2HHHC

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2hhhC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2hhhC02
2ATWA 2UXBC 4YHHC 4DR5C 4LF7C 3CJEA 4NOZA 4DR3C 1VLAA 4DCUA 2UUAC 1PA4A 2XR1A 4LF4C 4LF6C 4LF9C 2F4VC 5BR8C 3AF6A 4MTNA 1USPA 4DR7C 4JI1C 4B3TC 1N2FA 2ASBA 5LMUC 3GKUA 5IT9D 3T1HC 4NXNC 2E8CA 5IWAC 1XMQC 2YCBA 1N34C 1WF3A 2E7GA 2KZFA 4JI0C 4JI5C 4B3SC 4DCVA 3R9XA 4GKJC 2OPLA 2E8FA 3I07A 4YY3C 4JYAC 4NXMC 3AF5A 4DCTA 4LFCC 4B3RC 4X64C 4DCSA 1NYEA 4DV1C 4DUYC 3T1YC 4B3MC 4DR6C 4LFAC 4JV5C 2UXCC 1ZB8A 1IBMC 1WH9A 3IEVA 2PN2A 4BSZA 4X65C 4DV0C 3J80D 1HNXC 4JI2C 2VQFC 4JI4C 4DV2C 1HR0C 4DR4C 2UUBC 1ZB9A 4KHPC 4JI7C 1K0RA 4DV5C 2D7VA 1HH2P 4DR1C 3EERA 2UXDC 1QWIA 4JI8C 1MKYA 4JI3C 3JAMD 1XNRC 1N32C 1IBKC 2QL8A 1JOSA 2DYJA 1IBLC 2E5LC 4LFBC 4GKKC 1J5EC 4K0KC 2EGTA 1XMOC 4DUZC 1UKKA 1LQLA 2ZM6C 2ONFA 2CY1A 4DV3C 1N36C 4AQYC 1I94C 4X62C 4OX9C 3J7AD 5LMNC 2PT7G 3LUSA 2JMPA 3IEUA 1XNQC 2VQEC 2OPLB 4LF8C 4MH4A 3J81D 1KKGA 2CXCA 4LF5C 5FLXD 1HNWC 1ML8A 2HJGA 4XX2A 1HNZC 2UU9C 4JI6C 2E8EA 2BJOA 1EGAA 1USPB 1L2FA 3R9WA 1FJGC 4DV6C 2HHHC 1N33C 4X66C 4DV7C 3OTOC 4DR2C 5A2QD 4DV4C 2UUCC
chains in the Genus database with same CATH superfamily
2UXBC 2UUAC 1VLAA 4DCUA 2F4VC 1QM4A 4G36A 5BURA 2ZTBA 5IWAC 2YCBA 5E7QA 5T8SA 3DLPX 4B3SC 4BC7A 4I9GA 3AF5A 1M6XA 2QVYX 2V7BA 3T1YC 1RY2A 4DR6C 4GXRA 1ZB8A 1IBMC 1TH5A 3CW8X 2PN2A 1LCIA 2P2QA 2P20A 4PUIA 3N54B 5BSWA 2M5OA 3NYQA 4D57A 4DV5C 2D7VA 4DR1C 2P2MA 4JI8C 3CW9A 4RM3A 4LE5A 1IBKC 1XS3A 2QL8A 3LAXA 4LFBC 1V26A 1XRAA 3L8CA 3KXWA 4IZ6A 3E7WA 4AQYC 4I9FA 1MDFA 4MH4A 1WCJA 1O93A 5FLXD 1HNWC 2E8EA 1FLOA 4ZJZA 5KYVA 3A4IA 4R0MA 2HHHC 5A1IA 4HPVA 2QVZX 2UUCC 3B7WA 4YHHC 4LF7C 4NOZA 4DR3C 4LF9C 4MTNA 3NPDA 5BSMA 2KZ0A 4BCAA 4DR7C 4JI1C 5LCIA 1MXAA 2D1TA 3GKUA 2DPLA 2ZZMA 2QW0X 2E8CA 2D1RA 2OO4A 3AY0A 4GKJC 5AE1A 4BBYA 4IR7A 2MCQA 3GPCA 4JYAC 2KDNA 4R1MA 2M5HA 4DCTA 2CU6A 4LFCC 4X64C 4DUYC 3NYRA 4B3MC 4RLFA 4GXQA 1VEHA 3TDEA 4EATA 3CQ1A 3RV2A 3A25A 5CZXA 4WS9A 4JM1A 3C5EA 4DV0C 3J80D 1T5HX 2WP0C 4RVOA 4JI2C 3UOWA 4DV2C 5K85A 1HR0C 4DR4C 4RM2A 4OYCA 1K0RA 2D27A 1HH2P 2P02A 1GPMA 2P2BA 1XHJA 5H9UA 3R44A 5JRHA 1J5EC 2D1SA 4K0KC 3RG2A 3K6RA 5ADZA 3O2EA 1UKKA 1P7LA 2CY1A 2ONFA 4DV3C 3EQ6A 1I94C 4D4GA 1FUGA 4L4QA 1XDXA 1T5DX 3LUSA 3IEUA 1P4EC 2VQEC 2OPLB 4LF8C 3J81D 1KKGA 2CXCA 3IMLA 2Y27A 3I08A 4XX2A 1ULTA 3G7SA 2BJOA 4PUGA 3SO4A 1L2FA 4D4IA 3A9VA 2BH1X 4DV6C 1IB8A 3UX3A 5GTDA 1N33C 4X66C 5KEIA 1XRBA 4OXIA 2ATWA 4DR5C 3CJEA 4LF4C 1PA4A 2XR1A 2Y4OA 3H2TA 5BR8C 3AF6A 4PUHA 2E0GA 1O92A 2MMAB 2JNVA 1N2FA 5LMUC 2YWBA 3L95X 2PROA 1MXCA 2NCLA 1N34C 4RVNA 3N2QA 4JI0C 3FCEA 3R9XA 4PHTA 3GR0A 2E8FA 3I07A 3LGXA 3IPLA 4B3RC 3DAYA 2VZEA 4DCSA 4KTTA 2ZZNA 3IEVA 3LNOA 1XRCA 4X65C 5DV9A 3GR1A 2VQFC 4JI4C 3UZ0A 1ZB9A 4KHPC 2PG1E 5K8FA 1BA3A 2UXDC 3CQ2A 1QWIA 1MKYA 1JOSA 4FUTA 4GKKC 5KYTA 3PBKA 2Y4NA 5BSUA 1PU1A 3PESA 5IFIA 1M6XC 4ODJA 4K0BA 2MM9A 1MXBA 4U5YD 5BUQA 4DG8A 4NDNA 4OX9C 3J7AD 5T8TA 1MDBA 4L7IA 2PT7G 2JMPA 5BUSA 5BSRA 2AYAA 2HJGA 1HNZC 4D56A 4JI6C 4G37A 2P2JA 3FM7A 1USPB 5CZVA 3R9WA 2YX1A 1V25A 4ZLPA 5A1GA 3A26A 4DV7C 1V60A 2VSQA 4GS5A 4DV4C 3VNQA 1PG4A 3ETCA 4LF6C 3A9UA 4FTFA 4L2ZA 2DHMA 3UX2A 1USPA 4FUQA 4B3TC 4KTVA 5IT9D 3T1HC 4NXNC 1XMQC 1WF3A 2E7GA 3CQ3A 2KZFA 2OBVA 3NI2A 4JI5C 4G1IA 4DCVA 1AMUA 5AE2A 2OPLA 2D1QA 4YY3C 4NXMC 3S82A 1NYEA 4DV1C 3E7XA 4LFAC 4JV5C 2UXCC 3LNVA 1WH9A 1P4EA 5BSVA 1RG9A 4BSZA 4WV3A 5AE3A 3VNSA 1HNXC 4BC9A 1PG3A 5BSTA 4DG9A 2D28C 3ETOA 2UUBC 4JI7C 1NY8A 3TUFA 3EERA 4JI3C 3JAMD 1YJ7A 3VNRA 1XNRC 1N32C 2Z51A 1IBLC 2DYJA 2E5LC 1O90A 4PROC 2EGTA 4R1LA 1XMOC 3TR3A 4DUZC 4ISBA 4RLQA 1LQLA 2ZM6C 1N36C 4X62C 4RMNA 4PZPA 5LMNC 1UWDA 1YGTA 1XNQC 2YWCA 3UEBA 4LF5C 1ML8A 2UU9C 3PROC 3TQIA 2P2FA 1EGAA 2QVXX 1O9TA 3DHVA 2WD9A 1FJGC 5A19A 3FCCA 3OTOC 1MD9A 4DR2C 4TPSB 5A2QD 2ASBA
chains in the Genus database with same CATH topology
2UXBC 2UUAC 1VLAA 4DCUA 2F4VC 1QM4A 4G36A 5BURA 5IWAC 2YCBA 5E7QA 5T8SA 3DLPX 4B3SC 4BC7A 4I9GA 3AF5A 2QVYX 2V7BA 3T1YC 1RY2A 4DR6C 4GXRA 1ZB8A 1IBMC 3CW8X 2PN2A 1LCIA 2P2QA 2P20A 3N54B 5BSWA 3NYQA 4D57A 4DV5C 2D7VA 4DR1C 2P2MA 4JI8C 3CW9A 4RM3A 4LE5A 1IBKC 2QL8A 3LAXA 4LFBC 1V26A 1XRAA 3L8CA 3KXWA 4IZ6A 3E7WA 4AQYC 4I9FA 1MDFA 4MH4A 1O93A 5FLXD 1HNWC 2E8EA 4ZJZA 5KYVA 3A4IA 4R0MA 2HHHC 5A1IA 4HPVA 2QVZX 2UUCC 3B7WA 4YHHC 4LF7C 4NOZA 4DR3C 4LF9C 4MTNA 3NPDA 5BSMA 4BCAA 4DR7C 4JI1C 1MXAA 2D1TA 3GKUA 2DPLA 2QW0X 2E8CA 2D1RA 2OO4A 4GKJC 5AE1A 4BBYA 4IR7A 3GPCA 4JYAC 4R1MA 4DCTA 4LFCC 4X64C 4DUYC 3NYRA 4B3MC 4RLFA 4GXQA 3TDEA 4EATA 3RV2A 5CZXA 4WS9A 4JM1A 3C5EA 4DV0C 3J80D 1T5HX 2WP0C 4RVOA 4JI2C 3UOWA 4DV2C 5K85A 1HR0C 4DR4C 4RM2A 4OYCA 1K0RA 2D27A 1HH2P 2P02A 1GPMA 2P2BA 5H9UA 3R44A 5JRHA 1J5EC 2D1SA 4K0KC 3RG2A 5ADZA 1UKKA 1P7LA 2CY1A 2ONFA 4DV3C 3EQ6A 1I94C 4D4GA 1FUGA 4L4QA 1T5DX 3LUSA 3IEUA 2VQEC 2OPLB 4LF8C 3J81D 1KKGA 2CXCA 3IMLA 2Y27A 3I08A 4XX2A 1ULTA 3G7SA 2BJOA 3SO4A 1L2FA 4D4IA 3A9VA 2BH1X 4DV6C 5GTDA 1N33C 4X66C 5KEIA 1XRBA 4OXIA 2ATWA 4DR5C 3CJEA 4LF4C 1PA4A 2XR1A 2Y4OA 3H2TA 5BR8C 3AF6A 2E0GA 1O92A 1N2FA 5LMUC 2YWBA 3L95X 2PROA 1MXCA 1N34C 4RVNA 3N2QA 4JI0C 3FCEA 3R9XA 4PHTA 3GR0A 2E8FA 3I07A 3LGXA 3IPLA 4B3RC 3DAYA 2VZEA 4DCSA 4KTTA 3IEVA 1XRCA 4X65C 5DV9A 3GR1A 2VQFC 4JI4C 3UZ0A 1ZB9A 4KHPC 5K8FA 1BA3A 2UXDC 1QWIA 1MKYA 1JOSA 4FUTA 4GKKC 5KYTA 3PBKA 2Y4NA 5BSUA 3PESA 5IFIA 4ODJA 4K0BA 1MXBA 4U5YD 5BUQA 4DG8A 4NDNA 4OX9C 3J7AD 5T8TA 1MDBA 4L7IA 2PT7G 2JMPA 5BUSA 5BSRA 2AYAA 2HJGA 1HNZC 4D56A 4JI6C 4G37A 2P2JA 1USPB 5CZVA 3R9WA 1V25A 4ZLPA 5A1GA 4DV7C 2VSQA 4GS5A 4DV4C 3VNQA 1PG4A 3ETCA 4LF6C 3A9UA 4FTFA 4L2ZA 1USPA 4FUQA 4B3TC 4KTVA 5IT9D 3T1HC 4NXNC 1XMQC 1WF3A 2E7GA 2KZFA 2OBVA 3NI2A 4JI5C 4G1IA 4DCVA 1AMUA 5AE2A 2OPLA 2D1QA 4YY3C 4NXMC 3S82A 1NYEA 4DV1C 3E7XA 4LFAC 4JV5C 2UXCC 3LNVA 1WH9A 5BSVA 1RG9A 4BSZA 4WV3A 5AE3A 3VNSA 1HNXC 4BC9A 1PG3A 5BSTA 4DG9A 2D28C 3ETOA 2UUBC 4JI7C 3TUFA 3EERA 4JI3C 3JAMD 1YJ7A 3VNRA 1XNRC 1N32C 1IBLC 2DYJA 2E5LC 1O90A 4PROC 2EGTA 4R1LA 1XMOC 4DUZC 4ISBA 4RLQA 1LQLA 2ZM6C 1N36C 4X62C 4RMNA 5LMNC 4PZPA 1XNQC 2YWCA 4LF5C 1ML8A 2UU9C 3PROC 3TQIA 2P2FA 1EGAA 2QVXX 1O9TA 3DHVA 2WD9A 1FJGC 5A19A 3FCCA 3OTOC 1MD9A 4DR2C 4TPSB 5A2QD 2ASBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATW A;  2UXB C;  4YHH C;  4DR5 C;  4LF7 C;  3CJE A;  4NOZ A;  4DR3 C;  1VLA A;  4DCU A;  2UUA C;  1PA4 A;  2XR1 A;  4LF4 C;  4LF6 C;  4LF9 C;  2F4V C;  5BR8 C;  3AF6 A;  4MTN A;  1USP A;  4DR7 C;  4JI1 C;  4B3T C;  1N2F A;  2ASB A;  5LMU C;  3GKU A;  5IT9 D;  3T1H C;  4NXN C;  2E8C A;  5IWA C;  1XMQ C;  2YCB A;  1N34 C;  1WF3 A;  2E7G A;  2KZF A;  4JI0 C;  4JI5 C;  4B3S C;  4DCV A;  3R9X A;  4GKJ C;  2OPL A;  2E8F A;  3I07 A;  4YY3 C;  4JYA C;  4NXM C;  3AF5 A;  4DCT A;  4LFC C;  4B3R C;  4X64 C;  4DCS A;  1NYE A;  4DV1 C;  4DUY C;  3T1Y C;  4B3M C;  4DR6 C;  4LFA C;  4JV5 C;  2UXC C;  1ZB8 A;  1IBM C;  1WH9 A;  3IEV A;  2PN2 A;  4BSZ A;  4X65 C;  4DV0 C;  3J80 D;  1HNX C;  4JI2 C;  2VQF C;  4JI4 C;  4DV2 C;  1HR0 C;  4DR4 C;  2UUB C;  1ZB9 A;  4KHP C;  4JI7 C;  1K0R A;  4DV5 C;  2D7V A;  1HH2 P;  4DR1 C;  3EER A;  2UXD C;  1QWI A;  4JI8 C;  1MKY A;  4JI3 C;  3JAM D;  1XNR C;  1N32 C;  1IBK C;  2QL8 A;  1JOS A;  2DYJ A;  1IBL C;  2E5L C;  4LFB C;  4GKK C;  1J5E C;  4K0K C;  2EGT A;  1XMO C;  4DUZ C;  1UKK A;  1LQL A;  2ZM6 C;  2ONF A;  2CY1 A;  4DV3 C;  1N36 C;  4AQY C;  1I94 C;  4X62 C;  4OX9 C;  3J7A D;  5LMN C;  2PT7 G;  3LUS A;  2JMP A;  3IEU A;  1XNQ C;  2VQE C;  2OPL B;  4LF8 C;  4MH4 A;  3J81 D;  1KKG A;  2CXC A;  4LF5 C;  5FLX D;  1HNW C;  1ML8 A;  2HJG A;  4XX2 A;  1HNZ C;  2UU9 C;  4JI6 C;  2E8E A;  2BJO A;  1EGA A;  1USP B;  1L2F A;  3R9W A;  1FJG C;  4DV6 C;  2HHH C;  1N33 C;  4X66 C;  4DV7 C;  3OTO C;  4DR2 C;  5A2Q D;  4DV4 C;  2UUC C; 
#chains in the Genus database with same CATH topology
 2UXB C;  2UUA C;  1VLA A;  4DCU A;  2F4V C;  1QM4 A;  4G36 A;  5BUR A;  2ZTB A;  5IWA C;  2YCB A;  5E7Q A;  5T8S A;  3DLP X;  4B3S C;  4BC7 A;  4I9G A;  3AF5 A;  1M6X A;  2QVY X;  2V7B A;  3T1Y C;  1RY2 A;  4DR6 C;  4GXR A;  1ZB8 A;  1IBM C;  1TH5 A;  3CW8 X;  2PN2 A;  1LCI A;  2P2Q A;  2P20 A;  4PUI A;  3N54 B;  5BSW A;  2M5O A;  3NYQ A;  4D57 A;  4DV5 C;  2D7V A;  4DR1 C;  2P2M A;  4JI8 C;  3CW9 A;  4RM3 A;  4LE5 A;  1IBK C;  1XS3 A;  2QL8 A;  3LAX A;  4LFB C;  1V26 A;  1XRA A;  3L8C A;  3KXW A;  4IZ6 A;  3E7W A;  4AQY C;  4I9F A;  1MDF A;  4MH4 A;  1WCJ A;  1O93 A;  5FLX D;  1HNW C;  2E8E A;  1FLO A;  4ZJZ A;  5KYV A;  3A4I A;  4R0M A;  2HHH C;  5A1I A;  4HPV A;  2QVZ X;  2UUC C;  3B7W A;  4YHH C;  4LF7 C;  4NOZ A;  4DR3 C;  4LF9 C;  4MTN A;  3NPD A;  5BSM A;  2KZ0 A;  4BCA A;  4DR7 C;  4JI1 C;  5LCI A;  1MXA A;  2D1T A;  3GKU A;  2DPL A;  2ZZM A;  2QW0 X;  2E8C A;  2D1R A;  2OO4 A;  3AY0 A;  4GKJ C;  5AE1 A;  4BBY A;  4IR7 A;  2MCQ A;  3GPC A;  4JYA C;  2KDN A;  4R1M A;  2M5H A;  4DCT A;  2CU6 A;  4LFC C;  4X64 C;  4DUY C;  3NYR A;  4B3M C;  4RLF A;  4GXQ A;  1VEH A;  3TDE A;  4EAT A;  3CQ1 A;  3RV2 A;  3A25 A;  5CZX A;  4WS9 A;  4JM1 A;  3C5E A;  4DV0 C;  3J80 D;  1T5H X;  2WP0 C;  4RVO A;  4JI2 C;  3UOW A;  4DV2 C;  5K85 A;  1HR0 C;  4DR4 C;  4RM2 A;  4OYC A;  1K0R A;  2D27 A;  1HH2 P;  2P02 A;  1GPM A;  2P2B A;  1XHJ A;  5H9U A;  3R44 A;  5JRH A;  1J5E C;  2D1S A;  4K0K C;  3RG2 A;  3K6R A;  5ADZ A;  3O2E A;  1UKK A;  1P7L A;  2CY1 A;  2ONF A;  4DV3 C;  3EQ6 A;  1I94 C;  4D4G A;  1FUG A;  4L4Q A;  1XDX A;  1T5D X;  3LUS A;  3IEU A;  1P4E C;  2VQE C;  2OPL B;  4LF8 C;  3J81 D;  1KKG A;  2CXC A;  3IML A;  2Y27 A;  3I08 A;  4XX2 A;  1ULT A;  3G7S A;  2BJO A;  4PUG A;  3SO4 A;  1L2F A;  4D4I A;  3A9V A;  2BH1 X;  4DV6 C;  1IB8 A;  3UX3 A;  5GTD A;  1N33 C;  4X66 C;  5KEI A;  1XRB A;  4OXI A;  2ATW A;  4DR5 C;  3CJE A;  4LF4 C;  1PA4 A;  2XR1 A;  2Y4O A;  3H2T A;  5BR8 C;  3AF6 A;  4PUH A;  2E0G A;  1O92 A;  2MMA B;  2JNV A;  1N2F A;  5LMU C;  2YWB A;  3L95 X;  2PRO A;  1MXC A;  2NCL A;  1N34 C;  4RVN A;  3N2Q A;  4JI0 C;  3FCE A;  3R9X A;  4PHT A;  3GR0 A;  2E8F A;  3I07 A;  3LGX A;  3IPL A;  4B3R C;  3DAY A;  2VZE A;  4DCS A;  4KTT A;  2ZZN A;  3IEV A;  3LNO A;  1XRC A;  4X65 C;  5DV9 A;  3GR1 A;  2VQF C;  4JI4 C;  3UZ0 A;  1ZB9 A;  4KHP C;  2PG1 E;  5K8F A;  1BA3 A;  2UXD C;  3CQ2 A;  1QWI A;  1MKY A;  1JOS A;  4FUT A;  4GKK C;  5KYT A;  3PBK A;  2Y4N A;  5BSU A;  1PU1 A;  3PES A;  5IFI A;  1M6X C;  4ODJ A;  4K0B A;  2MM9 A;  1MXB A;  4U5Y D;  5BUQ A;  4DG8 A;  4NDN A;  4OX9 C;  3J7A D;  5T8T A;  1MDB A;  4L7I A;  2PT7 G;  2JMP A;  5BUS A;  5BSR A;  2AYA A;  2HJG A;  1HNZ C;  4D56 A;  4JI6 C;  4G37 A;  2P2J A;  3FM7 A;  1USP B;  5CZV A;  3R9W A;  2YX1 A;  1V25 A;  4ZLP A;  5A1G A;  3A26 A;  4DV7 C;  1V60 A;  2VSQ A;  4GS5 A;  4DV4 C;  3VNQ A;  1PG4 A;  3ETC A;  4LF6 C;  3A9U A;  4FTF A;  4L2Z A;  2DHM A;  3UX2 A;  1USP A;  4FUQ A;  4B3T C;  4KTV A;  5IT9 D;  3T1H C;  4NXN C;  1XMQ C;  1WF3 A;  2E7G A;  3CQ3 A;  2KZF A;  2OBV A;  3NI2 A;  4JI5 C;  4G1I A;  4DCV A;  1AMU A;  5AE2 A;  2OPL A;  2D1Q A;  4YY3 C;  4NXM C;  3S82 A;  1NYE A;  4DV1 C;  3E7X A;  4LFA C;  4JV5 C;  2UXC C;  3LNV A;  1WH9 A;  1P4E A;  5BSV A;  1RG9 A;  4BSZ A;  4WV3 A;  5AE3 A;  3VNS A;  1HNX C;  4BC9 A;  1PG3 A;  5BST A;  4DG9 A;  2D28 C;  3ETO A;  2UUB C;  4JI7 C;  1NY8 A;  3TUF A;  3EER A;  4JI3 C;  3JAM D;  1YJ7 A;  3VNR A;  1XNR C;  1N32 C;  2Z51 A;  1IBL C;  2DYJ A;  2E5L C;  1O90 A;  4PRO C;  2EGT A;  4R1L A;  1XMO C;  3TR3 A;  4DUZ C;  4ISB A;  4RLQ A;  1LQL A;  2ZM6 C;  1N36 C;  4X62 C;  4RMN A;  4PZP A;  5LMN C;  1UWD A;  1YGT A;  1XNQ C;  2YWC A;  3UEB A;  4LF5 C;  1ML8 A;  2UU9 C;  3PRO C;  3TQI A;  2P2F A;  1EGA A;  2QVX X;  1O9T A;  3DHV A;  2WD9 A;  1FJG C;  5A19 A;  3FCC A;  3OTO C;  1MD9 A;  4DR2 C;  4TPS B;  5A2Q D;  2ASB A; 
#chains in the Genus database with same CATH homology
 2UXB C;  2UUA C;  1VLA A;  4DCU A;  2F4V C;  1QM4 A;  4G36 A;  5BUR A;  5IWA C;  2YCB A;  5E7Q A;  5T8S A;  3DLP X;  4B3S C;  4BC7 A;  4I9G A;  3AF5 A;  2QVY X;  2V7B A;  3T1Y C;  1RY2 A;  4DR6 C;  4GXR A;  1ZB8 A;  1IBM C;  3CW8 X;  2PN2 A;  1LCI A;  2P2Q A;  2P20 A;  3N54 B;  5BSW A;  3NYQ A;  4D57 A;  4DV5 C;  2D7V A;  4DR1 C;  2P2M A;  4JI8 C;  3CW9 A;  4RM3 A;  4LE5 A;  1IBK C;  2QL8 A;  3LAX A;  4LFB C;  1V26 A;  1XRA A;  3L8C A;  3KXW A;  4IZ6 A;  3E7W A;  4AQY C;  4I9F A;  1MDF A;  4MH4 A;  1O93 A;  5FLX D;  1HNW C;  2E8E A;  4ZJZ A;  5KYV A;  3A4I A;  4R0M A;  2HHH C;  5A1I A;  4HPV A;  2QVZ X;  2UUC C;  3B7W A;  4YHH C;  4LF7 C;  4NOZ A;  4DR3 C;  4LF9 C;  4MTN A;  3NPD A;  5BSM A;  4BCA A;  4DR7 C;  4JI1 C;  1MXA A;  2D1T A;  3GKU A;  2DPL A;  2QW0 X;  2E8C A;  2D1R A;  2OO4 A;  4GKJ C;  5AE1 A;  4BBY A;  4IR7 A;  3GPC A;  4JYA C;  4R1M A;  4DCT A;  4LFC C;  4X64 C;  4DUY C;  3NYR A;  4B3M C;  4RLF A;  4GXQ A;  3TDE A;  4EAT A;  3RV2 A;  5CZX A;  4WS9 A;  4JM1 A;  3C5E A;  4DV0 C;  3J80 D;  1T5H X;  2WP0 C;  4RVO A;  4JI2 C;  3UOW A;  4DV2 C;  5K85 A;  1HR0 C;  4DR4 C;  4RM2 A;  4OYC A;  1K0R A;  2D27 A;  1HH2 P;  2P02 A;  1GPM A;  2P2B A;  5H9U A;  3R44 A;  5JRH A;  1J5E C;  2D1S A;  4K0K C;  3RG2 A;  5ADZ A;  1UKK A;  1P7L A;  2CY1 A;  2ONF A;  4DV3 C;  3EQ6 A;  1I94 C;  4D4G A;  1FUG A;  4L4Q A;  1T5D X;  3LUS A;  3IEU A;  2VQE C;  2OPL B;  4LF8 C;  3J81 D;  1KKG A;  2CXC A;  3IML A;  2Y27 A;  3I08 A;  4XX2 A;  1ULT A;  3G7S A;  2BJO A;  3SO4 A;  1L2F A;  4D4I A;  3A9V A;  2BH1 X;  4DV6 C;  5GTD A;  1N33 C;  4X66 C;  5KEI A;  1XRB A;  4OXI A;  2ATW A;  4DR5 C;  3CJE A;  4LF4 C;  1PA4 A;  2XR1 A;  2Y4O A;  3H2T A;  5BR8 C;  3AF6 A;  2E0G A;  1O92 A;  1N2F A;  5LMU C;  2YWB A;  3L95 X;  2PRO A;  1MXC A;  1N34 C;  4RVN A;  3N2Q A;  4JI0 C;  3FCE A;  3R9X A;  4PHT A;  3GR0 A;  2E8F A;  3I07 A;  3LGX A;  3IPL A;  4B3R C;  3DAY A;  2VZE A;  4DCS A;  4KTT A;  3IEV A;  1XRC A;  4X65 C;  5DV9 A;  3GR1 A;  2VQF C;  4JI4 C;  3UZ0 A;  1ZB9 A;  4KHP C;  5K8F A;  1BA3 A;  2UXD C;  1QWI A;  1MKY A;  1JOS A;  4FUT A;  4GKK C;  5KYT A;  3PBK A;  2Y4N A;  5BSU A;  3PES A;  5IFI A;  4ODJ A;  4K0B A;  1MXB A;  4U5Y D;  5BUQ A;  4DG8 A;  4NDN A;  4OX9 C;  3J7A D;  5T8T A;  1MDB A;  4L7I A;  2PT7 G;  2JMP A;  5BUS A;  5BSR A;  2AYA A;  2HJG A;  1HNZ C;  4D56 A;  4JI6 C;  4G37 A;  2P2J A;  1USP B;  5CZV A;  3R9W A;  1V25 A;  4ZLP A;  5A1G A;  4DV7 C;  2VSQ A;  4GS5 A;  4DV4 C;  3VNQ A;  1PG4 A;  3ETC A;  4LF6 C;  3A9U A;  4FTF A;  4L2Z A;  1USP A;  4FUQ A;  4B3T C;  4KTV A;  5IT9 D;  3T1H C;  4NXN C;  1XMQ C;  1WF3 A;  2E7G A;  2KZF A;  2OBV A;  3NI2 A;  4JI5 C;  4G1I A;  4DCV A;  1AMU A;  5AE2 A;  2OPL A;  2D1Q A;  4YY3 C;  4NXM C;  3S82 A;  1NYE A;  4DV1 C;  3E7X A;  4LFA C;  4JV5 C;  2UXC C;  3LNV A;  1WH9 A;  5BSV A;  1RG9 A;  4BSZ A;  4WV3 A;  5AE3 A;  3VNS A;  1HNX C;  4BC9 A;  1PG3 A;  5BST A;  4DG9 A;  2D28 C;  3ETO A;  2UUB C;  4JI7 C;  3TUF A;  3EER A;  4JI3 C;  3JAM D;  1YJ7 A;  3VNR A;  1XNR C;  1N32 C;  1IBL C;  2DYJ A;  2E5L C;  1O90 A;  4PRO C;  2EGT A;  4R1L A;  1XMO C;  4DUZ C;  4ISB A;  4RLQ A;  1LQL A;  2ZM6 C;  1N36 C;  4X62 C;  4RMN A;  5LMN C;  4PZP A;  1XNQ C;  2YWC A;  4LF5 C;  1ML8 A;  2UU9 C;  3PRO C;  3TQI A;  2P2F A;  1EGA A;  2QVX X;  1O9T A;  3DHV A;  2WD9 A;  1FJG C;  5A19 A;  3FCC A;  3OTO C;  1MD9 A;  4DR2 C;  4TPS B;  5A2Q D;  2ASB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...