4LF8C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 54
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf8C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf8C02
1N2FA 2UXBC 3AF6A 1IBKC 4LF4C 4LFBC 1ZB9A 3J7AD 1HNXC 5LMUC 1J5EC 4K0KC 4YHHC 4DUZC 1XNQC 4X66C 3LUSA 4AQYC 2VQFC 3R9XA 4JI3C 4DR6C 2CY1A 5IWAC 2HJGA 3T1YC 4XX2A 4LF9C 4NOZA 4DR1C 4JI0C 4DR3C 3JAMD 3GKUA 4JI6C 4LF6C 3J81D 2E8FA 1HNWC 3CJEA 4DCSA 4DV1C 1USPA 4DR2C 4LFAC 2UUCC 2VQEC 1L2FA 2KZFA 1XMOC 4NXMC 2HHHC 4DR7C 1N34C 4DCVA 2E8CA 4DR5C 1N36C 4JI5C 1PA4A 2E5LC 1XNRC 4X64C 3AF5A 2OPLA 1USPB 3IEUA 3T1HC 1KKGA 2ASBA 4LF7C 2UU9C 3EERA 2BJOA 4B3SC 4X65C 2PT7G 2XR1A 4DV5C 4B3TC 4DV4C 1IBLC 1VLAA 2ATWA 1QWIA 4X62C 5LMNC 4NXNC 4DUYC 4DR4C 2UXDC 4DCTA 4JV5C 2F4VC 4B3MC 4JYAC 4DV7C 5BR8C 4DV2C 1XMQC 4JI2C 2OPLB 4GKKC 2ZM6C 4JI1C 4MTNA 4BSZA 4JI4C 4MH4A 1IBMC 4YY3C 5IT9D 5FLXD 3R9WA 2UUAC 1WH9A 4LF8C 2JMPA 2PN2A 3OTOC 2EGTA 5A2QD 2E8EA 1ML8A 4KHPC 1N32C 4JI7C 1NYEA 4GKJC 4DV6C 1MKYA 2DYJA 1FJGC 1HR0C 1HH2P 4OX9C 3J80D 2E7GA 1I94C 1N33C 1WF3A 1LQLA 1HNZC 3I07A 1K0RA 2YCBA 4LFCC 4JI8C 1JOSA 2CXCA 4DCUA 3IEVA 2QL8A 2D7VA 2UXCC 2UUBC 4B3RC 2ONFA 4LF5C 1ZB8A 4DV3C 4DV0C 1EGAA 1UKKA
chains in the Genus database with same CATH superfamily
4DG8A 3C5EA 2UXBC 1IBKC 3CW9A 5AE3A 4YHHC 4D4IA 5BUQA 3R9XA 5BURA 1LCIA 3TQIA 4NOZA 4DR1C 4LF6C 3JAMD 2P2QA 3CJEA 3LNVA 2P20A 1XMOC 2WP0C 1N34C 4PHTA 2E8CA 1GPMA 5BSWA 2PROA 4R1MA 3RG2A 2MMAB 2D1QA 2KZ0A 3I08A 4X64C 5BSMA 4DG9A 3AF5A 3IEUA 2ASBA 3DAYA 5AE2A 4FUTA 1PG3A 3H2TA 2M5HA 1P4EA 4B3TC 4PUHA 3A25A 2ATWA 2YWBA 4DR4C 2F4VC 5CZXA 4B3MC 2MM9A 5BR8C 5H9UA 3L95X 4OXIA 4KTTA 4JI2C 1FLOA 4MH4A 1MD9A 1IBMC 3GR0A 4BCAA 2D1TA 2E0GA 3R9WA 2UUAC 1WH9A 3ETOA 5A2QD 3TUFA 1NYEA 2NCLA 2YWCA 2DYJA 4DV6C 2BH1X 1HR0C 4FTFA 3J80D 4RMNA 1I94C 1LQLA 2P2JA 4LFCC 3TR3A 2QL8A 2D7VA 2QVYX 3A26A 2UUBC 5A1GA 2P2BA 3PROC 2CU6A 1ZB8A 1UKKA 2D1RA 3IPLA 2ZZNA 3J7AD 1HNXC 1YGTA 1IB8A 4RVNA 2Y4NA 3IMLA 1P7LA 2D1SA 5LMUC 1J5EC 1M6XC 4K0KC 5A19A 4X66C 3LUSA 4ZJZA 2QW0X 4AQYC 4JI3C 2HJGA 4LF9C 4JI0C 3GKUA 3NPDA 1AMUA 1HNWC 1USPA 5KEIA 1L2FA 4DCVA 1UWDA 4ZLPA 3UX3A 1ULTA 1O93A 1N36C 1O92A 3VNSA 4JI5C 1XNRC 1MXBA 4GXRA 2OPLA 1USPB 3NYRA 3T1HC 1KKGA 2UU9C 2P02A 2BJOA 3SO4A 4BC9A 3FCCA 1QWIA 4NXNC 3NYQA 4PUGA 3G7SA 4DUYC 3R44A 2UXDC 3DLPX 2DHMA 1MXAA 4JYAC 2ZZMA 4G1IA 1XMQC 4GKKC 2OPLB 3CQ2A 4ODJA 3ETCA 2ZM6C 4MTNA 4RVOA 4YY3C 2Y4OA 2OO4A 4LF8C 3OTOC 2EGTA 1ML8A 4KHPC 1N32C 4GKJC 4L4QA 2WD9A 3UX2A 1QM4A 5GTDA 3UEBA 1XDXA 3PESA 3EQ6A 3I07A 1K0RA 5DV9A 4JI8C 2QVZX 3K6RA 2OBVA 3E7XA 1RY2A 4ISBA 1T5HX 2VSQA 4LF5C 3VNRA 2AYAA 1EGAA 1P4EC 1YJ7A 4I9FA 4FUQA 1V60A 1XRBA 3DHVA 4PROC 4DUZC 2VQFC 5LCIA 4DR6C 5IWAC 3T1YC 1V26A 4JM1A 4BBYA 3LAXA 1MXCA 2E8FA 4DCSA 2Y27A 4LFAC 5BSRA 3GPCA 2VQEC 2V7BA 2HHHC 4DR7C 1BA3A 4PUIA 1M6XA 3A9VA 1PA4A 2MCQA 4U5YD 4D57A 4X65C 2PT7G 4RLFA 4DV4C 3A9UA 3FCEA 4X62C 5BSUA 1O90A 4JV5C 4K0BA 2VZEA 5KYTA 3N2QA 4WV3A 4DV2C 1XRCA 1MDBA 5JRHA 4JI1C 4L2ZA 1RG9A 4JI4C 4GXQA 2M5OA 3NI2A 5IT9D 4D4GA 1XHJA 2JMPA 1FUGA 2PN2A 2E8EA 4JI7C 3KXWA 1MKYA 3TDEA 1FJGC 3GR1A 4OX9C 5T8SA 4I9GA 5A1IA 4LE5A 4GS5A 2YCBA 3N54B 1MDFA 1JOSA 2JNVA 2P2MA 5T8TA 3E7WA 2ONFA 4RM3A 4DV3C 4DR3C 2P2FA 1N2FA 3AF6A 4LF4C 4LFBC 4PZPA 1ZB9A 4G37A 1TH5A 1WCJA 2Z51A 4EATA 3UOWA 3VNQA 3A4IA 3UZ0A 1XNQC 3B7WA 2CY1A 3FM7A 4D56A 3CQ3A 1XRAA 4XX2A 4JI6C 5KYVA 3J81D 3O2EA 2DPLA 3LNOA 4DV1C 4DR2C 2UUCC 5E7QA 3S82A 5IFIA 5BSVA 2KZFA 3LGXA 4NXMC 3AY0A 4BC7A 5K85A 4DR5C 2E5LC 3L8CA 1V25A 1T5DX 2YX1A 4NDNA 4G36A 3RV2A 5ADZA 4LF7C 1NY8A 3EERA 3CW8X 4B3SC 4IR7A 2ZTBA 4DV5C 2XR1A 1IBLC 1VLAA 1O9TA 4TPSB 5LMNC 4KTVA 1XS3A 4DCTA 4DV7C 2QVXX 4RM2A 4L7IA 2PG1E 4BSZA 5AE1A 3CQ1A 5FLXD 2D28C 4IZ6A 4HPVA 2KDNA 4R1LA 5CZVA 1HH2P 1PG4A 3PBKA 2E7GA 1N33C 1WF3A 1HNZC 2D27A 5BUSA 5BSTA 4DCUA 2CXCA 1VEHA 4RLQA 3IEVA 1PU1A 4R0MA 2UXCC 4B3RC 4WS9A 4OYCA 5K8FA 4DV0C
chains in the Genus database with same CATH topology
4DG8A 3C5EA 2UXBC 1IBKC 3CW9A 5AE3A 4YHHC 4D4IA 5BUQA 3R9XA 5BURA 1LCIA 3TQIA 4NOZA 4DR1C 4LF6C 3JAMD 2P2QA 3CJEA 3LNVA 2P20A 1XMOC 2WP0C 1N34C 4PHTA 2E8CA 1GPMA 5BSWA 2PROA 4R1MA 3RG2A 2D1QA 3I08A 4X64C 5BSMA 4DG9A 3AF5A 3IEUA 2ASBA 3DAYA 5AE2A 4FUTA 1PG3A 3H2TA 4B3TC 2ATWA 2YWBA 4DR4C 2F4VC 5CZXA 4B3MC 5BR8C 5H9UA 3L95X 4OXIA 4KTTA 4JI2C 4MH4A 1MD9A 1IBMC 3GR0A 4BCAA 2D1TA 2E0GA 3R9WA 2UUAC 1WH9A 3ETOA 5A2QD 3TUFA 1NYEA 2YWCA 2DYJA 4DV6C 2BH1X 1HR0C 4FTFA 3J80D 4RMNA 1I94C 1LQLA 2P2JA 4LFCC 2QL8A 2D7VA 2QVYX 2UUBC 5A1GA 2P2BA 3PROC 1ZB8A 1UKKA 2D1RA 3IPLA 3J7AD 1HNXC 4RVNA 2Y4NA 3IMLA 1P7LA 2D1SA 5LMUC 1J5EC 4K0KC 5A19A 4X66C 3LUSA 4ZJZA 2QW0X 4AQYC 4JI3C 2HJGA 4LF9C 4JI0C 3GKUA 3NPDA 1AMUA 1HNWC 1USPA 5KEIA 1L2FA 4DCVA 4ZLPA 1ULTA 1O93A 1N36C 1O92A 3VNSA 4JI5C 1XNRC 1MXBA 4GXRA 2OPLA 1USPB 3NYRA 3T1HC 1KKGA 2UU9C 2P02A 2BJOA 3SO4A 4BC9A 3FCCA 1QWIA 4NXNC 3NYQA 3G7SA 4DUYC 3R44A 2UXDC 3DLPX 1MXAA 4JYAC 4G1IA 1XMQC 4GKKC 2OPLB 4ODJA 3ETCA 2ZM6C 4MTNA 4RVOA 4YY3C 2Y4OA 2OO4A 4LF8C 3OTOC 2EGTA 1ML8A 4KHPC 1N32C 4GKJC 4L4QA 2WD9A 1QM4A 5GTDA 3PESA 3EQ6A 3I07A 1K0RA 5DV9A 4JI8C 2QVZX 2OBVA 3E7XA 1RY2A 4ISBA 1T5HX 2VSQA 4LF5C 3VNRA 2AYAA 1EGAA 1YJ7A 4I9FA 4FUQA 1XRBA 3DHVA 4PROC 4DUZC 2VQFC 4DR6C 5IWAC 3T1YC 1V26A 4JM1A 4BBYA 3LAXA 1MXCA 2E8FA 4DCSA 2Y27A 4LFAC 5BSRA 3GPCA 2VQEC 2V7BA 2HHHC 4DR7C 1BA3A 3A9VA 1PA4A 4U5YD 4D57A 4X65C 2PT7G 4RLFA 4DV4C 3A9UA 3FCEA 4X62C 5BSUA 1O90A 4JV5C 4K0BA 2VZEA 5KYTA 3N2QA 4WV3A 4DV2C 1XRCA 1MDBA 5JRHA 4JI1C 4L2ZA 1RG9A 4JI4C 4GXQA 3NI2A 5IT9D 4D4GA 2JMPA 1FUGA 2PN2A 2E8EA 4JI7C 3KXWA 1MKYA 3TDEA 1FJGC 3GR1A 4OX9C 5T8SA 4I9GA 5A1IA 4LE5A 4GS5A 2YCBA 3N54B 1MDFA 1JOSA 2P2MA 5T8TA 3E7WA 2ONFA 4RM3A 4DV3C 4DR3C 2P2FA 1N2FA 3AF6A 4LF4C 4LFBC 4PZPA 1ZB9A 4G37A 4EATA 3UOWA 3VNQA 3A4IA 3UZ0A 1XNQC 3B7WA 2CY1A 4D56A 1XRAA 4XX2A 4JI6C 5KYVA 3J81D 2DPLA 4DV1C 4DR2C 2UUCC 5E7QA 3S82A 5IFIA 5BSVA 2KZFA 3LGXA 4NXMC 4BC7A 5K85A 4DR5C 2E5LC 3L8CA 1V25A 1T5DX 4NDNA 4G36A 3RV2A 5ADZA 4LF7C 3EERA 3CW8X 4B3SC 4IR7A 4DV5C 2XR1A 1IBLC 1VLAA 1O9TA 4TPSB 5LMNC 4KTVA 4DCTA 4DV7C 2QVXX 4RM2A 4L7IA 4BSZA 5AE1A 5FLXD 2D28C 4IZ6A 4HPVA 4R1LA 5CZVA 1HH2P 1PG4A 3PBKA 2E7GA 1N33C 1WF3A 1HNZC 2D27A 5BUSA 5BSTA 4DCUA 2CXCA 4RLQA 3IEVA 4R0MA 2UXCC 4B3RC 4WS9A 4OYCA 5K8FA 4DV0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2F A;  2UXB C;  3AF6 A;  1IBK C;  4LF4 C;  4LFB C;  1ZB9 A;  3J7A D;  1HNX C;  5LMU C;  1J5E C;  4K0K C;  4YHH C;  4DUZ C;  1XNQ C;  4X66 C;  3LUS A;  4AQY C;  2VQF C;  3R9X A;  4JI3 C;  4DR6 C;  2CY1 A;  5IWA C;  2HJG A;  3T1Y C;  4XX2 A;  4LF9 C;  4NOZ A;  4DR1 C;  4JI0 C;  4DR3 C;  3JAM D;  3GKU A;  4JI6 C;  4LF6 C;  3J81 D;  2E8F A;  1HNW C;  3CJE A;  4DCS A;  4DV1 C;  1USP A;  4DR2 C;  4LFA C;  2UUC C;  2VQE C;  1L2F A;  2KZF A;  1XMO C;  4NXM C;  2HHH C;  4DR7 C;  1N34 C;  4DCV A;  2E8C A;  4DR5 C;  1N36 C;  4JI5 C;  1PA4 A;  2E5L C;  1XNR C;  4X64 C;  3AF5 A;  2OPL A;  1USP B;  3IEU A;  3T1H C;  1KKG A;  2ASB A;  4LF7 C;  2UU9 C;  3EER A;  2BJO A;  4B3S C;  4X65 C;  2PT7 G;  2XR1 A;  4DV5 C;  4B3T C;  4DV4 C;  1IBL C;  1VLA A;  2ATW A;  1QWI A;  4X62 C;  5LMN C;  4NXN C;  4DUY C;  4DR4 C;  2UXD C;  4DCT A;  4JV5 C;  2F4V C;  4B3M C;  4JYA C;  4DV7 C;  5BR8 C;  4DV2 C;  1XMQ C;  4JI2 C;  2OPL B;  4GKK C;  2ZM6 C;  4JI1 C;  4MTN A;  4BSZ A;  4JI4 C;  4MH4 A;  1IBM C;  4YY3 C;  5IT9 D;  5FLX D;  3R9W A;  2UUA C;  1WH9 A;  4LF8 C;  2JMP A;  2PN2 A;  3OTO C;  2EGT A;  5A2Q D;  2E8E A;  1ML8 A;  4KHP C;  1N32 C;  4JI7 C;  1NYE A;  4GKJ C;  4DV6 C;  1MKY A;  2DYJ A;  1FJG C;  1HR0 C;  1HH2 P;  4OX9 C;  3J80 D;  2E7G A;  1I94 C;  1N33 C;  1WF3 A;  1LQL A;  1HNZ C;  3I07 A;  1K0R A;  2YCB A;  4LFC C;  4JI8 C;  1JOS A;  2CXC A;  4DCU A;  3IEV A;  2QL8 A;  2D7V A;  2UXC C;  2UUB C;  4B3R C;  2ONF A;  4LF5 C;  1ZB8 A;  4DV3 C;  4DV0 C;  1EGA A;  1UKK A; 
#chains in the Genus database with same CATH topology
 4DG8 A;  3C5E A;  2UXB C;  1IBK C;  3CW9 A;  5AE3 A;  4YHH C;  4D4I A;  5BUQ A;  3R9X A;  5BUR A;  1LCI A;  3TQI A;  4NOZ A;  4DR1 C;  4LF6 C;  3JAM D;  2P2Q A;  3CJE A;  3LNV A;  2P20 A;  1XMO C;  2WP0 C;  1N34 C;  4PHT A;  2E8C A;  1GPM A;  5BSW A;  2PRO A;  4R1M A;  3RG2 A;  2MMA B;  2D1Q A;  2KZ0 A;  3I08 A;  4X64 C;  5BSM A;  4DG9 A;  3AF5 A;  3IEU A;  2ASB A;  3DAY A;  5AE2 A;  4FUT A;  1PG3 A;  3H2T A;  2M5H A;  1P4E A;  4B3T C;  4PUH A;  3A25 A;  2ATW A;  2YWB A;  4DR4 C;  2F4V C;  5CZX A;  4B3M C;  2MM9 A;  5BR8 C;  5H9U A;  3L95 X;  4OXI A;  4KTT A;  4JI2 C;  1FLO A;  4MH4 A;  1MD9 A;  1IBM C;  3GR0 A;  4BCA A;  2D1T A;  2E0G A;  3R9W A;  2UUA C;  1WH9 A;  3ETO A;  5A2Q D;  3TUF A;  1NYE A;  2NCL A;  2YWC A;  2DYJ A;  4DV6 C;  2BH1 X;  1HR0 C;  4FTF A;  3J80 D;  4RMN A;  1I94 C;  1LQL A;  2P2J A;  4LFC C;  3TR3 A;  2QL8 A;  2D7V A;  2QVY X;  3A26 A;  2UUB C;  5A1G A;  2P2B A;  3PRO C;  2CU6 A;  1ZB8 A;  1UKK A;  2D1R A;  3IPL A;  2ZZN A;  3J7A D;  1HNX C;  1YGT A;  1IB8 A;  4RVN A;  2Y4N A;  3IML A;  1P7L A;  2D1S A;  5LMU C;  1J5E C;  1M6X C;  4K0K C;  5A19 A;  4X66 C;  3LUS A;  4ZJZ A;  2QW0 X;  4AQY C;  4JI3 C;  2HJG A;  4LF9 C;  4JI0 C;  3GKU A;  3NPD A;  1AMU A;  1HNW C;  1USP A;  5KEI A;  1L2F A;  4DCV A;  1UWD A;  4ZLP A;  3UX3 A;  1ULT A;  1O93 A;  1N36 C;  1O92 A;  3VNS A;  4JI5 C;  1XNR C;  1MXB A;  4GXR A;  2OPL A;  1USP B;  3NYR A;  3T1H C;  1KKG A;  2UU9 C;  2P02 A;  2BJO A;  3SO4 A;  4BC9 A;  3FCC A;  1QWI A;  4NXN C;  3NYQ A;  4PUG A;  3G7S A;  4DUY C;  3R44 A;  2UXD C;  3DLP X;  2DHM A;  1MXA A;  4JYA C;  2ZZM A;  4G1I A;  1XMQ C;  4GKK C;  2OPL B;  3CQ2 A;  4ODJ A;  3ETC A;  2ZM6 C;  4MTN A;  4RVO A;  4YY3 C;  2Y4O A;  2OO4 A;  4LF8 C;  3OTO C;  2EGT A;  1ML8 A;  4KHP C;  1N32 C;  4GKJ C;  4L4Q A;  2WD9 A;  3UX2 A;  1QM4 A;  5GTD A;  3UEB A;  1XDX A;  3PES A;  3EQ6 A;  3I07 A;  1K0R A;  5DV9 A;  4JI8 C;  2QVZ X;  3K6R A;  2OBV A;  3E7X A;  1RY2 A;  4ISB A;  1T5H X;  2VSQ A;  4LF5 C;  3VNR A;  2AYA A;  1EGA A;  1P4E C;  1YJ7 A;  4I9F A;  4FUQ A;  1V60 A;  1XRB A;  3DHV A;  4PRO C;  4DUZ C;  2VQF C;  5LCI A;  4DR6 C;  5IWA C;  3T1Y C;  1V26 A;  4JM1 A;  4BBY A;  3LAX A;  1MXC A;  2E8F A;  4DCS A;  2Y27 A;  4LFA C;  5BSR A;  3GPC A;  2VQE C;  2V7B A;  2HHH C;  4DR7 C;  1BA3 A;  4PUI A;  1M6X A;  3A9V A;  1PA4 A;  2MCQ A;  4U5Y D;  4D57 A;  4X65 C;  2PT7 G;  4RLF A;  4DV4 C;  3A9U A;  3FCE A;  4X62 C;  5BSU A;  1O90 A;  4JV5 C;  4K0B A;  2VZE A;  5KYT A;  3N2Q A;  4WV3 A;  4DV2 C;  1XRC A;  1MDB A;  5JRH A;  4JI1 C;  4L2Z A;  1RG9 A;  4JI4 C;  4GXQ A;  2M5O A;  3NI2 A;  5IT9 D;  4D4G A;  1XHJ A;  2JMP A;  1FUG A;  2PN2 A;  2E8E A;  4JI7 C;  3KXW A;  1MKY A;  3TDE A;  1FJG C;  3GR1 A;  4OX9 C;  5T8S A;  4I9G A;  5A1I A;  4LE5 A;  4GS5 A;  2YCB A;  3N54 B;  1MDF A;  1JOS A;  2JNV A;  2P2M A;  5T8T A;  3E7W A;  2ONF A;  4RM3 A;  4DV3 C;  4DR3 C;  2P2F A;  1N2F A;  3AF6 A;  4LF4 C;  4LFB C;  4PZP A;  1ZB9 A;  4G37 A;  1TH5 A;  1WCJ A;  2Z51 A;  4EAT A;  3UOW A;  3VNQ A;  3A4I A;  3UZ0 A;  1XNQ C;  3B7W A;  2CY1 A;  3FM7 A;  4D56 A;  3CQ3 A;  1XRA A;  4XX2 A;  4JI6 C;  5KYV A;  3J81 D;  3O2E A;  2DPL A;  3LNO A;  4DV1 C;  4DR2 C;  2UUC C;  5E7Q A;  3S82 A;  5IFI A;  5BSV A;  2KZF A;  3LGX A;  4NXM C;  3AY0 A;  4BC7 A;  5K85 A;  4DR5 C;  2E5L C;  3L8C A;  1V25 A;  1T5D X;  2YX1 A;  4NDN A;  4G36 A;  3RV2 A;  5ADZ A;  4LF7 C;  1NY8 A;  3EER A;  3CW8 X;  4B3S C;  4IR7 A;  2ZTB A;  4DV5 C;  2XR1 A;  1IBL C;  1VLA A;  1O9T A;  4TPS B;  5LMN C;  4KTV A;  1XS3 A;  4DCT A;  4DV7 C;  2QVX X;  4RM2 A;  4L7I A;  2PG1 E;  4BSZ A;  5AE1 A;  3CQ1 A;  5FLX D;  2D28 C;  4IZ6 A;  4HPV A;  2KDN A;  4R1L A;  5CZV A;  1HH2 P;  1PG4 A;  3PBK A;  2E7G A;  1N33 C;  1WF3 A;  1HNZ C;  2D27 A;  5BUS A;  5BST A;  4DCU A;  2CXC A;  1VEH A;  4RLQ A;  3IEV A;  1PU1 A;  4R0M A;  2UXC C;  4B3R C;  4WS9 A;  4OYC A;  5K8F A;  4DV0 C; 
#chains in the Genus database with same CATH homology
 4DG8 A;  3C5E A;  2UXB C;  1IBK C;  3CW9 A;  5AE3 A;  4YHH C;  4D4I A;  5BUQ A;  3R9X A;  5BUR A;  1LCI A;  3TQI A;  4NOZ A;  4DR1 C;  4LF6 C;  3JAM D;  2P2Q A;  3CJE A;  3LNV A;  2P20 A;  1XMO C;  2WP0 C;  1N34 C;  4PHT A;  2E8C A;  1GPM A;  5BSW A;  2PRO A;  4R1M A;  3RG2 A;  2D1Q A;  3I08 A;  4X64 C;  5BSM A;  4DG9 A;  3AF5 A;  3IEU A;  2ASB A;  3DAY A;  5AE2 A;  4FUT A;  1PG3 A;  3H2T A;  4B3T C;  2ATW A;  2YWB A;  4DR4 C;  2F4V C;  5CZX A;  4B3M C;  5BR8 C;  5H9U A;  3L95 X;  4OXI A;  4KTT A;  4JI2 C;  4MH4 A;  1MD9 A;  1IBM C;  3GR0 A;  4BCA A;  2D1T A;  2E0G A;  3R9W A;  2UUA C;  1WH9 A;  3ETO A;  5A2Q D;  3TUF A;  1NYE A;  2YWC A;  2DYJ A;  4DV6 C;  2BH1 X;  1HR0 C;  4FTF A;  3J80 D;  4RMN A;  1I94 C;  1LQL A;  2P2J A;  4LFC C;  2QL8 A;  2D7V A;  2QVY X;  2UUB C;  5A1G A;  2P2B A;  3PRO C;  1ZB8 A;  1UKK A;  2D1R A;  3IPL A;  3J7A D;  1HNX C;  4RVN A;  2Y4N A;  3IML A;  1P7L A;  2D1S A;  5LMU C;  1J5E C;  4K0K C;  5A19 A;  4X66 C;  3LUS A;  4ZJZ A;  2QW0 X;  4AQY C;  4JI3 C;  2HJG A;  4LF9 C;  4JI0 C;  3GKU A;  3NPD A;  1AMU A;  1HNW C;  1USP A;  5KEI A;  1L2F A;  4DCV A;  4ZLP A;  1ULT A;  1O93 A;  1N36 C;  1O92 A;  3VNS A;  4JI5 C;  1XNR C;  1MXB A;  4GXR A;  2OPL A;  1USP B;  3NYR A;  3T1H C;  1KKG A;  2UU9 C;  2P02 A;  2BJO A;  3SO4 A;  4BC9 A;  3FCC A;  1QWI A;  4NXN C;  3NYQ A;  3G7S A;  4DUY C;  3R44 A;  2UXD C;  3DLP X;  1MXA A;  4JYA C;  4G1I A;  1XMQ C;  4GKK C;  2OPL B;  4ODJ A;  3ETC A;  2ZM6 C;  4MTN A;  4RVO A;  4YY3 C;  2Y4O A;  2OO4 A;  4LF8 C;  3OTO C;  2EGT A;  1ML8 A;  4KHP C;  1N32 C;  4GKJ C;  4L4Q A;  2WD9 A;  1QM4 A;  5GTD A;  3PES A;  3EQ6 A;  3I07 A;  1K0R A;  5DV9 A;  4JI8 C;  2QVZ X;  2OBV A;  3E7X A;  1RY2 A;  4ISB A;  1T5H X;  2VSQ A;  4LF5 C;  3VNR A;  2AYA A;  1EGA A;  1YJ7 A;  4I9F A;  4FUQ A;  1XRB A;  3DHV A;  4PRO C;  4DUZ C;  2VQF C;  4DR6 C;  5IWA C;  3T1Y C;  1V26 A;  4JM1 A;  4BBY A;  3LAX A;  1MXC A;  2E8F A;  4DCS A;  2Y27 A;  4LFA C;  5BSR A;  3GPC A;  2VQE C;  2V7B A;  2HHH C;  4DR7 C;  1BA3 A;  3A9V A;  1PA4 A;  4U5Y D;  4D57 A;  4X65 C;  2PT7 G;  4RLF A;  4DV4 C;  3A9U A;  3FCE A;  4X62 C;  5BSU A;  1O90 A;  4JV5 C;  4K0B A;  2VZE A;  5KYT A;  3N2Q A;  4WV3 A;  4DV2 C;  1XRC A;  1MDB A;  5JRH A;  4JI1 C;  4L2Z A;  1RG9 A;  4JI4 C;  4GXQ A;  3NI2 A;  5IT9 D;  4D4G A;  2JMP A;  1FUG A;  2PN2 A;  2E8E A;  4JI7 C;  3KXW A;  1MKY A;  3TDE A;  1FJG C;  3GR1 A;  4OX9 C;  5T8S A;  4I9G A;  5A1I A;  4LE5 A;  4GS5 A;  2YCB A;  3N54 B;  1MDF A;  1JOS A;  2P2M A;  5T8T A;  3E7W A;  2ONF A;  4RM3 A;  4DV3 C;  4DR3 C;  2P2F A;  1N2F A;  3AF6 A;  4LF4 C;  4LFB C;  4PZP A;  1ZB9 A;  4G37 A;  4EAT A;  3UOW A;  3VNQ A;  3A4I A;  3UZ0 A;  1XNQ C;  3B7W A;  2CY1 A;  4D56 A;  1XRA A;  4XX2 A;  4JI6 C;  5KYV A;  3J81 D;  2DPL A;  4DV1 C;  4DR2 C;  2UUC C;  5E7Q A;  3S82 A;  5IFI A;  5BSV A;  2KZF A;  3LGX A;  4NXM C;  4BC7 A;  5K85 A;  4DR5 C;  2E5L C;  3L8C A;  1V25 A;  1T5D X;  4NDN A;  4G36 A;  3RV2 A;  5ADZ A;  4LF7 C;  3EER A;  3CW8 X;  4B3S C;  4IR7 A;  4DV5 C;  2XR1 A;  1IBL C;  1VLA A;  1O9T A;  4TPS B;  5LMN C;  4KTV A;  4DCT A;  4DV7 C;  2QVX X;  4RM2 A;  4L7I A;  4BSZ A;  5AE1 A;  5FLX D;  2D28 C;  4IZ6 A;  4HPV A;  4R1L A;  5CZV A;  1HH2 P;  1PG4 A;  3PBK A;  2E7G A;  1N33 C;  1WF3 A;  1HNZ C;  2D27 A;  5BUS A;  5BST A;  4DCU A;  2CXC A;  4RLQ A;  3IEV A;  4R0M A;  2UXC C;  4B3R C;  4WS9 A;  4OYC A;  5K8F A;  4DV0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...