4EA 1HR0C 1MXBA 2MCQA 4DUZC 1PU1A 2OPLB 3KXWA 4JI4C 3UOWA 5A1IA 4GXQA 4PHTA 5IFIA 4WS9A 2KDNA 1XMQC 1T5HX 5AE1A 2ONFA 1O93A 3A4IA 3G7SA 3IEUA 5BSWA 5LMNC 2D1TA 2OO4A 4DCVA 5A2QD 3T1YC 1XRCA 4NDNA 5K85A 1RY2A 5BURA 4X66C 1MD9A 1PG4A 2QL8A 1M6XC 2UXDC 5BSRA 4B3TC 2P20A 2KZ0A 2KZFA 3CW9A 5LMUC 3J81D 3LNVA 3FM7A 4DV2C 3GR0A 3O2EA 4YY3C 1XNRC 2PG1E 1HNXC 5H9UA 4DR6C 4DV0C 4LF9C 2WD9A 4JI7C 3N2QA 2D28C 2D7VA 1IBKC 2P2BA 2Y4OA 1PA4A 4ZLPA 4DR3C 4LFAC 1XRBA 4GKJC 1FJGC 2UUAC 3H2TA 5BR8C 2CY1A 5K8FA 2UUBC 2DPLA 4D4GA 2V7BA 2WP0C 3C5EA 4BC9A 1N2FA 1QM4A 3OTOC 1XRAA 4L7IA 4K0BA 4PZPA 1V25A 2MMAB 3VNSA 4K0KC 5T8SA 4B3RC 3PBKA 4X65C 4DCUA 2P2QA 2XR1A 4BCAA 1XHJA 3AY0A 3J80D 4G36A 2DHMA 3DHVA 3JAMD 4JI2C 3NI2A 2DYJA 1P7LA 5KEIA 2E7GA 3EERA 4DV5C 3TQIA 3AF5A 2VSQA 1MDFA 4DR1C 5BSMA 4LF7C 4R1LA 1TH5A 2UUCC 2OBVA 4U5YD 3IMLA 1N36C 1XDXA 1NY8A 3ETCA 4NOZA 4IZ6A 2MM9A 1KKGA 4JM1A 1HNZC 3I07A 1USPB 1WH9A 5JRHA 1IBMC 4RM3A 2D1SA 1N34C 2ZTBA 5GTDA 4XX2A 5A19A 1YGTA 2PROA 5BUQA 1WCJA 1WF3A 3A9UA 1JOSA 2ZZNA 4DV1C 1ZB8A 3CJEA 2NCLA 1FUGA 4DV7C 5AE2A 5IWAC 2YCBA 1IBLC 4PUHA 3R44A 2E8CA 3IPLA 4I9GA 4OX9C 5BSUA 4DR2C 2D1QA 4JI0C 3DAYA 3GKUA 4JYAC 1K0RA 3UEBA 2P2JA 4EATA 3A25A 2CU6A 1BA3A 3CW8X 3L8CA 5CZVA 4G1IA 2BH1X 4DR4C 1NYEA 4B3MC 2YX1A 4DV6C 1AMUA 3I08A 2OPLA 3NYQA 1HH2P 1XS3A 4DG8A 1P4EC 4JI6C 1O90A 2PN2A 1PG3A 1N33C 1V26A 4PUIA 4DR5C 4NXNC 4G37A 4DCSA 4L4QA 4R1MA 2QVXX 3S82A 2UXBC 3E7WA 1M6XA 3J7AD 2CXCA 5LCIA 4GXRA 3LAXA 4D57A 4MH4A 4WV3A 4KHPC 5BSVA 3K6RA 4KTVA 1QWIA 3FCCA 3UX2A 2JMPA 3LUSA 3GPCA 1VLAA 2ZZMA 2P2MA 2QW0X 2VQEC 1L2FA 2UU9C 1RG9A 2JNVA 2E0GA 3NPDA 2HHHC 5IT9D 3TUFA 3FCEA 4D4IA 4PUGA 4DR7C 3R9WA 4LE5A 4ODJA 4ISBA 3CQ3A 3VNRA 4L2ZA 3DLPX 3LNOA 5FLXD 2Y27A 2YWCA 2UXCC 3PESA 3AF6A 3E7XA 1T5DX 3CQ2A 4OXIA 1I94C 1LCIA 4GKKC 3IEVA 5E7QA 4DG9A 4IR7A 2ASBA 4ZJZA 3GR1A 1O9TA 1XMOC 3TR3A 3N54B 4BSZA 2ZM6C 1GPMA 4GS5A 5BSTA 4RVNA 5A1GA 3VNQA 4FTFA 1YJ7A 4LF8C 4LF4C 4LF6C 4RVOA 4BBYA 5KYTA 1XNQC 2M5OA 2D1RA 4DV4C 3R9XA 4JI5C 4LFCC 1ULTA 2VZEA 4PROC 2QVYX 1N32C
chains in the Genus database with same CATH topology
4TPSB 1USPA 2YWBA 1LQLA 3ETOA 4JI3C 1MXCA 4RLQA 3RG2A 4B3SC 2AYAA 1MXAA 4DCTA 5BUSA 3LGXA 1MKYA 3RV2A 4X64C 2ATWA 1ZB9A 5KYVA 4OYCA 5T8TA 1UKKA 2D27A 1HNWC 1EGAA 3B7WA 4X62C 4DUYC 1MDBA 3L95X 2QVZX 4MTNA 1J5EC 2P2FA 4JI8C 4RMNA 4BC7A 3UZ0A 5AE3A 2P02A 4RLFA 3T1HC 2F4VC 1O92A 4FUQA 4YHHC 4JI1C 4I9FA 2Y4NA 2E8EA 2EGTA 4D56A 4JV5C 5ADZA 4LFBC 3SO4A 5CZXA 2E8FA 3PROC 3EQ6A 2HJGA 4HPVA 4LF5C 2PT7G 5DV9A 1ML8A 2VQFC 4DV3C 3A9VA 4FUTA 4KTTA 4R0MA 2BJOA 3TDEA 4AQYC 4NXMC 2E5LC 3NYRA 4RM2A 1HR0C 1MXBA 4DUZC 2OPLB 3KXWA 4JI4C 3UOWA 5A1IA 4GXQA 4PHTA 5IFIA 4WS9A 1XMQC 1T5HX 5AE1A 2ONFA 1O93A 3A4IA 3G7SA 3IEUA 5BSWA 5LMNC 2D1TA 2OO4A 4DCVA 5A2QD 3T1YC 1XRCA 4NDNA 5K85A 1RY2A 5BURA 4X66C 1MD9A 1PG4A 2QL8A 2UXDC 5BSRA 4B3TC 2P20A 2KZFA 3CW9A 5LMUC 3J81D 3LNVA 4DV2C 3GR0A 4YY3C 1XNRC 1HNXC 5H9UA 4DR6C 4DV0C 4LF9C 2WD9A 4JI7C 3N2QA 2D28C 2D7VA 1IBKC 2P2BA 2Y4OA 1PA4A 4ZLPA 4DR3C 4LFAC 1XRBA 4GKJC 1FJGC 2UUAC 3H2TA 5BR8C 2CY1A 5K8FA 2UUBC 2DPLA 4D4GA 2V7BA 2WP0C 3C5EA 4BC9A 1N2FA 1QM4A 3OTOC 1XRAA 4L7IA 4K0BA 4PZPA 1V25A 3VNSA 4K0KC 5T8SA 4B3RC 3PBKA 4X65C 4DCUA 2P2QA 2XR1A 4BCAA 3J80D 4G36A 3DHVA 3JAMD 4JI2C 3NI2A 2DYJA 1P7LA 5KEIA 2E7GA 3EERA 4DV5C 3TQIA 3AF5A 2VSQA 1MDFA 4DR1C 5BSMA 4LF7C 4R1LA 2UUCC 2OBVA 4U5YD 3IMLA 1N36C 3ETCA 4NOZA 4IZ6A 1KKGA 4JM1A 1HNZC 3I07A 1USPB 1WH9A 5JRHA 1IBMC 4RM3A 2D1SA 1N34C 5GTDA 4XX2A 5A19A 2PROA 5BUQA 1WF3A 3A9UA 1JOSA 4DV1C 1ZB8A 3CJEA 1FUGA 4DV7C 5AE2A 5IWAC 2YCBA 1IBLC 3R44A 2E8CA 3IPLA 4I9GA 4OX9C 5BSUA 4DR2C 2D1QA 4JI0C 3DAYA 3GKUA 4JYAC 1K0RA 2P2JA 4EATA 1BA3A 3CW8X 3L8CA 5CZVA 4G1IA 2BH1X 4DR4C 1NYEA 4B3MC 4DV6C 1AMUA 3I08A 2OPLA 3NYQA 1HH2P 4DG8A 4JI6C 1O90A 2PN2A 1PG3A 1N33C 1V26A 4DR5C 4NXNC 4G37A 4DCSA 4L4QA 4R1MA 2QVXX 3S82A 2UXBC 3E7WA 3J7AD 2CXCA 4GXRA 3LAXA 4D57A 4MH4A 4WV3A 4KHPC 5BSVA 4KTVA 1QWIA 3FCCA 2JMPA 3LUSA 3GPCA 1VLAA 2P2MA 2QW0X 2VQEC 1L2FA 2UU9C 1RG9A 2E0GA 3NPDA 2HHHC 5IT9D 3TUFA 3FCEA 4D4IA 4DR7C 3R9WA 4LE5A 4ODJA 4ISBA 3VNRA 4L2ZA 3DLPX 5FLXD 2Y27A 2YWCA 2UXCC 3PESA 3AF6A 3E7XA 1T5DX 4OXIA 1I94C 1LCIA 4GKKC 3IEVA 5E7QA 4DG9A 4IR7A 2ASBA 4ZJZA 3GR1A 1O9TA 1XMOC 3N54B 4BSZA 2ZM6C 1GPMA 4GS5A 5BSTA 4RVNA 5A1GA 3VNQA 4FTFA 1YJ7A 4LF8C 4LF4C 4LF6C 4RVOA 4BBYA 5KYTA 1XNQC 2D1RA 4DV4C 3R9XA 4JI5C 4LFCC 1ULTA 2VZEA 4PROC 2QVYX 1N32C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB C;  1N36 C;  4X66 C;  4NOZ A;  3J7A D;  2CXC A;  1USP A;  1LQL A;  2QL8 A;  2UXD C;  4MH4 A;  1KKG A;  4JI3 C;  1HNZ C;  4B3T C;  4KHP C;  3I07 A;  1USP B;  1WH9 A;  4B3S C;  1IBM C;  1QWI A;  4DCT A;  2KZF A;  2JMP A;  5LMU C;  3LUS A;  3J81 D;  4X64 C;  1MKY A;  1N34 C;  1VLA A;  4DV2 C;  1ZB9 A;  2ATW A;  4YY3 C;  1XNR C;  2VQE C;  1L2F A;  4XX2 A;  1UKK A;  1HNX C;  2UU9 C;  4DR6 C;  1WF3 A;  4DV0 C;  1HNW C;  1EGA A;  4X62 C;  2HHH C;  1JOS A;  4DUY C;  4DV1 C;  5IT9 D;  1ZB8 A;  3CJE A;  4LF9 C;  4JI7 C;  4DR7 C;  3R9W A;  2D7V A;  4MTN A;  1J5E C;  1IBK C;  4DV7 C;  4JI8 C;  1PA4 A;  4DR3 C;  5IWA C;  2YCB A;  5FLX D;  4LFA C;  4GKJ C;  1FJG C;  1IBL C;  2UXC C;  2UUA C;  5BR8 C;  2CY1 A;  3AF6 A;  3T1H C;  2F4V C;  2E8C A;  4OX9 C;  4YHH C;  2UUB C;  4DR2 C;  4JI1 C;  2E8E A;  2EGT A;  4JI0 C;  1I94 C;  3GKU A;  4JYA C;  1K0R A;  4GKK C;  4JV5 C;  3IEV A;  4LFB C;  2E8F A;  1N2F A;  3OTO C;  2ASB A;  2HJG A;  4LF5 C;  2PT7 G;  1XMO C;  1ML8 A;  2VQF C;  4DV3 C;  4K0K C;  4B3R C;  4X65 C;  4DCU A;  4BSZ A;  2ZM6 C;  2BJO A;  4AQY C;  4DR4 C;  4NXM C;  1NYE A;  4B3M C;  4DV6 C;  2XR1 A;  2E5L C;  2OPL A;  1HH2 P;  1HR0 C;  3J80 D;  4DUZ C;  4LF8 C;  4JI6 C;  4LF4 C;  4LF6 C;  2OPL B;  2PN2 A;  1N33 C;  3JAM D;  4JI2 C;  2DYJ A;  4JI4 C;  1XNQ C;  2E7G A;  3EER A;  4DR5 C;  4NXN C;  4DV5 C;  1XMQ C;  2ONF A;  3AF5 A;  4DV4 C;  3R9X A;  4JI5 C;  3IEU A;  4DCS A;  4DR1 C;  4LFC C;  5LMN C;  4DCV A;  5A2Q D;  3T1Y C;  4LF7 C;  2UUC C;  1N32 C; 
#chains in the Genus database with same CATH topology
 2Z51 A;  4TPS B;  1USP A;  2YWB A;  1LQL A;  3ETO A;  4JI3 C;  1MXC A;  4RLQ A;  3RG2 A;  4B3S C;  1UWD A;  2AYA A;  5BUS A;  1MXA A;  4DCT A;  3LGX A;  1MKY A;  3RV2 A;  4X64 C;  2ATW A;  1ZB9 A;  5KYV A;  4OYC A;  5T8T A;  1FLO A;  1UKK A;  2D27 A;  1HNW C;  1EGA A;  3B7W A;  4X62 C;  4DUY C;  3CQ1 A;  1MDB A;  3L95 X;  2QVZ X;  4MTN A;  2M5H A;  2P2F A;  1J5E C;  4JI8 C;  4RMN A;  4BC7 A;  3UZ0 A;  5AE3 A;  2P02 A;  1IB8 A;  4RLF A;  3T1H C;  2F4V C;  1O92 A;  4FUQ A;  1VEH A;  4YHH C;  4JI1 C;  4I9F A;  2Y4N A;  2E8E A;  2EGT A;  4D56 A;  4JV5 C;  5ADZ A;  4LFB C;  3SO4 A;  5CZX A;  2E8F A;  3PRO C;  1V60 A;  3EQ6 A;  2HJG A;  4HPV A;  4LF5 C;  2PT7 G;  5DV9 A;  1ML8 A;  2VQF C;  4DV3 C;  3A9V A;  4FUT A;  4KTT A;  3UX3 A;  4R0M A;  2BJO A;  3TDE A;  4AQY C;  4NXM C;  3A26 A;  2E5L C;  3NYR A;  4RM2 A;  1P4E A;  1HR0 C;  1MXB A;  2MCQ A;  4DUZ C;  1PU1 A;  2OPL B;  3KXW A;  4JI4 C;  3UOW A;  5A1I A;  4GXQ A;  4PHT A;  5IFI A;  4WS9 A;  2KDN A;  1XMQ C;  1T5H X;  5AE1 A;  2ONF A;  1O93 A;  3A4I A;  3G7S A;  3IEU A;  5BSW A;  5LMN C;  2D1T A;  2OO4 A;  4DCV A;  5A2Q D;  3T1Y C;  1XRC A;  4NDN A;  5K85 A;  1RY2 A;  5BUR A;  4X66 C;  1MD9 A;  1PG4 A;  2QL8 A;  1M6X C;  2UXD C;  5BSR A;  4B3T C;  2P20 A;  2KZ0 A;  2KZF A;  3CW9 A;  5LMU C;  3J81 D;  3LNV A;  3FM7 A;  4DV2 C;  3GR0 A;  3O2E A;  4YY3 C;  1XNR C;  2PG1 E;  1HNX C;  5H9U A;  4DR6 C;  4DV0 C;  4LF9 C;  2WD9 A;  4JI7 C;  3N2Q A;  2D28 C;  2D7V A;  1IBK C;  2P2B A;  2Y4O A;  1PA4 A;  4ZLP A;  4DR3 C;  4LFA C;  1XRB A;  4GKJ C;  1FJG C;  2UUA C;  3H2T A;  5BR8 C;  2CY1 A;  5K8F A;  2UUB C;  2DPL A;  4D4G A;  2V7B A;  2WP0 C;  3C5E A;  4BC9 A;  1N2F A;  1QM4 A;  3OTO C;  1XRA A;  4L7I A;  4K0B A;  4PZP A;  1V25 A;  2MMA B;  3VNS A;  4K0K C;  5T8S A;  4B3R C;  3PBK A;  4X65 C;  4DCU A;  2P2Q A;  2XR1 A;  4BCA A;  1XHJ A;  3AY0 A;  3J80 D;  4G36 A;  2DHM A;  3DHV A;  3JAM D;  4JI2 C;  3NI2 A;  2DYJ A;  1P7L A;  5KEI A;  2E7G A;  3EER A;  4DV5 C;  3TQI A;  3AF5 A;  2VSQ A;  1MDF A;  4DR1 C;  5BSM A;  4LF7 C;  4R1L A;  1TH5 A;  2UUC C;  2OBV A;  4U5Y D;  3IML A;  1N36 C;  1XDX A;  1NY8 A;  3ETC A;  4NOZ A;  4IZ6 A;  2MM9 A;  1KKG A;  4JM1 A;  1HNZ C;  3I07 A;  1USP B;  1WH9 A;  5JRH A;  1IBM C;  4RM3 A;  2D1S A;  1N34 C;  2ZTB A;  5GTD A;  4XX2 A;  5A19 A;  1YGT A;  2PRO A;  5BUQ A;  1WCJ A;  1WF3 A;  3A9U A;  1JOS A;  2ZZN A;  4DV1 C;  1ZB8 A;  3CJE A;  2NCL A;  1FUG A;  4DV7 C;  5AE2 A;  5IWA C;  2YCB A;  1IBL C;  4PUH A;  3R44 A;  2E8C A;  3IPL A;  4I9G A;  4OX9 C;  5BSU A;  4DR2 C;  2D1Q A;  4JI0 C;  3DAY A;  3GKU A;  4JYA C;  1K0R A;  3UEB A;  2P2J A;  4EAT A;  3A25 A;  2CU6 A;  1BA3 A;  3CW8 X;  3L8C A;  5CZV A;  4G1I A;  2BH1 X;  4DR4 C;  1NYE A;  4B3M C;  2YX1 A;  4DV6 C;  1AMU A;  3I08 A;  2OPL A;  3NYQ A;  1HH2 P;  1XS3 A;  4DG8 A;  1P4E C;  4JI6 C;  1O90 A;  2PN2 A;  1PG3 A;  1N33 C;  1V26 A;  4PUI A;  4DR5 C;  4NXN C;  4G37 A;  4DCS A;  4L4Q A;  4R1M A;  2QVX X;  3S82 A;  2UXB C;  3E7W A;  1M6X A;  3J7A D;  2CXC A;  5LCI A;  4GXR A;  3LAX A;  4D57 A;  4MH4 A;  4WV3 A;  4KHP C;  5BSV A;  3K6R A;  4KTV A;  1QWI A;  3FCC A;  3UX2 A;  2JMP A;  3LUS A;  3GPC A;  1VLA A;  2ZZM A;  2P2M A;  2QW0 X;  2VQE C;  1L2F A;  2UU9 C;  1RG9 A;  2JNV A;  2E0G A;  3NPD A;  2HHH C;  5IT9 D;  3TUF A;  3FCE A;  4D4I A;  4PUG A;  4DR7 C;  3R9W A;  4LE5 A;  4ODJ A;  4ISB A;  3CQ3 A;  3VNR A;  4L2Z A;  3DLP X;  3LNO A;  5FLX D;  2Y27 A;  2YWC A;  2UXC C;  3PES A;  3AF6 A;  3E7X A;  1T5D X;  3CQ2 A;  4OXI A;  1I94 C;  1LCI A;  4GKK C;  3IEV A;  5E7Q A;  4DG9 A;  4IR7 A;  2ASB A;  4ZJZ A;  3GR1 A;  1O9T A;  1XMO C;  3TR3 A;  3N54 B;  4BSZ A;  2ZM6 C;  1GPM A;  4GS5 A;  5BST A;  4RVN A;  5A1G A;  3VNQ A;  4FTF A;  1YJ7 A;  4LF8 C;  4LF4 C;  4LF6 C;  4RVO A;  4BBY A;  5KYT A;  1XNQ C;  2M5O A;  2D1R A;  4DV4 C;  3R9X A;  4JI5 C;  4LFC C;  1ULT A;  2VZE A;  4PRO C;  2QVY X;  1N32 C; 
#chains in the Genus database with same CATH homology
 4TPS B;  1USP A;  2YWB A;  1LQL A;  3ETO A;  4JI3 C;  1MXC A;  4RLQ A;  3RG2 A;  4B3S C;  2AYA A;  1MXA A;  4DCT A;  5BUS A;  3LGX A;  1MKY A;  3RV2 A;  4X64 C;  2ATW A;  1ZB9 A;  5KYV A;  4OYC A;  5T8T A;  1UKK A;  2D27 A;  1HNW C;  1EGA A;  3B7W A;  4X62 C;  4DUY C;  1MDB A;  3L95 X;  2QVZ X;  4MTN A;  1J5E C;  2P2F A;  4JI8 C;  4RMN A;  4BC7 A;  3UZ0 A;  5AE3 A;  2P02 A;  4RLF A;  3T1H C;  2F4V C;  1O92 A;  4FUQ A;  4YHH C;  4JI1 C;  4I9F A;  2Y4N A;  2E8E A;  2EGT A;  4D56 A;  4JV5 C;  5ADZ A;  4LFB C;  3SO4 A;  5CZX A;  2E8F A;  3PRO C;  3EQ6 A;  2HJG A;  4HPV A;  4LF5 C;  2PT7 G;  5DV9 A;  1ML8 A;  2VQF C;  4DV3 C;  3A9V A;  4FUT A;  4KTT A;  4R0M A;  2BJO A;  3TDE A;  4AQY C;  4NXM C;  2E5L C;  3NYR A;  4RM2 A;  1HR0 C;  1MXB A;  4DUZ C;  2OPL B;  3KXW A;  4JI4 C;  3UOW A;  5A1I A;  4GXQ A;  4PHT A;  5IFI A;  4WS9 A;  1XMQ C;  1T5H X;  5AE1 A;  2ONF A;  1O93 A;  3A4I A;  3G7S A;  3IEU A;  5BSW A;  5LMN C;  2D1T A;  2OO4 A;  4DCV A;  5A2Q D;  3T1Y C;  1XRC A;  4NDN A;  5K85 A;  1RY2 A;  5BUR A;  4X66 C;  1MD9 A;  1PG4 A;  2QL8 A;  2UXD C;  5BSR A;  4B3T C;  2P20 A;  2KZF A;  3CW9 A;  5LMU C;  3J81 D;  3LNV A;  4DV2 C;  3GR0 A;  4YY3 C;  1XNR C;  1HNX C;  5H9U A;  4DR6 C;  4DV0 C;  4LF9 C;  2WD9 A;  4JI7 C;  3N2Q A;  2D28 C;  2D7V A;  1IBK C;  2P2B A;  2Y4O A;  1PA4 A;  4ZLP A;  4DR3 C;  4LFA C;  1XRB A;  4GKJ C;  1FJG C;  2UUA C;  3H2T A;  5BR8 C;  2CY1 A;  5K8F A;  2UUB C;  2DPL A;  4D4G A;  2V7B A;  2WP0 C;  3C5E A;  4BC9 A;  1N2F A;  1QM4 A;  3OTO C;  1XRA A;  4L7I A;  4K0B A;  4PZP A;  1V25 A;  3VNS A;  4K0K C;  5T8S A;  4B3R C;  3PBK A;  4X65 C;  4DCU A;  2P2Q A;  2XR1 A;  4BCA A;  3J80 D;  4G36 A;  3DHV A;  3JAM D;  4JI2 C;  3NI2 A;  2DYJ A;  1P7L A;  5KEI A;  2E7G A;  3EER A;  4DV5 C;  3TQI A;  3AF5 A;  2VSQ A;  1MDF A;  4DR1 C;  5BSM A;  4LF7 C;  4R1L A;  2UUC C;  2OBV A;  4U5Y D;  3IML A;  1N36 C;  3ETC A;  4NOZ A;  4IZ6 A;  1KKG A;  4JM1 A;  1HNZ C;  3I07 A;  1USP B;  1WH9 A;  5JRH A;  1IBM C;  4RM3 A;  2D1S A;  1N34 C;  5GTD A;  4XX2 A;  5A19 A;  2PRO A;  5BUQ A;  1WF3 A;  3A9U A;  1JOS A;  4DV1 C;  1ZB8 A;  3CJE A;  1FUG A;  4DV7 C;  5AE2 A;  5IWA C;  2YCB A;  1IBL C;  3R44 A;  2E8C A;  3IPL A;  4I9G A;  4OX9 C;  5BSU A;  4DR2 C;  2D1Q A;  4JI0 C;  3DAY A;  3GKU A;  4JYA C;  1K0R A;  2P2J A;  4EAT A;  1BA3 A;  3CW8 X;  3L8C A;  5CZV A;  4G1I A;  2BH1 X;  4DR4 C;  1NYE A;  4B3M C;  4DV6 C;  1AMU A;  3I08 A;  2OPL A;  3NYQ A;  1HH2 P;  4DG8 A;  4JI6 C;  1O90 A;  2PN2 A;  1PG3 A;  1N33 C;  1V26 A;  4DR5 C;  4NXN C;  4G37 A;  4DCS A;  4L4Q A;  4R1M A;  2QVX X;  3S82 A;  2UXB C;  3E7W A;  3J7A D;  2CXC A;  4GXR A;  3LAX A;  4D57 A;  4MH4 A;  4WV3 A;  4KHP C;  5BSV A;  4KTV A;  1QWI A;  3FCC A;  2JMP A;  3LUS A;  3GPC A;  1VLA A;  2P2M A;  2QW0 X;  2VQE C;  1L2F A;  2UU9 C;  1RG9 A;  2E0G A;  3NPD A;  2HHH C;  5IT9 D;  3TUF A;  3FCE A;  4D4I A;  4DR7 C;  3R9W A;  4LE5 A;  4ODJ A;  4ISB A;  3VNR A;  4L2Z A;  3DLP X;  5FLX D;  2Y27 A;  2YWC A;  2UXC C;  3PES A;  3AF6 A;  3E7X A;  1T5D X;  4OXI A;  1I94 C;  1LCI A;  4GKK C;  3IEV A;  5E7Q A;  4DG9 A;  4IR7 A;  2ASB A;  4ZJZ A;  3GR1 A;  1O9T A;  1XMO C;  3N54 B;  4BSZ A;  2ZM6 C;  1GPM A;  4GS5 A;  5BST A;  4RVN A;  5A1G A;  3VNQ A;  4FTF A;  1YJ7 A;  4LF8 C;  4LF4 C;  4LF6 C;  4RVO A;  4BBY A;  5KYT A;  1XNQ C;  2D1R A;  4DV4 C;  3R9X A;  4JI5 C;  4LFC C;  1ULT A;  2VZE A;  4PRO C;  2QVY X;  1N32 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...