2HHHC

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2hhhC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2hhhC02
1VLAA 3R9WA 4DCTA 4AQYC 3T1YC 1LQLA 4X66C 1XMOC 1IBKC 1I94C 3OTOC 3LUSA 5A2QD 4DV1C 4JI2C 1USPB 1EGAA 5BR8C 2E8FA 4KHPC 2CXCA 1ZB9A 2UUAC 4B3RC 3CJEA 4NXMC 2YCBA 2UU9C 4DCUA 4JI6C 3GKUA 1HNZC 4JI5C 1FJGC 4JI0C 3EERA 4DCSA 4LF8C 2E8EA 3AF5A 4X64C 1IBMC 3J81D 2E5LC 4DV3C 2PT7G 1HR0C 2UUCC 2KZFA 4JI7C 2JMPA 1MKYA 4K0KC 4B3MC 1XNRC 2UUBC 3T1HC 4X65C 4YY3C 4MH4A 1J5EC 2ZM6C 5LMUC 1QWIA 4BSZA 2QL8A 2ATWA 4DV5C 4LFCC 2D7VA 4JV5C 1XMQC 2E8CA 4OX9C 1JOSA 4DR6C 1N34C 2DYJA 4DV0C 1WH9A 2CY1A 5FLXD 4JI1C 4LF6C 1XNQC 2VQFC 4LFAC 2ONFA 2PN2A 4LF9C 2ASBA 1ZB8A 1IBLC 1USPA 4DR7C 4NXNC 4DV2C 3I07A 1ML8A 4XX2A 4B3SC 1HH2P 3AF6A 1HNWC 1N32C 5IT9D 1UKKA 2UXBC 4B3TC 2E7GA 4LF7C 2OPLB 2VQEC 4LF5C 2F4VC 1L2FA 4DR2C 3IEUA 4LFBC 4MTNA 4DR4C 1N36C 4GKKC 1KKGA 4DR5C 4JI4C 1N33C 2XR1A 4DV6C 4DV4C 1K0RA 3J80D 2UXDC 5IWAC 3J7AD 3IEVA 4DR3C 4X62C 5LMNC 1NYEA 2EGTA 1HNXC 2HJGA 3JAMD 4GKJC 2UXCC 4JI8C 4DCVA 4DUZC 2HHHC 1PA4A 4LF4C 4JYAC 2OPLA 2BJOA 1N2FA 1WF3A 4JI3C 4DUYC 3R9XA 4DV7C 4YHHC 4NOZA 4DR1C
chains in the Genus database with same CATH superfamily
4ISBA 3R9WA 4DCTA 3T1YC 1LQLA 5AE2A 4LE5A 4PUIA 4KHPC 2UUAC 1ZB9A 2Z51A 4B3RC 3CJEA 2D1SA 1XRBA 5KYTA 1TH5A 2JNVA 2P2QA 5BSWA 3GKUA 1AMUA 1FJGC 3DHVA 3EERA 2YWCA 2E8EA 2E5LC 4R1MA 3J81D 4DV3C 2D27A 4BC9A 4RM2A 2DHMA 4B3MC 5K8FA 2ZM6C 1ULTA 2MM9A 5T8TA 5LMUC 4BC7A 3NYQA 1XS3A 4PROC 4L2ZA 3PBKA 2E8CA 5BSTA 2CY1A 2M5OA 1UWDA 4LF6C 4LFAC 4K0BA 2Y27A 2ONFA 4LF9C 1XDXA 4BBYA 1USPA 2BH1X 4DR7C 4NXNC 3E7XA 4XX2A 1O93A 5JRHA 2YX1A 4R0MA 2UXBC 4LF5C 5A1GA 4I9FA 2M5HA 2WD9A 3K6RA 4MTNA 4GS5A 4TPSB 2ZTBA 1V60A 1KKGA 2UXDC 3CW8X 5IWAC 3J7AD 4RVNA 3IEVA 2HJGA 2UXCC 4ODJA 4DUZC 5BUSA 4JYAC 1GPMA 4RVOA 1NY8A 1WF3A 1XHJA 5E7QA 3O2EA 4DV7C 3TQIA 4NOZA 4PHTA 5BSVA 2VZEA 4GXQA 4WS9A 1EGAA 3H2TA 5BR8C 5BURA 3IPLA 4R1LA 2YCBA 3NYRA 2UU9C 4DCUA 4JI0C 4LF8C 4X64C 2UUCC 2JMPA 2QW0X 3EQ6A 2Y4NA 1MKYA 1YJ7A 4D57A 2UUBC 2D1QA 3A9VA 1V26A 3T1HC 5AE3A 4RLQA 1PU1A 4BSZA 5H9UA 4OX9C 1JOSA 1V25A 3UEBA 1P4EC 4DV0C 3L95X 3DLPX 1XRCA 3A25A 5DV9A 2KZ0A 1IBLC 4WV3A 3A4IA 1O9TA 3A26A 4RMNA 4DV2C 3I07A 4G36A 2QVYX 3LGXA 2KDNA 5IT9D 4PZPA 5A1IA 4L7IA 1P4EA 3E7WA 2OPLB 2F4VC 1L2FA 3IEUA 4EATA 1YGTA 4LFBC 3TDEA 3I08A 4RM3A 4JI4C 2D1TA 1N33C 4DV4C 1T5HX 2CU6A 2EGTA 4OXIA 3RV2A 2P2JA 3JAMD 3VNQA 4JI8C 1PG3A 5A19A 1PA4A 4LF4C 5CZXA 4KTVA 2OPLA 2YWBA 3ETCA 2BJOA 4JI3C 3C5EA 4DUYC 4DR1C 1VLAA 2QVXX 4AQYC 1XMOC 4X66C 2PG1E 2D1RA 3LUSA 3NPDA 4JI2C 4PUGA 1MDBA 3FCEA 2CXCA 5AE1A 3GPCA 4JM1A 1BA3A 2E0GA 2NCLA 4JI6C 1P7LA 1HNZC 4JI5C 3TR3A 1MXCA 5K85A 5IFIA 1IBMC 2PT7G 1HR0C 4JI7C 4FUTA 3UX3A 1XNRC 2Y4OA 1MXBA 3LNOA 5BSRA 2D28C 2QL8A 2ATWA 3PESA 3VNRA 4HPVA 4JV5C 4KTTA 4DR6C 3G7SA 2DYJA 4IR7A 1WH9A 3SO4A 5KEIA 2PROA 1XNQC 2VSQA 3CW9A 2ASBA 1ZB8A 2OBVA 1FUGA 2AYAA 4U5YD 1HNWC 1RG9A 1UKKA 3N2QA 3GR1A 4PUHA 3A9UA 4DR2C 3AY0A 2P2FA 5KYVA 1QM4A 5GTDA 4DR4C 2MCQA 4IZ6A 4DV6C 3J80D 3B7WA 2P20A 4X62C 4G1IA 1HNXC 4G37A 4ZJZA 3N54B 5CZVA 3VNSA 4DG8A 3CQ1A 3ETOA 2OO4A 1N2FA 4YHHC 3CQ3A 2ZZMA 1IBKC 1I94C 3OTOC 5A2QD 3TUFA 4DV1C 1USPB 2V7BA 5T8SA 2E8FA 3L8CA 1PG4A 5ADZA 4NXMC 3CQ2A 4BCAA 1MXAA 2MMAB 3R44A 4FTFA 1RY2A 1O92A 4ZLPA 4DCSA 3AF5A 4GXRA 2KZFA 3IMLA 1IB8A 3LNVA 3RG2A 4K0KC 3LAXA 4L4QA 5BSUA 4X65C 4YY3C 4MH4A 3S82A 4D56A 1J5EC 3DAYA 1LCIA 1QWIA 3NI2A 3GR0A 4DV5C 4LFCC 4FUQA 3FM7A 2D7VA 2QVZX 1XMQC 1FLOA 4I9GA 1N34C 1T5DX 4D4GA 4DG9A 2P02A 1VEHA 4RLFA 5FLXD 4JI1C 2VQFC 2PN2A 3UZ0A 3UX2A 2DPLA 2P2BA 1ML8A 4B3SC 1HH2P 3AF6A 1N32C 1M6XC 4B3TC 2E7GA 4LF7C 4D4IA 2VQEC 1O90A 4OYCA 1WCJA 1XRAA 2P2MA 1N36C 4GKKC 4DR5C 2WP0C 2XR1A 1K0RA 1MD9A 4DR3C 5BSMA 5LMNC 1NYEA 1M6XA 4GKJC 5BUQA 1MDFA 3KXWA 4DCVA 3FCCA 2HHHC 2ZZNA 3UOWA 4NDNA 5LCIA 3PROC 3R9XA
chains in the Genus database with same CATH topology
4ISBA 3R9WA 4DCTA 3T1YC 1LQLA 5AE2A 4LE5A 4KHPC 2UUAC 1ZB9A 4B3RC 3CJEA 2D1SA 1XRBA 5KYTA 2P2QA 5BSWA 3GKUA 1AMUA 1FJGC 3DHVA 3EERA 2YWCA 2E8EA 2E5LC 4R1MA 3J81D 4DV3C 2D27A 4BC9A 4RM2A 4B3MC 5K8FA 2ZM6C 1ULTA 5T8TA 5LMUC 4BC7A 3NYQA 4PROC 4L2ZA 3PBKA 2E8CA 5BSTA 2CY1A 4LF6C 4LFAC 4K0BA 2Y27A 2ONFA 4LF9C 4BBYA 1USPA 2BH1X 4DR7C 4NXNC 3E7XA 4XX2A 1O93A 5JRHA 4R0MA 2UXBC 4LF5C 5A1GA 4I9FA 2WD9A 4MTNA 4GS5A 4TPSB 1KKGA 2UXDC 3CW8X 5IWAC 3J7AD 4RVNA 3IEVA 2HJGA 2UXCC 4ODJA 4DUZC 5BUSA 4JYAC 1GPMA 4RVOA 1WF3A 5E7QA 4DV7C 3TQIA 4NOZA 4PHTA 5BSVA 2VZEA 4GXQA 4WS9A 1EGAA 3H2TA 5BR8C 5BURA 3IPLA 4R1LA 2YCBA 3NYRA 2UU9C 4DCUA 4JI0C 4LF8C 4X64C 2UUCC 2JMPA 2QW0X 3EQ6A 2Y4NA 1MKYA 1YJ7A 4D57A 2UUBC 2D1QA 3A9VA 1V26A 3T1HC 5AE3A 4RLQA 4BSZA 5H9UA 4OX9C 1JOSA 1V25A 4DV0C 3L95X 3DLPX 1XRCA 5DV9A 1IBLC 4WV3A 3A4IA 1O9TA 4RMNA 4DV2C 3I07A 4G36A 2QVYX 3LGXA 5IT9D 4PZPA 5A1IA 4L7IA 3E7WA 2OPLB 2F4VC 1L2FA 3IEUA 4EATA 4LFBC 3TDEA 3I08A 4RM3A 4JI4C 2D1TA 1N33C 4DV4C 1T5HX 2EGTA 4OXIA 3RV2A 2P2JA 3JAMD 3VNQA 4JI8C 1PG3A 5A19A 1PA4A 4LF4C 5CZXA 4KTVA 2OPLA 2YWBA 3ETCA 2BJOA 4JI3C 3C5EA 4DUYC 4DR1C 1VLAA 2QVXX 4AQYC 1XMOC 4X66C 2D1RA 3LUSA 3NPDA 4JI2C 1MDBA 3FCEA 2CXCA 5AE1A 3GPCA 4JM1A 1BA3A 2E0GA 4JI6C 1P7LA 1HNZC 4JI5C 1MXCA 5K85A 5IFIA 1IBMC 2PT7G 1HR0C 4JI7C 4FUTA 1XNRC 2Y4OA 1MXBA 5BSRA 2D28C 2QL8A 2ATWA 3PESA 3VNRA 4HPVA 4JV5C 4KTTA 4DR6C 3G7SA 2DYJA 4IR7A 1WH9A 3SO4A 5KEIA 2PROA 1XNQC 2VSQA 3CW9A 2ASBA 1ZB8A 2OBVA 1FUGA 2AYAA 4U5YD 1HNWC 1RG9A 1UKKA 3N2QA 3GR1A 3A9UA 4DR2C 2P2FA 5KYVA 1QM4A 5GTDA 4DR4C 4IZ6A 4DV6C 3J80D 3B7WA 2P20A 4X62C 4G1IA 1HNXC 4G37A 4ZJZA 3N54B 5CZVA 3VNSA 4DG8A 3ETOA 2OO4A 1N2FA 4YHHC 1IBKC 1I94C 3OTOC 5A2QD 3TUFA 4DV1C 1USPB 2V7BA 5T8SA 2E8FA 3L8CA 1PG4A 5ADZA 4NXMC 4BCAA 1MXAA 3R44A 4FTFA 1RY2A 1O92A 4ZLPA 4DCSA 3AF5A 4GXRA 2KZFA 3IMLA 3LNVA 3RG2A 4K0KC 3LAXA 4L4QA 5BSUA 4X65C 4YY3C 4MH4A 3S82A 4D56A 1J5EC 3DAYA 1LCIA 1QWIA 3NI2A 3GR0A 4DV5C 4LFCC 4FUQA 2D7VA 2QVZX 1XMQC 4I9GA 1N34C 1T5DX 4D4GA 4DG9A 2P02A 4RLFA 5FLXD 4JI1C 2VQFC 2PN2A 3UZ0A 2DPLA 2P2BA 1ML8A 4B3SC 1HH2P 3AF6A 1N32C 4B3TC 2E7GA 4LF7C 4D4IA 2VQEC 1O90A 4OYCA 1XRAA 2P2MA 1N36C 4GKKC 4DR5C 2WP0C 2XR1A 1K0RA 1MD9A 4DR3C 5BSMA 5LMNC 1NYEA 4GKJC 5BUQA 1MDFA 3KXWA 4DCVA 3FCCA 2HHHC 3UOWA 4NDNA 3PROC 3R9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLA A;  3R9W A;  4DCT A;  4AQY C;  3T1Y C;  1LQL A;  4X66 C;  1XMO C;  1IBK C;  1I94 C;  3OTO C;  3LUS A;  5A2Q D;  4DV1 C;  4JI2 C;  1USP B;  1EGA A;  5BR8 C;  2E8F A;  4KHP C;  2CXC A;  1ZB9 A;  2UUA C;  4B3R C;  3CJE A;  4NXM C;  2YCB A;  2UU9 C;  4DCU A;  4JI6 C;  3GKU A;  1HNZ C;  4JI5 C;  1FJG C;  4JI0 C;  3EER A;  4DCS A;  4LF8 C;  2E8E A;  3AF5 A;  4X64 C;  1IBM C;  3J81 D;  2E5L C;  4DV3 C;  2PT7 G;  1HR0 C;  2UUC C;  2KZF A;  4JI7 C;  2JMP A;  1MKY A;  4K0K C;  4B3M C;  1XNR C;  2UUB C;  3T1H C;  4X65 C;  4YY3 C;  4MH4 A;  1J5E C;  2ZM6 C;  5LMU C;  1QWI A;  4BSZ A;  2QL8 A;  2ATW A;  4DV5 C;  4LFC C;  2D7V A;  4JV5 C;  1XMQ C;  2E8C A;  4OX9 C;  1JOS A;  4DR6 C;  1N34 C;  2DYJ A;  4DV0 C;  1WH9 A;  2CY1 A;  5FLX D;  4JI1 C;  4LF6 C;  1XNQ C;  2VQF C;  4LFA C;  2ONF A;  2PN2 A;  4LF9 C;  2ASB A;  1ZB8 A;  1IBL C;  1USP A;  4DR7 C;  4NXN C;  4DV2 C;  3I07 A;  1ML8 A;  4XX2 A;  4B3S C;  1HH2 P;  3AF6 A;  1HNW C;  1N32 C;  5IT9 D;  1UKK A;  2UXB C;  4B3T C;  2E7G A;  4LF7 C;  2OPL B;  2VQE C;  4LF5 C;  2F4V C;  1L2F A;  4DR2 C;  3IEU A;  4LFB C;  4MTN A;  4DR4 C;  1N36 C;  4GKK C;  1KKG A;  4DR5 C;  4JI4 C;  1N33 C;  2XR1 A;  4DV6 C;  4DV4 C;  1K0R A;  3J80 D;  2UXD C;  5IWA C;  3J7A D;  3IEV A;  4DR3 C;  4X62 C;  5LMN C;  1NYE A;  2EGT A;  1HNX C;  2HJG A;  3JAM D;  4GKJ C;  2UXC C;  4JI8 C;  4DCV A;  4DUZ C;  2HHH C;  1PA4 A;  4LF4 C;  4JYA C;  2OPL A;  2BJO A;  1N2F A;  1WF3 A;  4JI3 C;  4DUY C;  3R9X A;  4DV7 C;  4YHH C;  4NOZ A;  4DR1 C; 
#chains in the Genus database with same CATH topology
 4ISB A;  3R9W A;  4DCT A;  3T1Y C;  1LQL A;  5AE2 A;  4LE5 A;  4PUI A;  4KHP C;  2UUA C;  1ZB9 A;  2Z51 A;  4B3R C;  3CJE A;  2D1S A;  1XRB A;  5KYT A;  1TH5 A;  2JNV A;  2P2Q A;  5BSW A;  3GKU A;  1AMU A;  1FJG C;  3DHV A;  3EER A;  2YWC A;  2E8E A;  2E5L C;  4R1M A;  3J81 D;  4DV3 C;  2D27 A;  4BC9 A;  4RM2 A;  2DHM A;  4B3M C;  5K8F A;  2ZM6 C;  1ULT A;  2MM9 A;  5T8T A;  5LMU C;  4BC7 A;  3NYQ A;  1XS3 A;  4PRO C;  4L2Z A;  3PBK A;  2E8C A;  5BST A;  2CY1 A;  2M5O A;  1UWD A;  4LF6 C;  4LFA C;  4K0B A;  2Y27 A;  2ONF A;  4LF9 C;  1XDX A;  4BBY A;  1USP A;  2BH1 X;  4DR7 C;  4NXN C;  3E7X A;  4XX2 A;  1O93 A;  5JRH A;  2YX1 A;  4R0M A;  2UXB C;  4LF5 C;  5A1G A;  4I9F A;  2M5H A;  2WD9 A;  3K6R A;  4MTN A;  4GS5 A;  4TPS B;  2ZTB A;  1V60 A;  1KKG A;  2UXD C;  3CW8 X;  5IWA C;  3J7A D;  4RVN A;  3IEV A;  2HJG A;  2UXC C;  4ODJ A;  4DUZ C;  5BUS A;  4JYA C;  1GPM A;  4RVO A;  1NY8 A;  1WF3 A;  1XHJ A;  5E7Q A;  3O2E A;  4DV7 C;  3TQI A;  4NOZ A;  4PHT A;  5BSV A;  2VZE A;  4GXQ A;  4WS9 A;  1EGA A;  3H2T A;  5BR8 C;  5BUR A;  3IPL A;  4R1L A;  2YCB A;  3NYR A;  2UU9 C;  4DCU A;  4JI0 C;  4LF8 C;  4X64 C;  2UUC C;  2JMP A;  2QW0 X;  3EQ6 A;  2Y4N A;  1MKY A;  1YJ7 A;  4D57 A;  2UUB C;  2D1Q A;  3A9V A;  1V26 A;  3T1H C;  5AE3 A;  4RLQ A;  1PU1 A;  4BSZ A;  5H9U A;  4OX9 C;  1JOS A;  1V25 A;  3UEB A;  1P4E C;  4DV0 C;  3L95 X;  3DLP X;  1XRC A;  3A25 A;  5DV9 A;  2KZ0 A;  1IBL C;  4WV3 A;  3A4I A;  1O9T A;  3A26 A;  4RMN A;  4DV2 C;  3I07 A;  4G36 A;  2QVY X;  3LGX A;  2KDN A;  5IT9 D;  4PZP A;  5A1I A;  4L7I A;  1P4E A;  3E7W A;  2OPL B;  2F4V C;  1L2F A;  3IEU A;  4EAT A;  1YGT A;  4LFB C;  3TDE A;  3I08 A;  4RM3 A;  4JI4 C;  2D1T A;  1N33 C;  4DV4 C;  1T5H X;  2CU6 A;  2EGT A;  4OXI A;  3RV2 A;  2P2J A;  3JAM D;  3VNQ A;  4JI8 C;  1PG3 A;  5A19 A;  1PA4 A;  4LF4 C;  5CZX A;  4KTV A;  2OPL A;  2YWB A;  3ETC A;  2BJO A;  4JI3 C;  3C5E A;  4DUY C;  4DR1 C;  1VLA A;  2QVX X;  4AQY C;  1XMO C;  4X66 C;  2PG1 E;  2D1R A;  3LUS A;  3NPD A;  4JI2 C;  4PUG A;  1MDB A;  3FCE A;  2CXC A;  5AE1 A;  3GPC A;  4JM1 A;  1BA3 A;  2E0G A;  2NCL A;  4JI6 C;  1P7L A;  1HNZ C;  4JI5 C;  3TR3 A;  1MXC A;  5K85 A;  5IFI A;  1IBM C;  2PT7 G;  1HR0 C;  4JI7 C;  4FUT A;  3UX3 A;  1XNR C;  2Y4O A;  1MXB A;  3LNO A;  5BSR A;  2D28 C;  2QL8 A;  2ATW A;  3PES A;  3VNR A;  4HPV A;  4JV5 C;  4KTT A;  4DR6 C;  3G7S A;  2DYJ A;  4IR7 A;  1WH9 A;  3SO4 A;  5KEI A;  2PRO A;  1XNQ C;  2VSQ A;  3CW9 A;  2ASB A;  1ZB8 A;  2OBV A;  1FUG A;  2AYA A;  4U5Y D;  1HNW C;  1RG9 A;  1UKK A;  3N2Q A;  3GR1 A;  4PUH A;  3A9U A;  4DR2 C;  3AY0 A;  2P2F A;  5KYV A;  1QM4 A;  5GTD A;  4DR4 C;  2MCQ A;  4IZ6 A;  4DV6 C;  3J80 D;  3B7W A;  2P20 A;  4X62 C;  4G1I A;  1HNX C;  4G37 A;  4ZJZ A;  3N54 B;  5CZV A;  3VNS A;  4DG8 A;  3CQ1 A;  3ETO A;  2OO4 A;  1N2F A;  4YHH C;  3CQ3 A;  2ZZM A;  1IBK C;  1I94 C;  3OTO C;  5A2Q D;  3TUF A;  4DV1 C;  1USP B;  2V7B A;  5T8S A;  2E8F A;  3L8C A;  1PG4 A;  5ADZ A;  4NXM C;  3CQ2 A;  4BCA A;  1MXA A;  2MMA B;  3R44 A;  4FTF A;  1RY2 A;  1O92 A;  4ZLP A;  4DCS A;  3AF5 A;  4GXR A;  2KZF A;  3IML A;  1IB8 A;  3LNV A;  3RG2 A;  4K0K C;  3LAX A;  4L4Q A;  5BSU A;  4X65 C;  4YY3 C;  4MH4 A;  3S82 A;  4D56 A;  1J5E C;  3DAY A;  1LCI A;  1QWI A;  3NI2 A;  3GR0 A;  4DV5 C;  4LFC C;  4FUQ A;  3FM7 A;  2D7V A;  2QVZ X;  1XMQ C;  1FLO A;  4I9G A;  1N34 C;  1T5D X;  4D4G A;  4DG9 A;  2P02 A;  1VEH A;  4RLF A;  5FLX D;  4JI1 C;  2VQF C;  2PN2 A;  3UZ0 A;  3UX2 A;  2DPL A;  2P2B A;  1ML8 A;  4B3S C;  1HH2 P;  3AF6 A;  1N32 C;  1M6X C;  4B3T C;  2E7G A;  4LF7 C;  4D4I A;  2VQE C;  1O90 A;  4OYC A;  1WCJ A;  1XRA A;  2P2M A;  1N36 C;  4GKK C;  4DR5 C;  2WP0 C;  2XR1 A;  1K0R A;  1MD9 A;  4DR3 C;  5BSM A;  5LMN C;  1NYE A;  1M6X A;  4GKJ C;  5BUQ A;  1MDF A;  3KXW A;  4DCV A;  3FCC A;  2HHH C;  2ZZN A;  3UOW A;  4NDN A;  5LCI A;  3PRO C;  3R9X A; 
#chains in the Genus database with same CATH homology
 4ISB A;  3R9W A;  4DCT A;  3T1Y C;  1LQL A;  5AE2 A;  4LE5 A;  4KHP C;  2UUA C;  1ZB9 A;  4B3R C;  3CJE A;  2D1S A;  1XRB A;  5KYT A;  2P2Q A;  5BSW A;  3GKU A;  1AMU A;  1FJG C;  3DHV A;  3EER A;  2YWC A;  2E8E A;  2E5L C;  4R1M A;  3J81 D;  4DV3 C;  2D27 A;  4BC9 A;  4RM2 A;  4B3M C;  5K8F A;  2ZM6 C;  1ULT A;  5T8T A;  5LMU C;  4BC7 A;  3NYQ A;  4PRO C;  4L2Z A;  3PBK A;  2E8C A;  5BST A;  2CY1 A;  4LF6 C;  4LFA C;  4K0B A;  2Y27 A;  2ONF A;  4LF9 C;  4BBY A;  1USP A;  2BH1 X;  4DR7 C;  4NXN C;  3E7X A;  4XX2 A;  1O93 A;  5JRH A;  4R0M A;  2UXB C;  4LF5 C;  5A1G A;  4I9F A;  2WD9 A;  4MTN A;  4GS5 A;  4TPS B;  1KKG A;  2UXD C;  3CW8 X;  5IWA C;  3J7A D;  4RVN A;  3IEV A;  2HJG A;  2UXC C;  4ODJ A;  4DUZ C;  5BUS A;  4JYA C;  1GPM A;  4RVO A;  1WF3 A;  5E7Q A;  4DV7 C;  3TQI A;  4NOZ A;  4PHT A;  5BSV A;  2VZE A;  4GXQ A;  4WS9 A;  1EGA A;  3H2T A;  5BR8 C;  5BUR A;  3IPL A;  4R1L A;  2YCB A;  3NYR A;  2UU9 C;  4DCU A;  4JI0 C;  4LF8 C;  4X64 C;  2UUC C;  2JMP A;  2QW0 X;  3EQ6 A;  2Y4N A;  1MKY A;  1YJ7 A;  4D57 A;  2UUB C;  2D1Q A;  3A9V A;  1V26 A;  3T1H C;  5AE3 A;  4RLQ A;  4BSZ A;  5H9U A;  4OX9 C;  1JOS A;  1V25 A;  4DV0 C;  3L95 X;  3DLP X;  1XRC A;  5DV9 A;  1IBL C;  4WV3 A;  3A4I A;  1O9T A;  4RMN A;  4DV2 C;  3I07 A;  4G36 A;  2QVY X;  3LGX A;  5IT9 D;  4PZP A;  5A1I A;  4L7I A;  3E7W A;  2OPL B;  2F4V C;  1L2F A;  3IEU A;  4EAT A;  4LFB C;  3TDE A;  3I08 A;  4RM3 A;  4JI4 C;  2D1T A;  1N33 C;  4DV4 C;  1T5H X;  2EGT A;  4OXI A;  3RV2 A;  2P2J A;  3JAM D;  3VNQ A;  4JI8 C;  1PG3 A;  5A19 A;  1PA4 A;  4LF4 C;  5CZX A;  4KTV A;  2OPL A;  2YWB A;  3ETC A;  2BJO A;  4JI3 C;  3C5E A;  4DUY C;  4DR1 C;  1VLA A;  2QVX X;  4AQY C;  1XMO C;  4X66 C;  2D1R A;  3LUS A;  3NPD A;  4JI2 C;  1MDB A;  3FCE A;  2CXC A;  5AE1 A;  3GPC A;  4JM1 A;  1BA3 A;  2E0G A;  4JI6 C;  1P7L A;  1HNZ C;  4JI5 C;  1MXC A;  5K85 A;  5IFI A;  1IBM C;  2PT7 G;  1HR0 C;  4JI7 C;  4FUT A;  1XNR C;  2Y4O A;  1MXB A;  5BSR A;  2D28 C;  2QL8 A;  2ATW A;  3PES A;  3VNR A;  4HPV A;  4JV5 C;  4KTT A;  4DR6 C;  3G7S A;  2DYJ A;  4IR7 A;  1WH9 A;  3SO4 A;  5KEI A;  2PRO A;  1XNQ C;  2VSQ A;  3CW9 A;  2ASB A;  1ZB8 A;  2OBV A;  1FUG A;  2AYA A;  4U5Y D;  1HNW C;  1RG9 A;  1UKK A;  3N2Q A;  3GR1 A;  3A9U A;  4DR2 C;  2P2F A;  5KYV A;  1QM4 A;  5GTD A;  4DR4 C;  4IZ6 A;  4DV6 C;  3J80 D;  3B7W A;  2P20 A;  4X62 C;  4G1I A;  1HNX C;  4G37 A;  4ZJZ A;  3N54 B;  5CZV A;  3VNS A;  4DG8 A;  3ETO A;  2OO4 A;  1N2F A;  4YHH C;  1IBK C;  1I94 C;  3OTO C;  5A2Q D;  3TUF A;  4DV1 C;  1USP B;  2V7B A;  5T8S A;  2E8F A;  3L8C A;  1PG4 A;  5ADZ A;  4NXM C;  4BCA A;  1MXA A;  3R44 A;  4FTF A;  1RY2 A;  1O92 A;  4ZLP A;  4DCS A;  3AF5 A;  4GXR A;  2KZF A;  3IML A;  3LNV A;  3RG2 A;  4K0K C;  3LAX A;  4L4Q A;  5BSU A;  4X65 C;  4YY3 C;  4MH4 A;  3S82 A;  4D56 A;  1J5E C;  3DAY A;  1LCI A;  1QWI A;  3NI2 A;  3GR0 A;  4DV5 C;  4LFC C;  4FUQ A;  2D7V A;  2QVZ X;  1XMQ C;  4I9G A;  1N34 C;  1T5D X;  4D4G A;  4DG9 A;  2P02 A;  4RLF A;  5FLX D;  4JI1 C;  2VQF C;  2PN2 A;  3UZ0 A;  2DPL A;  2P2B A;  1ML8 A;  4B3S C;  1HH2 P;  3AF6 A;  1N32 C;  4B3T C;  2E7G A;  4LF7 C;  4D4I A;  2VQE C;  1O90 A;  4OYC A;  1XRA A;  2P2M A;  1N36 C;  4GKK C;  4DR5 C;  2WP0 C;  2XR1 A;  1K0R A;  1MD9 A;  4DR3 C;  5BSM A;  5LMN C;  1NYE A;  4GKJ C;  5BUQ A;  1MDF A;  3KXW A;  4DCV A;  3FCC A;  2HHH C;  3UOW A;  4NDN A;  3PRO C;  3R9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...