4LF8C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 54
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf8C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf8C02
1N2FA 1EGAA 4MH4A 2ZM6C 1HH2P 1NYEA 1IBLC 2HHHC 5IT9D 2BJOA 4JI7C 2CY1A 2E8EA 2ONFA 1N36C 1XMQC 5FLXD 4DV0C 3IEVA 4JI6C 2UUBC 1VLAA 5IWAC 4LF7C 4K0KC 4LF5C 2ATWA 2UU9C 2PT7G 4DV2C 4DR5C 4DV6C 4LF6C 4DV3C 4JI2C 4DV1C 4JYAC 1N33C 1USPB 3AF5A 2UXBC 5BR8C 2E7GA 4MTNA 1XNQC 4YHHC 4JI5C 2OPLA 3IEUA 4JI8C 2E5LC 4DR1C 2F4VC 1PA4A 2KZFA 4NXNC 4GKKC 2HJGA 4DUYC 4B3MC 3EERA 2E8FA 4JI3C 3T1HC 5LMUC 1HNXC 1ZB9A 4X64C 3OTOC 1N34C 4XX2A 2UUAC 4DV7C 4DUZC 5LMNC 2EGTA 2DYJA 4JI4C 2PN2A 4DV4C 2D7VA 3I07A 4BSZA 4X62C 1JOSA 4B3RC 4DCUA 3J80D 1IBMC 4OX9C 4KHPC 1WF3A 4GKJC 4LF8C 2ASBA 1XNRC 1HR0C 1I94C 1J5EC 1IBKC 3JAMD 3CJEA 4NOZA 4DV5C 1ZB8A 4DR3C 2OPLB 2XR1A 4DR6C 4DR7C 2VQEC 3J81D 1MKYA 2CXCA 4DCTA 4DCVA 3AF6A 1WH9A 4YY3C 1QWIA 3J7AD 4NXMC 3GKUA 2UXDC 2UXCC 4JI0C 4DR4C 2VQFC 1ML8A 3T1YC 1KKGA 4JI1C 4B3TC 4AQYC 1HNWC 2YCBA 2E8CA 4JV5C 4B3SC 1XMOC 5A2QD 3R9WA 2QL8A 1UKKA 1L2FA 4LFCC 2UUCC 4LF9C 1HNZC 4X66C 4LF4C 4DCSA 4LFAC 1K0RA 1USPA 4DR2C 3LUSA 1N32C 4X65C 4LFBC 2JMPA 1LQLA 3R9XA 1FJGC
chains in the Genus database with same CATH superfamily
4GS5A 1EGAA 5E7QA 2ZM6C 5IT9D 2P2BA 5AE2A 2D27A 3FCCA 1VLAA 4LF5C 2ATWA 2UU9C 1QM4A 3C5EA 4JYAC 3UX2A 1N33C 2E7GA 2PG1E 3G7SA 2ZZMA 4JI5C 2VSQA 2E5LC 4WS9A 3UX3A 4GKKC 1XRCA 4G1IA 3VNSA 1XHJA 5LMUC 1HNXC 4GXQA 1ZB9A 3N54B 5LMNC 1V25A 4JI4C 4BSZA 4B3RC 1M6XC 1V26A 4KHPC 4D57A 4RLFA 4TPSB 3TR3A 1HR0C 4PUHA 1RY2A 4I9FA 1I94C 3RV2A 1J5EC 2Y4OA 2D1TA 3R44A 3DAYA 4R1MA 1T5HX 2D28C 4DR7C 4BC7A 4DCVA 2CU6A 3GKUA 4BC9A 4PUIA 3PESA 5CZVA 2VQFC 5K85A 3N2QA 1KKGA 3GR0A 2YCBA 5BSUA 5KEIA 5A2QD 2V7BA 2MM9A 2D1SA 4PZPA 4LFCC 4LF9C 4GXRA 3IPLA 4KTVA 3UOWA 1P4EA 3S82A 1K0RA 4DR2C 4PROC 1MXCA 4X65C 4EATA 1O90A 5T8SA 2P2FA 1FJGC 5A1GA 2BJOA 3KXWA 2OBVA 2WP0C 2YWBA 4JI7C 1PG4A 2E8EA 1XS3A 1N36C 2KZ0A 3LNVA 2P02A 4DV0C 3IEVA 4JI6C 3TDEA 4LF7C 3CW9A 1PU1A 1O9TA 4DR5C 4DV3C 4DV1C 3E7XA 3AF5A 4MTNA 2WD9A 2QW0X 4JI8C 4NXNC 2Y4NA 1AMUA 4DUYC 3EERA 3RG2A 5BUSA 5BUQA 4X64C 1N34C 5IFIA 5BSTA 2DYJA 4DV4C 2D7VA 3I07A 3FCEA 1JOSA 3J80D 1WF3A 3SO4A 4RVNA 1XNRC 3A9VA 5H9UA 1MDFA 5K8FA 2QVYX 2DHMA 1ZB8A 5LCIA 4DR3C 2OPLB 2P2MA 3ETOA 1XRAA 2QVXX 4DCTA 4K0BA 5GTDA 4RLQA 4R1LA 5KYVA 4ODJA 4RM3A 2UXCC 2VZEA 4DR4C 1MD9A 1O93A 4JI1C 3A26A 1TH5A 4LE5A 4JV5C 3H2TA 1FLOA 1UWDA 3R9WA 1XDXA 2D1RA 4D4GA 2UUCC 2AYAA 1HNZC 4X66C 5BURA 1USPA 2BH1X 2KDNA 1MXAA 4BBYA 1N32C 1YJ7A 4FTFA 4PHTA 1FUGA 3AY0A 4MH4A 1HH2P 1NYEA 3CQ1A 5AE3A 1IBLC 2HHHC 4U5YD 3UZ0A 2CY1A 1VEHA 2P2QA 2YWCA 1NY8A 4IZ6A 5IWAC 3LAXA 2PT7G 4DV2C 1MDBA 4DV6C 4LF6C 3PBKA 1USPB 5BR8C 2DPLA 4YHHC 2OPLA 5DV9A 4DR1C 1PA4A 1XRBA 4R0MA 4B3MC 2E8FA 4JI3C 3OTOC 3GPCA 2MMAB 4XX2A 2UUAC 4DV7C 3DLPX 4DUZC 4IR7A 4X62C 3LNOA 3O2EA 4DCUA 4OX9C 1M6XA 2ASBA 4PUGA 4RMNA 4NOZA 4JM1A 3A25A 3L8CA 1MXBA 2XR1A 3I08A 4DR6C 4NDNA 5AE1A 5A1IA 3ETCA 5CZXA 1WH9A 2YX1A 2P2JA 3TUFA 1QWIA 3NI2A 3J7AD 4NXMC 2M5HA 3B7WA 4JI0C 1ML8A 4HPVA 3T1YC 1LCIA 2E0GA 4D56A 4G36A 1HNWC 5BSRA 5BSVA 2E8CA 4B3SC 3E7WA 2OO4A 3VNRA 4ZJZA 1UKKA 3VNQA 1T5DX 1P7LA 3IMLA 4LF4C 4DCSA 4LFAC 3A9UA 3LUSA 5BSMA 2M5OA 5KYTA 3R9XA 2QVZX 1N2FA 4OYCA 2Y27A 5ADZA 3NPDA 4OXIA 2Z51A 2ONFA 3L95X 3K6RA 1XMQC 3NYRA 5FLXD 1BA3A 4FUQA 2UUBC 3EQ6A 2JNVA 4K0KC 4BCAA 4RM2A 4L7IA 4JI2C 2UXBC 1XNQC 4DG9A 5A19A 2MCQA 3IEUA 4ISBA 2PROA 2F4VC 2KZFA 1WCJA 2HJGA 3A4IA 3T1HC 3FM7A 5T8TA 1RG9A 1O92A 1IB8A 2EGTA 2PN2A 3CQ2A 1IBMC 4GKJC 4LF8C 1V60A 1IBKC 4ZLPA 3JAMD 3CJEA 4DV5C 1P4EC 2VQEC 3J81D 1MKYA 2CXCA 3AF6A 4YY3C 2P20A 3NYQA 2UXDC 4L2ZA 4L4QA 3DHVA 4FUTA 3CW8X 2D1QA 3LGXA 3PROC 3UEBA 4B3TC 1ULTA 2NCLA 4AQYC 2ZTBA 4KTTA 3CQ3A 3TQIA 1XMOC 2QL8A 5BSWA 1PG3A 1L2FA 1GPMA 4WV3A 4RVOA 2ZZNA 4D4IA 4DG8A 4I9GA 5JRHA 4G37A 1YGTA 4LFBC 2JMPA 1LQLA 3GR1A
chains in the Genus database with same CATH topology
4GS5A 1EGAA 5E7QA 2ZM6C 5IT9D 2P2BA 5AE2A 2D27A 3FCCA 1VLAA 4LF5C 2ATWA 2UU9C 1QM4A 3C5EA 4JYAC 1N33C 2E7GA 3G7SA 4JI5C 2VSQA 2E5LC 4WS9A 4GKKC 1XRCA 4G1IA 3VNSA 5LMUC 1HNXC 4GXQA 1ZB9A 3N54B 5LMNC 1V25A 4JI4C 4BSZA 4B3RC 1V26A 4KHPC 4D57A 4RLFA 4TPSB 1HR0C 1RY2A 4I9FA 1I94C 3RV2A 1J5EC 2Y4OA 2D1TA 3R44A 3DAYA 4R1MA 1T5HX 2D28C 4DR7C 4BC7A 4DCVA 3GKUA 4BC9A 3PESA 5CZVA 2VQFC 5K85A 3N2QA 1KKGA 3GR0A 2YCBA 5BSUA 5KEIA 5A2QD 2V7BA 2D1SA 4PZPA 4LFCC 4LF9C 4GXRA 3IPLA 4KTVA 3UOWA 3S82A 1K0RA 4DR2C 4PROC 1MXCA 4X65C 4EATA 1O90A 5T8SA 2P2FA 1FJGC 5A1GA 2BJOA 3KXWA 2OBVA 2WP0C 2YWBA 4JI7C 1PG4A 2E8EA 1N36C 3LNVA 2P02A 4DV0C 3IEVA 4JI6C 3TDEA 4LF7C 3CW9A 1O9TA 4DR5C 4DV3C 4DV1C 3E7XA 3AF5A 4MTNA 2WD9A 2QW0X 4JI8C 4NXNC 2Y4NA 1AMUA 4DUYC 3EERA 3RG2A 5BUSA 5BUQA 4X64C 1N34C 5IFIA 5BSTA 2DYJA 4DV4C 2D7VA 3I07A 3FCEA 1JOSA 3J80D 1WF3A 3SO4A 4RVNA 1XNRC 3A9VA 5H9UA 1MDFA 5K8FA 2QVYX 1ZB8A 4DR3C 2OPLB 2P2MA 3ETOA 1XRAA 2QVXX 4DCTA 4K0BA 5GTDA 4RLQA 4R1LA 5KYVA 4ODJA 4RM3A 2UXCC 2VZEA 4DR4C 1MD9A 1O93A 4JI1C 4LE5A 4JV5C 3H2TA 3R9WA 2D1RA 4D4GA 2UUCC 2AYAA 1HNZC 4X66C 5BURA 1USPA 2BH1X 1MXAA 4BBYA 1N32C 1YJ7A 4FTFA 4PHTA 1FUGA 4MH4A 1HH2P 1NYEA 1IBLC 5AE3A 2HHHC 4U5YD 3UZ0A 2P2QA 2CY1A 2YWCA 4IZ6A 5IWAC 3LAXA 2PT7G 4DV2C 1MDBA 4DV6C 4LF6C 3PBKA 1USPB 5BR8C 2DPLA 4YHHC 2OPLA 5DV9A 4DR1C 1PA4A 1XRBA 4R0MA 4B3MC 2E8FA 4JI3C 3OTOC 3GPCA 4XX2A 2UUAC 4DV7C 3DLPX 4DUZC 4IR7A 4X62C 4DCUA 4OX9C 2ASBA 4RMNA 4NOZA 4JM1A 3L8CA 1MXBA 2XR1A 3I08A 4DR6C 4NDNA 5AE1A 5A1IA 3ETCA 5CZXA 1WH9A 2P2JA 3TUFA 1QWIA 3NI2A 3J7AD 4NXMC 3B7WA 4JI0C 1ML8A 4HPVA 3T1YC 1LCIA 2E0GA 4D56A 4G36A 1HNWC 5BSRA 5BSVA 2E8CA 4B3SC 3E7WA 2OO4A 3VNRA 4ZJZA 1UKKA 3VNQA 1T5DX 1P7LA 3IMLA 4LF4C 4DCSA 4LFAC 3A9UA 3LUSA 5BSMA 5KYTA 3R9XA 2QVZX 1N2FA 4OYCA 2Y27A 5ADZA 3NPDA 4OXIA 2ONFA 3L95X 1XMQC 3NYRA 5FLXD 1BA3A 4FUQA 2UUBC 3EQ6A 4K0KC 4BCAA 4RM2A 4L7IA 4JI2C 2UXBC 1XNQC 4DG9A 5A19A 3IEUA 4ISBA 2PROA 2F4VC 2KZFA 2HJGA 3A4IA 3T1HC 5T8TA 1RG9A 1O92A 2EGTA 2PN2A 1IBMC 4GKJC 4LF8C 1IBKC 4ZLPA 3JAMD 3CJEA 4DV5C 2VQEC 3J81D 1MKYA 2CXCA 3AF6A 4YY3C 2P20A 3NYQA 2UXDC 4L2ZA 4L4QA 3DHVA 4FUTA 3CW8X 2D1QA 3LGXA 3PROC 4B3TC 1ULTA 4AQYC 4KTTA 3TQIA 1XMOC 2QL8A 5BSWA 1PG3A 1L2FA 1GPMA 4WV3A 4RVOA 4D4IA 4DG8A 4I9GA 5JRHA 4G37A 4LFBC 2JMPA 1LQLA 3GR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2F A;  1EGA A;  4MH4 A;  2ZM6 C;  1HH2 P;  1NYE A;  1IBL C;  2HHH C;  5IT9 D;  2BJO A;  4JI7 C;  2CY1 A;  2E8E A;  2ONF A;  1N36 C;  1XMQ C;  5FLX D;  4DV0 C;  3IEV A;  4JI6 C;  2UUB C;  1VLA A;  5IWA C;  4LF7 C;  4K0K C;  4LF5 C;  2ATW A;  2UU9 C;  2PT7 G;  4DV2 C;  4DR5 C;  4DV6 C;  4LF6 C;  4DV3 C;  4JI2 C;  4DV1 C;  4JYA C;  1N33 C;  1USP B;  3AF5 A;  2UXB C;  5BR8 C;  2E7G A;  4MTN A;  1XNQ C;  4YHH C;  4JI5 C;  2OPL A;  3IEU A;  4JI8 C;  2E5L C;  4DR1 C;  2F4V C;  1PA4 A;  2KZF A;  4NXN C;  4GKK C;  2HJG A;  4DUY C;  4B3M C;  3EER A;  2E8F A;  4JI3 C;  3T1H C;  5LMU C;  1HNX C;  1ZB9 A;  4X64 C;  3OTO C;  1N34 C;  4XX2 A;  2UUA C;  4DV7 C;  4DUZ C;  5LMN C;  2EGT A;  2DYJ A;  4JI4 C;  2PN2 A;  4DV4 C;  2D7V A;  3I07 A;  4BSZ A;  4X62 C;  1JOS A;  4B3R C;  4DCU A;  3J80 D;  1IBM C;  4OX9 C;  4KHP C;  1WF3 A;  4GKJ C;  4LF8 C;  2ASB A;  1XNR C;  1HR0 C;  1I94 C;  1J5E C;  1IBK C;  3JAM D;  3CJE A;  4NOZ A;  4DV5 C;  1ZB8 A;  4DR3 C;  2OPL B;  2XR1 A;  4DR6 C;  4DR7 C;  2VQE C;  3J81 D;  1MKY A;  2CXC A;  4DCT A;  4DCV A;  3AF6 A;  1WH9 A;  4YY3 C;  1QWI A;  3J7A D;  4NXM C;  3GKU A;  2UXD C;  2UXC C;  4JI0 C;  4DR4 C;  2VQF C;  1ML8 A;  3T1Y C;  1KKG A;  4JI1 C;  4B3T C;  4AQY C;  1HNW C;  2YCB A;  2E8C A;  4JV5 C;  4B3S C;  1XMO C;  5A2Q D;  3R9W A;  2QL8 A;  1UKK A;  1L2F A;  4LFC C;  2UUC C;  4LF9 C;  1HNZ C;  4X66 C;  4LF4 C;  4DCS A;  4LFA C;  1K0R A;  1USP A;  4DR2 C;  3LUS A;  1N32 C;  4X65 C;  4LFB C;  2JMP A;  1LQL A;  3R9X A;  1FJG C; 
#chains in the Genus database with same CATH topology
 4GS5 A;  1EGA A;  5E7Q A;  2ZM6 C;  5IT9 D;  2P2B A;  5AE2 A;  2D27 A;  3FCC A;  1VLA A;  4LF5 C;  2ATW A;  2UU9 C;  1QM4 A;  3C5E A;  4JYA C;  3UX2 A;  1N33 C;  2E7G A;  2PG1 E;  3G7S A;  2ZZM A;  4JI5 C;  2VSQ A;  2E5L C;  4WS9 A;  3UX3 A;  4GKK C;  1XRC A;  4G1I A;  3VNS A;  1XHJ A;  5LMU C;  1HNX C;  4GXQ A;  1ZB9 A;  3N54 B;  5LMN C;  1V25 A;  4JI4 C;  4BSZ A;  4B3R C;  1M6X C;  1V26 A;  4KHP C;  4D57 A;  4RLF A;  4TPS B;  3TR3 A;  1HR0 C;  4PUH A;  1RY2 A;  4I9F A;  1I94 C;  3RV2 A;  1J5E C;  2Y4O A;  2D1T A;  3R44 A;  3DAY A;  4R1M A;  1T5H X;  2D28 C;  4DR7 C;  4BC7 A;  4DCV A;  2CU6 A;  3GKU A;  4BC9 A;  4PUI A;  3PES A;  5CZV A;  2VQF C;  5K85 A;  3N2Q A;  1KKG A;  3GR0 A;  2YCB A;  5BSU A;  5KEI A;  5A2Q D;  2V7B A;  2MM9 A;  2D1S A;  4PZP A;  4LFC C;  4LF9 C;  4GXR A;  3IPL A;  4KTV A;  3UOW A;  1P4E A;  3S82 A;  1K0R A;  4DR2 C;  4PRO C;  1MXC A;  4X65 C;  4EAT A;  1O90 A;  5T8S A;  2P2F A;  1FJG C;  5A1G A;  2BJO A;  3KXW A;  2OBV A;  2WP0 C;  2YWB A;  4JI7 C;  1PG4 A;  2E8E A;  1XS3 A;  1N36 C;  2KZ0 A;  3LNV A;  2P02 A;  4DV0 C;  3IEV A;  4JI6 C;  3TDE A;  4LF7 C;  3CW9 A;  1PU1 A;  1O9T A;  4DR5 C;  4DV3 C;  4DV1 C;  3E7X A;  3AF5 A;  4MTN A;  2WD9 A;  2QW0 X;  4JI8 C;  4NXN C;  2Y4N A;  1AMU A;  4DUY C;  3EER A;  3RG2 A;  5BUS A;  5BUQ A;  4X64 C;  1N34 C;  5IFI A;  5BST A;  2DYJ A;  4DV4 C;  2D7V A;  3I07 A;  3FCE A;  1JOS A;  3J80 D;  1WF3 A;  3SO4 A;  4RVN A;  1XNR C;  3A9V A;  5H9U A;  1MDF A;  5K8F A;  2QVY X;  2DHM A;  1ZB8 A;  5LCI A;  4DR3 C;  2OPL B;  2P2M A;  3ETO A;  1XRA A;  2QVX X;  4DCT A;  4K0B A;  5GTD A;  4RLQ A;  4R1L A;  5KYV A;  4ODJ A;  4RM3 A;  2UXC C;  2VZE A;  4DR4 C;  1MD9 A;  1O93 A;  4JI1 C;  3A26 A;  1TH5 A;  4LE5 A;  4JV5 C;  3H2T A;  1FLO A;  1UWD A;  3R9W A;  1XDX A;  2D1R A;  4D4G A;  2UUC C;  2AYA A;  1HNZ C;  4X66 C;  5BUR A;  1USP A;  2BH1 X;  2KDN A;  1MXA A;  4BBY A;  1N32 C;  1YJ7 A;  4FTF A;  4PHT A;  1FUG A;  3AY0 A;  4MH4 A;  1HH2 P;  1NYE A;  3CQ1 A;  5AE3 A;  1IBL C;  2HHH C;  4U5Y D;  3UZ0 A;  2CY1 A;  1VEH A;  2P2Q A;  2YWC A;  1NY8 A;  4IZ6 A;  5IWA C;  3LAX A;  2PT7 G;  4DV2 C;  1MDB A;  4DV6 C;  4LF6 C;  3PBK A;  1USP B;  5BR8 C;  2DPL A;  4YHH C;  2OPL A;  5DV9 A;  4DR1 C;  1PA4 A;  1XRB A;  4R0M A;  4B3M C;  2E8F A;  4JI3 C;  3OTO C;  3GPC A;  2MMA B;  4XX2 A;  2UUA C;  4DV7 C;  3DLP X;  4DUZ C;  4IR7 A;  4X62 C;  3LNO A;  3O2E A;  4DCU A;  4OX9 C;  1M6X A;  2ASB A;  4PUG A;  4RMN A;  4NOZ A;  4JM1 A;  3A25 A;  3L8C A;  1MXB A;  2XR1 A;  3I08 A;  4DR6 C;  4NDN A;  5AE1 A;  5A1I A;  3ETC A;  5CZX A;  1WH9 A;  2YX1 A;  2P2J A;  3TUF A;  1QWI A;  3NI2 A;  3J7A D;  4NXM C;  2M5H A;  3B7W A;  4JI0 C;  1ML8 A;  4HPV A;  3T1Y C;  1LCI A;  2E0G A;  4D56 A;  4G36 A;  1HNW C;  5BSR A;  5BSV A;  2E8C A;  4B3S C;  3E7W A;  2OO4 A;  3VNR A;  4ZJZ A;  1UKK A;  3VNQ A;  1T5D X;  1P7L A;  3IML A;  4LF4 C;  4DCS A;  4LFA C;  3A9U A;  3LUS A;  5BSM A;  2M5O A;  5KYT A;  3R9X A;  2QVZ X;  1N2F A;  4OYC A;  2Y27 A;  5ADZ A;  3NPD A;  4OXI A;  2Z51 A;  2ONF A;  3L95 X;  3K6R A;  1XMQ C;  3NYR A;  5FLX D;  1BA3 A;  4FUQ A;  2UUB C;  3EQ6 A;  2JNV A;  4K0K C;  4BCA A;  4RM2 A;  4L7I A;  4JI2 C;  2UXB C;  1XNQ C;  4DG9 A;  5A19 A;  2MCQ A;  3IEU A;  4ISB A;  2PRO A;  2F4V C;  2KZF A;  1WCJ A;  2HJG A;  3A4I A;  3T1H C;  3FM7 A;  5T8T A;  1RG9 A;  1O92 A;  1IB8 A;  2EGT A;  2PN2 A;  3CQ2 A;  1IBM C;  4GKJ C;  4LF8 C;  1V60 A;  1IBK C;  4ZLP A;  3JAM D;  3CJE A;  4DV5 C;  1P4E C;  2VQE C;  3J81 D;  1MKY A;  2CXC A;  3AF6 A;  4YY3 C;  2P20 A;  3NYQ A;  2UXD C;  4L2Z A;  4L4Q A;  3DHV A;  4FUT A;  3CW8 X;  2D1Q A;  3LGX A;  3PRO C;  3UEB A;  4B3T C;  1ULT A;  2NCL A;  4AQY C;  2ZTB A;  4KTT A;  3CQ3 A;  3TQI A;  1XMO C;  2QL8 A;  5BSW A;  1PG3 A;  1L2F A;  1GPM A;  4WV3 A;  4RVO A;  2ZZN A;  4D4I A;  4DG8 A;  4I9G A;  5JRH A;  4G37 A;  1YGT A;  4LFB C;  2JMP A;  1LQL A;  3GR1 A; 
#chains in the Genus database with same CATH homology
 4GS5 A;  1EGA A;  5E7Q A;  2ZM6 C;  5IT9 D;  2P2B A;  5AE2 A;  2D27 A;  3FCC A;  1VLA A;  4LF5 C;  2ATW A;  2UU9 C;  1QM4 A;  3C5E A;  4JYA C;  1N33 C;  2E7G A;  3G7S A;  4JI5 C;  2VSQ A;  2E5L C;  4WS9 A;  4GKK C;  1XRC A;  4G1I A;  3VNS A;  5LMU C;  1HNX C;  4GXQ A;  1ZB9 A;  3N54 B;  5LMN C;  1V25 A;  4JI4 C;  4BSZ A;  4B3R C;  1V26 A;  4KHP C;  4D57 A;  4RLF A;  4TPS B;  1HR0 C;  1RY2 A;  4I9F A;  1I94 C;  3RV2 A;  1J5E C;  2Y4O A;  2D1T A;  3R44 A;  3DAY A;  4R1M A;  1T5H X;  2D28 C;  4DR7 C;  4BC7 A;  4DCV A;  3GKU A;  4BC9 A;  3PES A;  5CZV A;  2VQF C;  5K85 A;  3N2Q A;  1KKG A;  3GR0 A;  2YCB A;  5BSU A;  5KEI A;  5A2Q D;  2V7B A;  2D1S A;  4PZP A;  4LFC C;  4LF9 C;  4GXR A;  3IPL A;  4KTV A;  3UOW A;  3S82 A;  1K0R A;  4DR2 C;  4PRO C;  1MXC A;  4X65 C;  4EAT A;  1O90 A;  5T8S A;  2P2F A;  1FJG C;  5A1G A;  2BJO A;  3KXW A;  2OBV A;  2WP0 C;  2YWB A;  4JI7 C;  1PG4 A;  2E8E A;  1N36 C;  3LNV A;  2P02 A;  4DV0 C;  3IEV A;  4JI6 C;  3TDE A;  4LF7 C;  3CW9 A;  1O9T A;  4DR5 C;  4DV3 C;  4DV1 C;  3E7X A;  3AF5 A;  4MTN A;  2WD9 A;  2QW0 X;  4JI8 C;  4NXN C;  2Y4N A;  1AMU A;  4DUY C;  3EER A;  3RG2 A;  5BUS A;  5BUQ A;  4X64 C;  1N34 C;  5IFI A;  5BST A;  2DYJ A;  4DV4 C;  2D7V A;  3I07 A;  3FCE A;  1JOS A;  3J80 D;  1WF3 A;  3SO4 A;  4RVN A;  1XNR C;  3A9V A;  5H9U A;  1MDF A;  5K8F A;  2QVY X;  1ZB8 A;  4DR3 C;  2OPL B;  2P2M A;  3ETO A;  1XRA A;  2QVX X;  4DCT A;  4K0B A;  5GTD A;  4RLQ A;  4R1L A;  5KYV A;  4ODJ A;  4RM3 A;  2UXC C;  2VZE A;  4DR4 C;  1MD9 A;  1O93 A;  4JI1 C;  4LE5 A;  4JV5 C;  3H2T A;  3R9W A;  2D1R A;  4D4G A;  2UUC C;  2AYA A;  1HNZ C;  4X66 C;  5BUR A;  1USP A;  2BH1 X;  1MXA A;  4BBY A;  1N32 C;  1YJ7 A;  4FTF A;  4PHT A;  1FUG A;  4MH4 A;  1HH2 P;  1NYE A;  1IBL C;  5AE3 A;  2HHH C;  4U5Y D;  3UZ0 A;  2P2Q A;  2CY1 A;  2YWC A;  4IZ6 A;  5IWA C;  3LAX A;  2PT7 G;  4DV2 C;  1MDB A;  4DV6 C;  4LF6 C;  3PBK A;  1USP B;  5BR8 C;  2DPL A;  4YHH C;  2OPL A;  5DV9 A;  4DR1 C;  1PA4 A;  1XRB A;  4R0M A;  4B3M C;  2E8F A;  4JI3 C;  3OTO C;  3GPC A;  4XX2 A;  2UUA C;  4DV7 C;  3DLP X;  4DUZ C;  4IR7 A;  4X62 C;  4DCU A;  4OX9 C;  2ASB A;  4RMN A;  4NOZ A;  4JM1 A;  3L8C A;  1MXB A;  2XR1 A;  3I08 A;  4DR6 C;  4NDN A;  5AE1 A;  5A1I A;  3ETC A;  5CZX A;  1WH9 A;  2P2J A;  3TUF A;  1QWI A;  3NI2 A;  3J7A D;  4NXM C;  3B7W A;  4JI0 C;  1ML8 A;  4HPV A;  3T1Y C;  1LCI A;  2E0G A;  4D56 A;  4G36 A;  1HNW C;  5BSR A;  5BSV A;  2E8C A;  4B3S C;  3E7W A;  2OO4 A;  3VNR A;  4ZJZ A;  1UKK A;  3VNQ A;  1T5D X;  1P7L A;  3IML A;  4LF4 C;  4DCS A;  4LFA C;  3A9U A;  3LUS A;  5BSM A;  5KYT A;  3R9X A;  2QVZ X;  1N2F A;  4OYC A;  2Y27 A;  5ADZ A;  3NPD A;  4OXI A;  2ONF A;  3L95 X;  1XMQ C;  3NYR A;  5FLX D;  1BA3 A;  4FUQ A;  2UUB C;  3EQ6 A;  4K0K C;  4BCA A;  4RM2 A;  4L7I A;  4JI2 C;  2UXB C;  1XNQ C;  4DG9 A;  5A19 A;  3IEU A;  4ISB A;  2PRO A;  2F4V C;  2KZF A;  2HJG A;  3A4I A;  3T1H C;  5T8T A;  1RG9 A;  1O92 A;  2EGT A;  2PN2 A;  1IBM C;  4GKJ C;  4LF8 C;  1IBK C;  4ZLP A;  3JAM D;  3CJE A;  4DV5 C;  2VQE C;  3J81 D;  1MKY A;  2CXC A;  3AF6 A;  4YY3 C;  2P20 A;  3NYQ A;  2UXD C;  4L2Z A;  4L4Q A;  3DHV A;  4FUT A;  3CW8 X;  2D1Q A;  3LGX A;  3PRO C;  4B3T C;  1ULT A;  4AQY C;  4KTT A;  3TQI A;  1XMO C;  2QL8 A;  5BSW A;  1PG3 A;  1L2F A;  1GPM A;  4WV3 A;  4RVO A;  4D4I A;  4DG8 A;  4I9G A;  5JRH A;  4G37 A;  4LFB C;  2JMP A;  1LQL A;  3GR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...