2HHHC

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2hhhC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2hhhC02
4B3TC 3IEVA 2CY1A 4LFBC 1N2FA 3JAMD 3T1HC 2E8FA 4DCSA 4LF5C 2ATWA 1UKKA 1PA4A 1N34C 2HJGA 4OX9C 1N32C 1HH2P 1ZB9A 2D7VA 1KKGA 2UU9C 3T1YC 2F4VC 4JI6C 2ZM6C 4JI7C 2DYJA 3R9WA 2VQEC 1HNWC 4YY3C 3CJEA 4DCTA 1HNZC 4BSZA 1FJGC 2UXDC 1XNQC 1HNXC 1N33C 4LF8C 3IEUA 5FLXD 1QWIA 4NXMC 4DR1C 4NXNC 4JI3C 4MTNA 4DV3C 2PN2A 4DV0C 4X62C 2UUCC 4DV6C 4B3SC 3J7AD 4JI0C 5BR8C 4DV1C 5LMUC 2UXBC 4K0KC 1LQLA 4DCUA 1HR0C 4DV7C 3GKUA 3LUSA 2BJOA 4JI5C 4LF4C 1WH9A 1I94C 2QL8A 1JOSA 1J5EC 4DR6C 4JI1C 4X65C 4B3RC 4X66C 4MH4A 2VQFC 5LMNC 2YCBA 2ASBA 1ZB8A 4LFCC 1VLAA 4LFAC 3R9XA 1USPA 2CXCA 3J80D 4AQYC 3AF5A 2PT7G 4DV4C 4GKJC 5A2QD 1L2FA 1XNRC 4JI4C 2OPLA 4DR3C 1XMQC 4X64C 4YHHC 4NOZA 1IBKC 4GKKC 4DV2C 3OTOC 2ONFA 1XMOC 1IBMC 4LF6C 2E8CA 4JI2C 2E7GA 1IBLC 3AF6A 4B3MC 5IT9D 4XX2A 4DUYC 4DR2C 1N36C 2UUAC 4JV5C 2OPLB 1ML8A 1USPB 4JI8C 4DR4C 5IWAC 1EGAA 1NYEA 4DCVA 2XR1A 4DUZC 4LF9C 1WF3A 3EERA 3I07A 2EGTA 4LF7C 2HHHC 2E5LC 2UUBC 4DR7C 1K0RA 2JMPA 4DV5C 4JYAC 2UXCC 2KZFA 3J81D 2E8EA 4DR5C 4KHPC 1MKYA
chains in the Genus database with same CATH superfamily
1NY8A 1PG3A 3B7WA 1TH5A 4DCSA 1PA4A 4G1IA 2D7VA 1KKGA 2UU9C 2P2JA 3T1YC 2CU6A 5BSUA 1YJ7A 5BSRA 3TR3A 2VQEC 1HNWC 5T8TA 2M5OA 4BSZA 1HNZC 2M5HA 4ZJZA 3SO4A 1MDFA 4WS9A 3GR1A 4DV3C 2PN2A 2VZEA 2UUCC 5LMUC 1M6XC 3GKUA 3A9UA 2QL8A 1JOSA 4X65C 4B3RC 5BURA 1XRCA 4D4GA 2ASBA 1PG4A 4LFCC 5K8FA 3IMLA 2JNVA 2PT7G 3PBKA 1P4EC 4DV4C 5AE3A 1P4EA 4WV3A 3LNOA 1O93A 2PG1E 2P2QA 3OTOC 2ONFA 1XMOC 3N2QA 3DLPX 4GXRA 4FUQA 3ETOA 3UOWA 3A25A 4D4IA 1N36C 2UUAC 2KDNA 1LCIA 2OPLB 1ML8A 1USPB 4JI8C 2D1TA 2Y27A 4DUZC 4LF9C 1WF3A 3EERA 4JM1A 2YWCA 3DHVA 2UUBC 5ADZA 4DG8A 2KZFA 5KYVA 2PROA 4LFBC 1N2FA 3N54B 4LF5C 3CW9A 3VNRA 1N34C 4OX9C 5H9UA 1HH2P 4BC9A 4GXQA 4JI7C 3CJEA 3NPDA 5A1IA 5JRHA 4DCTA 4RLFA 4PROC 4I9GA 5FLXD 1MXAA 1QWIA 4NXMC 4RLQA 1ULTA 3J7AD 2VSQA 4K0KC 1LQLA 5KYTA 4DCUA 3G7SA 3LUSA 4FUTA 4LF4C 2Z51A 3H2TA 2OO4A 1XDXA 1AMUA 5GTDA 3R44A 4JI1C 4X66C 4MH4A 2VQFC 1ZB8A 2AYAA 4BBYA 4AQYC 1GPMA 3GPCA 2MCQA 1MXBA 1O90A 4PUHA 4D57A 4GKJC 5BSVA 4JI4C 5T8SA 4X64C 4YHHC 4NOZA 1IBKC 3TDEA 1IBMC 4L2ZA 2D27A 2E7GA 1FLOA 5A1GA 3AF6A 4B3MC 2MMAB 3E7WA 5IFIA 4PZPA 4DR2C 2ZTBA 4IZ6A 5BUSA 1FUGA 2EGTA 2HHHC 3CW8X 3UEBA 2JMPA 4JYAC 2UXCC 5BSMA 1XRBA 2D1QA 3S82A 3J81D 3RG2A 1M6XA 3IEVA 1RY2A 3UX3A 3JAMD 3T1HC 2D1RA 2E8FA 2ATWA 1UKKA 1ZB9A 3ETCA 2F4VC 4KTVA 4G36A 1XS3A 2UXDC 1XNQC 4HPVA 4PUIA 1N33C 3AY0A 3K6RA 4I9FA 4NXNC 4DR1C 4MTNA 4JI3C 2P2BA 3LNVA 4FTFA 2QVXX 4JI0C 5BR8C 4DV1C 1HR0C 3NYQA 3GR0A 4DV7C 3LAXA 1BA3A 3L8CA 2BJOA 4JI5C 3FCCA 1J5EC 3TUFA 1UWDA 5LCIA 3NYRA 1MDBA 3TQIA 4PHTA 3R9XA 1USPA 2CXCA 3AF5A 3CQ2A 5A2QD 1L2FA 1PU1A 1XNRC 4R1MA 1XMQC 5CZVA 3RV2A 4EATA 1QM4A 4GKKC 5E7QA 2P20A 4DV2C 2WD9A 5CZXA 4LF6C 4JI2C 5BSTA 2P2MA 4OXIA 5IT9D 3A4IA 4XX2A 4BCAA 1RG9A 3FM7A 4JV5C 2DHMA 4U5YD 2Y4NA 4DR4C 1WCJA 1EGAA 4DCVA 2XR1A 2P2FA 3I07A 5KEIA 1P7LA 3CQ1A 4DR7C 1K0RA 4ISBA 2V7BA 2E8EA 4KTTA 4PUGA 4LFAC 4GS5A 1MKYA 4KHPC 4B3TC 2CY1A 5A19A 2Y4OA 3DAYA 1MD9A 2KZ0A 1V60A 2HJGA 1N32C 1O9TA 4JI6C 2ZM6C 1T5HX 2DYJA 2ZZMA 3R9WA 4YY3C 1MXCA 2P02A 1FJGC 4RVOA 5DV9A 3C5EA 1HNXC 4LF8C 3FCEA 3IEUA 2DPLA 4RM2A 4RVNA 3L95X 1XHJA 2YWBA 4DV0C 4L4QA 4X62C 4DV6C 4B3SC 2UXBC 3IPLA 2QW0X 2E0GA 3PESA 4LE5A 4BC7A 4NDNA 3VNSA 3I08A 2D28C 4K0BA 1WH9A 2BH1X 1I94C 1VEHA 4DR6C 3E7XA 3UZ0A 2NCLA 1V26A 5LMNC 2YCBA 1VLAA 3LGXA 4DG9A 3VNQA 2OBVA 3J80D 2WP0C 3O2EA 4IR7A 3KXWA 1XRAA 2YX1A 4RMNA 1IB8A 2OPLA 4DR3C 4R0MA 5AE1A 4G37A 2E8CA 3NI2A 3A26A 4R1LA 5BSWA 2QVYX 3CQ3A 2QVZX 5BUQA 1IBLC 3A9VA 4DUYC 4ZLPA 5K85A 3PROC 4TPSB 5IWAC 1NYEA 2D1SA 1O92A 1T5DX 4D56A 3EQ6A 4L7IA 2MM9A 5AE2A 1V25A 4LF7C 2E5LC 4OYCA 4DV5C 4ODJA 4RM3A 3UX2A 2ZZNA 4DR5C 1YGTA
chains in the Genus database with same CATH topology
1PG3A 3B7WA 4DCSA 1PA4A 4G1IA 2D7VA 1KKGA 2UU9C 2P2JA 3T1YC 5BSUA 1YJ7A 5BSRA 2VQEC 1HNWC 5T8TA 1HNZC 4BSZA 4ZJZA 3SO4A 1MDFA 4WS9A 3GR1A 4DV3C 2PN2A 2VZEA 2UUCC 5LMUC 3GKUA 3A9UA 2QL8A 1JOSA 4X65C 4B3RC 5BURA 1XRCA 4D4GA 2ASBA 1PG4A 4LFCC 5K8FA 3IMLA 2PT7G 3PBKA 4DV4C 5AE3A 4WV3A 1O93A 2P2QA 3OTOC 2ONFA 1XMOC 3N2QA 3DLPX 4GXRA 4FUQA 3ETOA 3UOWA 4D4IA 1N36C 2UUAC 1LCIA 2OPLB 1ML8A 1USPB 4JI8C 2D1TA 2Y27A 4DUZC 4LF9C 1WF3A 3EERA 4JM1A 2YWCA 3DHVA 2UUBC 5ADZA 4DG8A 2KZFA 5KYVA 2PROA 4LFBC 1N2FA 3N54B 4LF5C 3CW9A 3VNRA 1N34C 4OX9C 5H9UA 1HH2P 4BC9A 4GXQA 4JI7C 3CJEA 3NPDA 5A1IA 5JRHA 4DCTA 4RLFA 4PROC 4I9GA 5FLXD 1MXAA 1QWIA 4NXMC 4RLQA 1ULTA 3J7AD 2VSQA 4K0KC 1LQLA 5KYTA 4DCUA 3G7SA 3LUSA 4FUTA 4LF4C 3H2TA 2OO4A 1AMUA 5GTDA 3R44A 4JI1C 4X66C 4MH4A 2VQFC 1ZB8A 2AYAA 4BBYA 4AQYC 1GPMA 3GPCA 1MXBA 1O90A 4D57A 4GKJC 5BSVA 4JI4C 5T8SA 4X64C 4YHHC 4NOZA 1IBKC 3TDEA 1IBMC 4L2ZA 2D27A 2E7GA 5A1GA 3AF6A 4B3MC 3E7WA 5IFIA 4PZPA 4DR2C 4IZ6A 5BUSA 1FUGA 2EGTA 2HHHC 3CW8X 2JMPA 4JYAC 2UXCC 5BSMA 1XRBA 2D1QA 3S82A 3J81D 3RG2A 3IEVA 1RY2A 3JAMD 3T1HC 2D1RA 2E8FA 2ATWA 1UKKA 1ZB9A 3ETCA 2F4VC 4KTVA 4G36A 2UXDC 1XNQC 4HPVA 1N33C 4I9FA 4NXNC 4DR1C 4MTNA 4JI3C 2P2BA 3LNVA 4FTFA 2QVXX 4JI0C 5BR8C 4DV1C 1HR0C 3NYQA 3GR0A 4DV7C 3LAXA 1BA3A 3L8CA 2BJOA 4JI5C 3FCCA 1J5EC 3TUFA 3NYRA 1MDBA 3TQIA 4PHTA 3R9XA 1USPA 2CXCA 3AF5A 5A2QD 1L2FA 1XNRC 4R1MA 1XMQC 5CZVA 3RV2A 4EATA 1QM4A 4GKKC 5E7QA 2P20A 4DV2C 2WD9A 5CZXA 4LF6C 4JI2C 5BSTA 2P2MA 4OXIA 5IT9D 3A4IA 4XX2A 4BCAA 1RG9A 4JV5C 4U5YD 2Y4NA 4DR4C 1EGAA 4DCVA 2XR1A 2P2FA 3I07A 5KEIA 1P7LA 4DR7C 1K0RA 4ISBA 4LFAC 2V7BA 2E8EA 4KTTA 4GS5A 1MKYA 4KHPC 4B3TC 2CY1A 5A19A 2Y4OA 3DAYA 1MD9A 2HJGA 1N32C 1O9TA 4JI6C 2ZM6C 1T5HX 2DYJA 3R9WA 4YY3C 1MXCA 2P02A 1FJGC 4RVOA 5DV9A 3C5EA 1HNXC 4LF8C 3FCEA 3IEUA 2DPLA 4RM2A 4RVNA 3L95X 2YWBA 4DV0C 4L4QA 4X62C 4DV6C 4B3SC 2UXBC 3IPLA 2QW0X 2E0GA 3PESA 4LE5A 4BC7A 4NDNA 3VNSA 3I08A 2D28C 4K0BA 1WH9A 2BH1X 1I94C 4DR6C 3E7XA 3UZ0A 1V26A 5LMNC 2YCBA 1VLAA 3LGXA 4DG9A 3VNQA 2OBVA 3J80D 2WP0C 4IR7A 3KXWA 1XRAA 4RMNA 2OPLA 4DR3C 4R0MA 5AE1A 4G37A 2E8CA 3NI2A 4R1LA 5BSWA 2QVYX 2QVZX 1IBLC 5BUQA 3A9VA 4DUYC 4ZLPA 5K85A 3PROC 4TPSB 5IWAC 1NYEA 2D1SA 1O92A 1T5DX 4D56A 3EQ6A 4L7IA 5AE2A 1V25A 4LF7C 2E5LC 4OYCA 4DV5C 4ODJA 4RM3A 4DR5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T C;  3IEV A;  2CY1 A;  4LFB C;  1N2F A;  3JAM D;  3T1H C;  2E8F A;  4DCS A;  4LF5 C;  2ATW A;  1UKK A;  1PA4 A;  1N34 C;  2HJG A;  4OX9 C;  1N32 C;  1HH2 P;  1ZB9 A;  2D7V A;  1KKG A;  2UU9 C;  3T1Y C;  2F4V C;  4JI6 C;  2ZM6 C;  4JI7 C;  2DYJ A;  3R9W A;  2VQE C;  1HNW C;  4YY3 C;  3CJE A;  4DCT A;  1HNZ C;  4BSZ A;  1FJG C;  2UXD C;  1XNQ C;  1HNX C;  1N33 C;  4LF8 C;  3IEU A;  5FLX D;  1QWI A;  4NXM C;  4DR1 C;  4NXN C;  4JI3 C;  4MTN A;  4DV3 C;  2PN2 A;  4DV0 C;  4X62 C;  2UUC C;  4DV6 C;  4B3S C;  3J7A D;  4JI0 C;  5BR8 C;  4DV1 C;  5LMU C;  2UXB C;  4K0K C;  1LQL A;  4DCU A;  1HR0 C;  4DV7 C;  3GKU A;  3LUS A;  2BJO A;  4JI5 C;  4LF4 C;  1WH9 A;  1I94 C;  2QL8 A;  1JOS A;  1J5E C;  4DR6 C;  4JI1 C;  4X65 C;  4B3R C;  4X66 C;  4MH4 A;  2VQF C;  5LMN C;  2YCB A;  2ASB A;  1ZB8 A;  4LFC C;  1VLA A;  4LFA C;  3R9X A;  1USP A;  2CXC A;  3J80 D;  4AQY C;  3AF5 A;  2PT7 G;  4DV4 C;  4GKJ C;  5A2Q D;  1L2F A;  1XNR C;  4JI4 C;  2OPL A;  4DR3 C;  1XMQ C;  4X64 C;  4YHH C;  4NOZ A;  1IBK C;  4GKK C;  4DV2 C;  3OTO C;  2ONF A;  1XMO C;  1IBM C;  4LF6 C;  2E8C A;  4JI2 C;  2E7G A;  1IBL C;  3AF6 A;  4B3M C;  5IT9 D;  4XX2 A;  4DUY C;  4DR2 C;  1N36 C;  2UUA C;  4JV5 C;  2OPL B;  1ML8 A;  1USP B;  4JI8 C;  4DR4 C;  5IWA C;  1EGA A;  1NYE A;  4DCV A;  2XR1 A;  4DUZ C;  4LF9 C;  1WF3 A;  3EER A;  3I07 A;  2EGT A;  4LF7 C;  2HHH C;  2E5L C;  2UUB C;  4DR7 C;  1K0R A;  2JMP A;  4DV5 C;  4JYA C;  2UXC C;  2KZF A;  3J81 D;  2E8E A;  4DR5 C;  4KHP C;  1MKY A; 
#chains in the Genus database with same CATH topology
 1NY8 A;  1PG3 A;  3B7W A;  1TH5 A;  4DCS A;  1PA4 A;  4G1I A;  2D7V A;  1KKG A;  2UU9 C;  2P2J A;  3T1Y C;  2CU6 A;  5BSU A;  1YJ7 A;  5BSR A;  3TR3 A;  2VQE C;  1HNW C;  5T8T A;  2M5O A;  4BSZ A;  1HNZ C;  2M5H A;  4ZJZ A;  3SO4 A;  1MDF A;  4WS9 A;  3GR1 A;  4DV3 C;  2PN2 A;  2VZE A;  2UUC C;  5LMU C;  1M6X C;  3GKU A;  3A9U A;  2QL8 A;  1JOS A;  4X65 C;  4B3R C;  5BUR A;  1XRC A;  4D4G A;  2ASB A;  1PG4 A;  4LFC C;  5K8F A;  3IML A;  2JNV A;  2PT7 G;  3PBK A;  1P4E C;  4DV4 C;  5AE3 A;  1P4E A;  4WV3 A;  3LNO A;  1O93 A;  2PG1 E;  2P2Q A;  3OTO C;  2ONF A;  1XMO C;  3N2Q A;  3DLP X;  4GXR A;  4FUQ A;  3ETO A;  3UOW A;  3A25 A;  4D4I A;  1N36 C;  2UUA C;  2KDN A;  1LCI A;  2OPL B;  1ML8 A;  1USP B;  4JI8 C;  2D1T A;  2Y27 A;  4DUZ C;  4LF9 C;  1WF3 A;  3EER A;  4JM1 A;  2YWC A;  3DHV A;  2UUB C;  5ADZ A;  4DG8 A;  2KZF A;  5KYV A;  2PRO A;  4LFB C;  1N2F A;  3N54 B;  4LF5 C;  3CW9 A;  3VNR A;  1N34 C;  4OX9 C;  5H9U A;  1HH2 P;  4BC9 A;  4GXQ A;  4JI7 C;  3CJE A;  3NPD A;  5A1I A;  5JRH A;  4DCT A;  4RLF A;  4PRO C;  4I9G A;  5FLX D;  1MXA A;  1QWI A;  4NXM C;  4RLQ A;  1ULT A;  3J7A D;  2VSQ A;  4K0K C;  1LQL A;  5KYT A;  4DCU A;  3G7S A;  3LUS A;  4FUT A;  4LF4 C;  2Z51 A;  3H2T A;  2OO4 A;  1XDX A;  1AMU A;  5GTD A;  3R44 A;  4JI1 C;  4X66 C;  4MH4 A;  2VQF C;  1ZB8 A;  2AYA A;  4BBY A;  4AQY C;  1GPM A;  3GPC A;  2MCQ A;  1MXB A;  1O90 A;  4PUH A;  4D57 A;  4GKJ C;  5BSV A;  4JI4 C;  5T8S A;  4X64 C;  4YHH C;  4NOZ A;  1IBK C;  3TDE A;  1IBM C;  4L2Z A;  2D27 A;  2E7G A;  1FLO A;  5A1G A;  3AF6 A;  4B3M C;  2MMA B;  3E7W A;  5IFI A;  4PZP A;  4DR2 C;  2ZTB A;  4IZ6 A;  5BUS A;  1FUG A;  2EGT A;  2HHH C;  3CW8 X;  3UEB A;  2JMP A;  4JYA C;  2UXC C;  5BSM A;  1XRB A;  2D1Q A;  3S82 A;  3J81 D;  3RG2 A;  1M6X A;  3IEV A;  1RY2 A;  3UX3 A;  3JAM D;  3T1H C;  2D1R A;  2E8F A;  2ATW A;  1UKK A;  1ZB9 A;  3ETC A;  2F4V C;  4KTV A;  4G36 A;  1XS3 A;  2UXD C;  1XNQ C;  4HPV A;  4PUI A;  1N33 C;  3AY0 A;  3K6R A;  4I9F A;  4NXN C;  4DR1 C;  4MTN A;  4JI3 C;  2P2B A;  3LNV A;  4FTF A;  2QVX X;  4JI0 C;  5BR8 C;  4DV1 C;  1HR0 C;  3NYQ A;  3GR0 A;  4DV7 C;  3LAX A;  1BA3 A;  3L8C A;  2BJO A;  4JI5 C;  3FCC A;  1J5E C;  3TUF A;  1UWD A;  5LCI A;  3NYR A;  1MDB A;  3TQI A;  4PHT A;  3R9X A;  1USP A;  2CXC A;  3AF5 A;  3CQ2 A;  5A2Q D;  1L2F A;  1PU1 A;  1XNR C;  4R1M A;  1XMQ C;  5CZV A;  3RV2 A;  4EAT A;  1QM4 A;  4GKK C;  5E7Q A;  2P20 A;  4DV2 C;  2WD9 A;  5CZX A;  4LF6 C;  4JI2 C;  5BST A;  2P2M A;  4OXI A;  5IT9 D;  3A4I A;  4XX2 A;  4BCA A;  1RG9 A;  3FM7 A;  4JV5 C;  2DHM A;  4U5Y D;  2Y4N A;  4DR4 C;  1WCJ A;  1EGA A;  4DCV A;  2XR1 A;  2P2F A;  3I07 A;  5KEI A;  1P7L A;  3CQ1 A;  4DR7 C;  1K0R A;  4ISB A;  2V7B A;  2E8E A;  4KTT A;  4PUG A;  4LFA C;  4GS5 A;  1MKY A;  4KHP C;  4B3T C;  2CY1 A;  5A19 A;  2Y4O A;  3DAY A;  1MD9 A;  2KZ0 A;  1V60 A;  2HJG A;  1N32 C;  1O9T A;  4JI6 C;  2ZM6 C;  1T5H X;  2DYJ A;  2ZZM A;  3R9W A;  4YY3 C;  1MXC A;  2P02 A;  1FJG C;  4RVO A;  5DV9 A;  3C5E A;  1HNX C;  4LF8 C;  3FCE A;  3IEU A;  2DPL A;  4RM2 A;  4RVN A;  3L95 X;  1XHJ A;  2YWB A;  4DV0 C;  4L4Q A;  4X62 C;  4DV6 C;  4B3S C;  2UXB C;  3IPL A;  2QW0 X;  2E0G A;  3PES A;  4LE5 A;  4BC7 A;  4NDN A;  3VNS A;  3I08 A;  2D28 C;  4K0B A;  1WH9 A;  2BH1 X;  1I94 C;  1VEH A;  4DR6 C;  3E7X A;  3UZ0 A;  2NCL A;  1V26 A;  5LMN C;  2YCB A;  1VLA A;  3LGX A;  4DG9 A;  3VNQ A;  2OBV A;  3J80 D;  2WP0 C;  3O2E A;  4IR7 A;  3KXW A;  1XRA A;  2YX1 A;  4RMN A;  1IB8 A;  2OPL A;  4DR3 C;  4R0M A;  5AE1 A;  4G37 A;  2E8C A;  3NI2 A;  3A26 A;  4R1L A;  5BSW A;  2QVY X;  3CQ3 A;  2QVZ X;  5BUQ A;  1IBL C;  3A9V A;  4DUY C;  4ZLP A;  5K85 A;  3PRO C;  4TPS B;  5IWA C;  1NYE A;  2D1S A;  1O92 A;  1T5D X;  4D56 A;  3EQ6 A;  4L7I A;  2MM9 A;  5AE2 A;  1V25 A;  4LF7 C;  2E5L C;  4OYC A;  4DV5 C;  4ODJ A;  4RM3 A;  3UX2 A;  2ZZN A;  4DR5 C;  1YGT A; 
#chains in the Genus database with same CATH homology
 1PG3 A;  3B7W A;  4DCS A;  1PA4 A;  4G1I A;  2D7V A;  1KKG A;  2UU9 C;  2P2J A;  3T1Y C;  5BSU A;  1YJ7 A;  5BSR A;  2VQE C;  1HNW C;  5T8T A;  1HNZ C;  4BSZ A;  4ZJZ A;  3SO4 A;  1MDF A;  4WS9 A;  3GR1 A;  4DV3 C;  2PN2 A;  2VZE A;  2UUC C;  5LMU C;  3GKU A;  3A9U A;  2QL8 A;  1JOS A;  4X65 C;  4B3R C;  5BUR A;  1XRC A;  4D4G A;  2ASB A;  1PG4 A;  4LFC C;  5K8F A;  3IML A;  2PT7 G;  3PBK A;  4DV4 C;  5AE3 A;  4WV3 A;  1O93 A;  2P2Q A;  3OTO C;  2ONF A;  1XMO C;  3N2Q A;  3DLP X;  4GXR A;  4FUQ A;  3ETO A;  3UOW A;  4D4I A;  1N36 C;  2UUA C;  1LCI A;  2OPL B;  1ML8 A;  1USP B;  4JI8 C;  2D1T A;  2Y27 A;  4DUZ C;  4LF9 C;  1WF3 A;  3EER A;  4JM1 A;  2YWC A;  3DHV A;  2UUB C;  5ADZ A;  4DG8 A;  2KZF A;  5KYV A;  2PRO A;  4LFB C;  1N2F A;  3N54 B;  4LF5 C;  3CW9 A;  3VNR A;  1N34 C;  4OX9 C;  5H9U A;  1HH2 P;  4BC9 A;  4GXQ A;  4JI7 C;  3CJE A;  3NPD A;  5A1I A;  5JRH A;  4DCT A;  4RLF A;  4PRO C;  4I9G A;  5FLX D;  1MXA A;  1QWI A;  4NXM C;  4RLQ A;  1ULT A;  3J7A D;  2VSQ A;  4K0K C;  1LQL A;  5KYT A;  4DCU A;  3G7S A;  3LUS A;  4FUT A;  4LF4 C;  3H2T A;  2OO4 A;  1AMU A;  5GTD A;  3R44 A;  4JI1 C;  4X66 C;  4MH4 A;  2VQF C;  1ZB8 A;  2AYA A;  4BBY A;  4AQY C;  1GPM A;  3GPC A;  1MXB A;  1O90 A;  4D57 A;  4GKJ C;  5BSV A;  4JI4 C;  5T8S A;  4X64 C;  4YHH C;  4NOZ A;  1IBK C;  3TDE A;  1IBM C;  4L2Z A;  2D27 A;  2E7G A;  5A1G A;  3AF6 A;  4B3M C;  3E7W A;  5IFI A;  4PZP A;  4DR2 C;  4IZ6 A;  5BUS A;  1FUG A;  2EGT A;  2HHH C;  3CW8 X;  2JMP A;  4JYA C;  2UXC C;  5BSM A;  1XRB A;  2D1Q A;  3S82 A;  3J81 D;  3RG2 A;  3IEV A;  1RY2 A;  3JAM D;  3T1H C;  2D1R A;  2E8F A;  2ATW A;  1UKK A;  1ZB9 A;  3ETC A;  2F4V C;  4KTV A;  4G36 A;  2UXD C;  1XNQ C;  4HPV A;  1N33 C;  4I9F A;  4NXN C;  4DR1 C;  4MTN A;  4JI3 C;  2P2B A;  3LNV A;  4FTF A;  2QVX X;  4JI0 C;  5BR8 C;  4DV1 C;  1HR0 C;  3NYQ A;  3GR0 A;  4DV7 C;  3LAX A;  1BA3 A;  3L8C A;  2BJO A;  4JI5 C;  3FCC A;  1J5E C;  3TUF A;  3NYR A;  1MDB A;  3TQI A;  4PHT A;  3R9X A;  1USP A;  2CXC A;  3AF5 A;  5A2Q D;  1L2F A;  1XNR C;  4R1M A;  1XMQ C;  5CZV A;  3RV2 A;  4EAT A;  1QM4 A;  4GKK C;  5E7Q A;  2P20 A;  4DV2 C;  2WD9 A;  5CZX A;  4LF6 C;  4JI2 C;  5BST A;  2P2M A;  4OXI A;  5IT9 D;  3A4I A;  4XX2 A;  4BCA A;  1RG9 A;  4JV5 C;  4U5Y D;  2Y4N A;  4DR4 C;  1EGA A;  4DCV A;  2XR1 A;  2P2F A;  3I07 A;  5KEI A;  1P7L A;  4DR7 C;  1K0R A;  4ISB A;  4LFA C;  2V7B A;  2E8E A;  4KTT A;  4GS5 A;  1MKY A;  4KHP C;  4B3T C;  2CY1 A;  5A19 A;  2Y4O A;  3DAY A;  1MD9 A;  2HJG A;  1N32 C;  1O9T A;  4JI6 C;  2ZM6 C;  1T5H X;  2DYJ A;  3R9W A;  4YY3 C;  1MXC A;  2P02 A;  1FJG C;  4RVO A;  5DV9 A;  3C5E A;  1HNX C;  4LF8 C;  3FCE A;  3IEU A;  2DPL A;  4RM2 A;  4RVN A;  3L95 X;  2YWB A;  4DV0 C;  4L4Q A;  4X62 C;  4DV6 C;  4B3S C;  2UXB C;  3IPL A;  2QW0 X;  2E0G A;  3PES A;  4LE5 A;  4BC7 A;  4NDN A;  3VNS A;  3I08 A;  2D28 C;  4K0B A;  1WH9 A;  2BH1 X;  1I94 C;  4DR6 C;  3E7X A;  3UZ0 A;  1V26 A;  5LMN C;  2YCB A;  1VLA A;  3LGX A;  4DG9 A;  3VNQ A;  2OBV A;  3J80 D;  2WP0 C;  4IR7 A;  3KXW A;  1XRA A;  4RMN A;  2OPL A;  4DR3 C;  4R0M A;  5AE1 A;  4G37 A;  2E8C A;  3NI2 A;  4R1L A;  5BSW A;  2QVY X;  2QVZ X;  1IBL C;  5BUQ A;  3A9V A;  4DUY C;  4ZLP A;  5K85 A;  3PRO C;  4TPS B;  5IWA C;  1NYE A;  2D1S A;  1O92 A;  1T5D X;  4D56 A;  3EQ6 A;  4L7I A;  5AE2 A;  1V25 A;  4LF7 C;  2E5L C;  4OYC A;  4DV5 C;  4ODJ A;  4RM3 A;  4DR5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...