2HHHC

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2hhhC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2hhhC02
1J5EC 2UUBC 4K0KC 1XNQC 4DCSA 3JAMD 4JI1C 2E7GA 2ATWA 4JI2C 1WF3A 2JMPA 2ONFA 4JI5C 1XMOC 2ZM6C 4LFAC 3J7AD 4DCVA 1KKGA 1LQLA 5A2QD 3J81D 2VQEC 3IEUA 1HNZC 4DCTA 2UUCC 2E8FA 1I94C 3I07A 2HHHC 1ZB8A 1ML8A 2D7VA 2PT7G 4YY3C 4NXMC 4LF9C 5IT9D 2CY1A 3OTOC 1XNRC 2UU9C 4GKJC 4X64C 4B3RC 4DV5C 4DCUA 4JI8C 3T1HC 3R9WA 2UXDC 4X65C 3R9XA 2E8CA 2VQFC 4DR7C 5BR8C 4JI7C 2ASBA 2OPLA 2DYJA 1WH9A 3GKUA 3J80D 4JI4C 2UUAC 1N33C 4DV6C 5LMUC 1EGAA 4NXNC 4YHHC 2BJOA 3LUSA 4DV7C 1HR0C 1USPA 3CJEA 1N34C 2PN2A 1XMQC 4NOZA 4LF8C 2UXBC 4BSZA 4AQYC 2CXCA 5LMNC 1MKYA 4DR1C 1IBKC 1NYEA 1HNWC 4DR3C 4LF7C 1N32C 1USPB 4LFBC 1PA4A 4B3SC 4DR4C 2EGTA 1ZB9A 2XR1A 1L2FA 4DV4C 1VLAA 4X66C 4JI0C 1HNXC 1N36C 1QWIA 2OPLB 5IWAC 1IBLC 4DV0C 4MH4A 4DR2C 1IBMC 4DUZC 3AF6A 3T1YC 4JYAC 4LF6C 4LFCC 4B3MC 4DUYC 2YCBA 4LF5C 1FJGC 4DV2C 4MTNA 4OX9C 4JV5C 4JI6C 2E8EA 4X62C 2HJGA 1K0RA 4JI3C 2UXCC 3IEVA 2F4VC 2QL8A 1HH2P 4DV3C 4DR5C 1UKKA 5FLXD 4B3TC 3AF5A 1JOSA 4KHPC 2E5LC 2KZFA 1N2FA 4DV1C 4LF4C 4XX2A 4GKKC 4DR6C 3EERA
chains in the Genus database with same CATH superfamily
1XNQC 3NI2A 3ETCA 3JAMD 4JI1C 3LGXA 4LE5A 4D4IA 2YX1A 2JMPA 2YWBA 4D57A 1XMOC 4G36A 2P2FA 2M5HA 2P02A 3UZ0A 5AE2A 3J7AD 5BUQA 1HNZC 2JNVA 2MMAB 3EQ6A 2HHHC 1MXCA 5GTDA 1ML8A 3L8CA 3CW9A 4YY3C 3GPCA 3OTOC 1XNRC 2UU9C 2D28C 1XRAA 2NCLA 3TQIA 3RG2A 4DCUA 1T5HX 3FCEA 2E8CA 2VZEA 4L2ZA 2Y27A 5A1IA 1MXBA 2P2MA 4DR7C 4NDNA 1N33C 2D1QA 4D56A 4DV6C 1YGTA 4YHHC 3LUSA 4DV7C 3CJEA 1N34C 3NPDA 1XHJA 4LF8C 5LMNC 3DLPX 1HNWC 4DR3C 5JRHA 5DV9A 1N32C 1USPB 1PA4A 4DR4C 1MXAA 1GPMA 2MM9A 5BURA 2XR1A 1L2FA 1VLAA 4G1IA 4X66C 5KYVA 1XDXA 3UEBA 3L95X 3H2TA 4DUZC 1BA3A 5T8SA 3UX2A 4JYAC 4LF6C 2WP0C 2YCBA 1FJGC 4MTNA 4JI6C 4JI3C 2QL8A 4DR5C 3DHVA 3AF5A 4PUHA 3IPLA 5BUSA 4GXQA 2E5LC 2KZFA 2QW0X 4GKKC 4U5YD 3E7WA 4K0KC 4DCSA 4RMNA 2ATWA 4JI2C 3TDEA 1VEHA 1MDFA 2ONFA 2D27A 4LFAC 3KXWA 4L7IA 4DCVA 2VQEC 2AYAA 3TR3A 4DG8A 4DCTA 2UUCC 2E8FA 1WCJA 3I07A 3O2EA 5T8TA 1XRBA 4NXMC 4LF9C 1V26A 2CY1A 2PROA 2Y4NA 2UXDC 4OYCA 3R9XA 5CZXA 4ZLPA 2VQFC 5BR8C 4JI7C 2M5OA 4PUIA 4JI4C 3UOWA 5BSTA 2BJOA 1M6XC 5KYTA 3CQ2A 1PG4A 2PN2A 1XMQC 4NOZA 3E7XA 1QM4A 4WS9A 5BSMA 2CXCA 1MKYA 1V25A 4DR1C 1IBKC 1NYEA 3LNVA 4LF7C 4FUQA 4B3SC 2QVYX 3A25A 4DV4C 4L4QA 1HNXC 1XRCA 4I9FA 2DPLA 1NY8A 4DR2C 1IBMC 4FUTA 3AF6A 3T1YC 3A9VA 1O92A 1AMUA 4LFCC 2WD9A 4OX9C 5BSVA 1M6XA 4RLQA 4RVNA 5A19A 4KHPC 4IR7A 4ODJA 4RM2A 2ZTBA 4XX2A 2P20A 3PROC 4R1MA 1RG9A 2E7GA 2OBVA 2YWCA 2Y4OA 4JI5C 3TUFA 4K0BA 3A26A 3VNRA 5A2QD 3B7WA 4RLFA 1ULTA 3RV2A 4ZJZA 2BH1X 3FCCA 2QVXX 3S82A 5KEIA 4OXIA 3VNSA 1P7LA 3CQ1A 1XS3A 4PROC 5IT9D 4IZ6A 5K8FA 4ISBA 4GKJC 3R9WA 3R44A 4X65C 1O9TA 5IFIA 2DYJA 5BSRA 1UWDA 2UUAC 3CW8X 3AY0A 1HR0C 1USPA 4BSZA 2CU6A 4RM3A 4D4GA 3LAXA 4RVOA 2Z51A 4LFBC 4BC9A 5LCIA 5CZVA 2P2BA 4R1LA 1LCIA 4PUGA 2OO4A 4TPSB 5K85A 2OPLB 5IWAC 2QVZX 1IBLC 3I08A 4BC7A 3PBKA 1FUGA 4I9GA 4B3MC 3GR0A 4DUYC 4LF5C 4DV2C 4JV5C 2E8EA 4KTVA 3PESA 1K0RA 2P2QA 2KDNA 2UXCC 2D1SA 1PG3A 1IB8A 3K6RA 1UKKA 3VNQA 1JOSA 4HPVA 4EATA 4DV1C 2D1TA 3N2QA 4LF4C 4GS5A 4PHTA 1J5EC 2UUBC 2E0GA 3CQ3A 3UX3A 4FTFA 1WF3A 4PZPA 1V60A 3A9UA 2ZM6C 5AE3A 1KKGA 1LQLA 3J81D 1MDBA 3IEUA 1I94C 4BBYA 4G37A 5AE1A 4WV3A 1ZB8A 2D7VA 2PT7G 2DHMA 4X64C 4B3RC 4DV5C 5E7QA 4JI8C 3T1HC 5BSWA 2VSQA 2MCQA 1P4EC 2ASBA 2OPLA 3G7SA 1WH9A 3GKUA 3J80D 1O93A 4R0MA 5LMUC 1RY2A 1EGAA 3SO4A 4NXNC 3N54B 1PU1A 3LNOA 2UXBC 4AQYC 3DAYA 1P4EA 2P2JA 1O90A 4JM1A 3GR1A 4DG9A 1MD9A 4KTTA 2EGTA 3NYQA 1ZB9A 5H9UA 3ETOA 5BSUA 4JI0C 1N36C 1QWIA 2PG1E 4DV0C 1FLOA 2D1RA 4MH4A 1T5DX 1YJ7A 3FM7A 2ZZMA 3IMLA 2KZ0A 4X62C 2HJGA 3IEVA 1TH5A 3C5EA 3NYRA 2F4VC 1HH2P 5A1GA 2V7BA 4DV3C 4BCAA 5FLXD 4B3TC 3A4IA 2ZZNA 5ADZA 1N2FA 4GXRA 4DR6C 3EERA
chains in the Genus database with same CATH topology
1XNQC 3NI2A 3ETCA 3JAMD 4JI1C 3LGXA 4LE5A 4D4IA 2JMPA 2YWBA 4D57A 1XMOC 4G36A 2P2FA 2P02A 3UZ0A 5AE2A 3J7AD 5BUQA 1HNZC 3EQ6A 2HHHC 1MXCA 5GTDA 1ML8A 3L8CA 3CW9A 4YY3C 3GPCA 3OTOC 1XNRC 2UU9C 2D28C 1XRAA 3TQIA 3RG2A 4DCUA 1T5HX 3FCEA 2E8CA 2VZEA 4L2ZA 2Y27A 5A1IA 1MXBA 2P2MA 4DR7C 4NDNA 1N33C 2D1QA 4D56A 4DV6C 4YHHC 3LUSA 4DV7C 3CJEA 1N34C 3NPDA 4LF8C 5LMNC 3DLPX 1HNWC 4DR3C 5JRHA 5DV9A 1N32C 1USPB 1PA4A 4DR4C 1MXAA 1GPMA 5BURA 2XR1A 1L2FA 1VLAA 4G1IA 4X66C 5KYVA 3L95X 3H2TA 4DUZC 1BA3A 5T8SA 4JYAC 4LF6C 2WP0C 2YCBA 1FJGC 4MTNA 4JI6C 4JI3C 2QL8A 4DR5C 3DHVA 3AF5A 3IPLA 5BUSA 4GXQA 2E5LC 2KZFA 2QW0X 4GKKC 4U5YD 3E7WA 4K0KC 4DCSA 4RMNA 2ATWA 4JI2C 3TDEA 1MDFA 2ONFA 2D27A 4LFAC 3KXWA 4L7IA 4DCVA 2VQEC 2AYAA 4DG8A 4DCTA 2UUCC 2E8FA 3I07A 5T8TA 1XRBA 4NXMC 4LF9C 1V26A 2CY1A 2PROA 2Y4NA 2UXDC 4OYCA 3R9XA 5CZXA 4ZLPA 2VQFC 5BR8C 4JI7C 4JI4C 3UOWA 5BSTA 2BJOA 5KYTA 1PG4A 2PN2A 1XMQC 4NOZA 3E7XA 1QM4A 4WS9A 5BSMA 2CXCA 1MKYA 1V25A 4DR1C 1IBKC 1NYEA 3LNVA 4LF7C 4FUQA 4B3SC 2QVYX 4DV4C 4L4QA 1HNXC 1XRCA 4I9FA 2DPLA 4DR2C 1IBMC 4FUTA 3AF6A 3T1YC 3A9VA 1O92A 1AMUA 4LFCC 2WD9A 4OX9C 5BSVA 4RLQA 4RVNA 5A19A 4KHPC 4IR7A 4ODJA 4RM2A 4XX2A 2P20A 3PROC 4R1MA 1RG9A 2E7GA 2OBVA 2YWCA 2Y4OA 4JI5C 3TUFA 4K0BA 3VNRA 5A2QD 3B7WA 4RLFA 1ULTA 3RV2A 4ZJZA 2BH1X 3FCCA 2QVXX 3S82A 5KEIA 4OXIA 3VNSA 1P7LA 4PROC 5IT9D 4IZ6A 5K8FA 4ISBA 4GKJC 3R9WA 3R44A 4X65C 1O9TA 5IFIA 2DYJA 5BSRA 2UUAC 3CW8X 1HR0C 1USPA 4BSZA 4RM3A 4D4GA 3LAXA 4RVOA 4LFBC 4BC9A 5CZVA 2P2BA 4R1LA 1LCIA 2OO4A 4TPSB 5K85A 2OPLB 5IWAC 2QVZX 1IBLC 3I08A 4BC7A 3PBKA 1FUGA 4I9GA 4B3MC 3GR0A 4DUYC 4LF5C 4DV2C 4JV5C 2E8EA 4KTVA 3PESA 1K0RA 2P2QA 2UXCC 2D1SA 1PG3A 1UKKA 3VNQA 1JOSA 4HPVA 4EATA 4DV1C 4LF4C 2D1TA 3N2QA 4GS5A 4PHTA 1J5EC 2UUBC 2E0GA 4FTFA 1WF3A 4PZPA 3A9UA 2ZM6C 5AE3A 1KKGA 1LQLA 3J81D 1MDBA 3IEUA 1I94C 4BBYA 4G37A 5AE1A 4WV3A 1ZB8A 2D7VA 2PT7G 4X64C 4B3RC 4DV5C 5E7QA 4JI8C 3T1HC 5BSWA 2VSQA 2ASBA 2OPLA 3G7SA 1WH9A 3GKUA 3J80D 1O93A 4R0MA 5LMUC 1RY2A 1EGAA 3SO4A 4NXNC 3N54B 2UXBC 4AQYC 3DAYA 2P2JA 1O90A 4JM1A 3GR1A 4DG9A 1MD9A 4KTTA 2EGTA 3NYQA 1ZB9A 5H9UA 3ETOA 5BSUA 4JI0C 1N36C 1QWIA 4DV0C 2D1RA 4MH4A 1T5DX 1YJ7A 3IMLA 4X62C 2HJGA 3IEVA 3C5EA 3NYRA 2F4VC 1HH2P 5A1GA 2V7BA 4DV3C 4BCAA 5FLXD 4B3TC 3A4IA 5ADZA 1N2FA 4GXRA 4DR6C 3EERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E C;  2UUB C;  4K0K C;  1XNQ C;  4DCS A;  3JAM D;  4JI1 C;  2E7G A;  2ATW A;  4JI2 C;  1WF3 A;  2JMP A;  2ONF A;  4JI5 C;  1XMO C;  2ZM6 C;  4LFA C;  3J7A D;  4DCV A;  1KKG A;  1LQL A;  5A2Q D;  3J81 D;  2VQE C;  3IEU A;  1HNZ C;  4DCT A;  2UUC C;  2E8F A;  1I94 C;  3I07 A;  2HHH C;  1ZB8 A;  1ML8 A;  2D7V A;  2PT7 G;  4YY3 C;  4NXM C;  4LF9 C;  5IT9 D;  2CY1 A;  3OTO C;  1XNR C;  2UU9 C;  4GKJ C;  4X64 C;  4B3R C;  4DV5 C;  4DCU A;  4JI8 C;  3T1H C;  3R9W A;  2UXD C;  4X65 C;  3R9X A;  2E8C A;  2VQF C;  4DR7 C;  5BR8 C;  4JI7 C;  2ASB A;  2OPL A;  2DYJ A;  1WH9 A;  3GKU A;  3J80 D;  4JI4 C;  2UUA C;  1N33 C;  4DV6 C;  5LMU C;  1EGA A;  4NXN C;  4YHH C;  2BJO A;  3LUS A;  4DV7 C;  1HR0 C;  1USP A;  3CJE A;  1N34 C;  2PN2 A;  1XMQ C;  4NOZ A;  4LF8 C;  2UXB C;  4BSZ A;  4AQY C;  2CXC A;  5LMN C;  1MKY A;  4DR1 C;  1IBK C;  1NYE A;  1HNW C;  4DR3 C;  4LF7 C;  1N32 C;  1USP B;  4LFB C;  1PA4 A;  4B3S C;  4DR4 C;  2EGT A;  1ZB9 A;  2XR1 A;  1L2F A;  4DV4 C;  1VLA A;  4X66 C;  4JI0 C;  1HNX C;  1N36 C;  1QWI A;  2OPL B;  5IWA C;  1IBL C;  4DV0 C;  4MH4 A;  4DR2 C;  1IBM C;  4DUZ C;  3AF6 A;  3T1Y C;  4JYA C;  4LF6 C;  4LFC C;  4B3M C;  4DUY C;  2YCB A;  4LF5 C;  1FJG C;  4DV2 C;  4MTN A;  4OX9 C;  4JV5 C;  4JI6 C;  2E8E A;  4X62 C;  2HJG A;  1K0R A;  4JI3 C;  2UXC C;  3IEV A;  2F4V C;  2QL8 A;  1HH2 P;  4DV3 C;  4DR5 C;  1UKK A;  5FLX D;  4B3T C;  3AF5 A;  1JOS A;  4KHP C;  2E5L C;  2KZF A;  1N2F A;  4DV1 C;  4LF4 C;  4XX2 A;  4GKK C;  4DR6 C;  3EER A; 
#chains in the Genus database with same CATH topology
 1XNQ C;  3NI2 A;  3ETC A;  3JAM D;  4JI1 C;  3LGX A;  4LE5 A;  4D4I A;  2YX1 A;  2JMP A;  2YWB A;  4D57 A;  1XMO C;  4G36 A;  2P2F A;  2M5H A;  2P02 A;  3UZ0 A;  5AE2 A;  3J7A D;  5BUQ A;  1HNZ C;  2JNV A;  2MMA B;  3EQ6 A;  2HHH C;  1MXC A;  5GTD A;  1ML8 A;  3L8C A;  3CW9 A;  4YY3 C;  3GPC A;  3OTO C;  1XNR C;  2UU9 C;  2D28 C;  1XRA A;  2NCL A;  3TQI A;  3RG2 A;  4DCU A;  1T5H X;  3FCE A;  2E8C A;  2VZE A;  4L2Z A;  2Y27 A;  5A1I A;  1MXB A;  2P2M A;  4DR7 C;  4NDN A;  1N33 C;  2D1Q A;  4D56 A;  4DV6 C;  1YGT A;  4YHH C;  3LUS A;  4DV7 C;  3CJE A;  1N34 C;  3NPD A;  1XHJ A;  4LF8 C;  5LMN C;  3DLP X;  1HNW C;  4DR3 C;  5JRH A;  5DV9 A;  1N32 C;  1USP B;  1PA4 A;  4DR4 C;  1MXA A;  1GPM A;  2MM9 A;  5BUR A;  2XR1 A;  1L2F A;  1VLA A;  4G1I A;  4X66 C;  5KYV A;  1XDX A;  3UEB A;  3L95 X;  3H2T A;  4DUZ C;  1BA3 A;  5T8S A;  3UX2 A;  4JYA C;  4LF6 C;  2WP0 C;  2YCB A;  1FJG C;  4MTN A;  4JI6 C;  4JI3 C;  2QL8 A;  4DR5 C;  3DHV A;  3AF5 A;  4PUH A;  3IPL A;  5BUS A;  4GXQ A;  2E5L C;  2KZF A;  2QW0 X;  4GKK C;  4U5Y D;  3E7W A;  4K0K C;  4DCS A;  4RMN A;  2ATW A;  4JI2 C;  3TDE A;  1VEH A;  1MDF A;  2ONF A;  2D27 A;  4LFA C;  3KXW A;  4L7I A;  4DCV A;  2VQE C;  2AYA A;  3TR3 A;  4DG8 A;  4DCT A;  2UUC C;  2E8F A;  1WCJ A;  3I07 A;  3O2E A;  5T8T A;  1XRB A;  4NXM C;  4LF9 C;  1V26 A;  2CY1 A;  2PRO A;  2Y4N A;  2UXD C;  4OYC A;  3R9X A;  5CZX A;  4ZLP A;  2VQF C;  5BR8 C;  4JI7 C;  2M5O A;  4PUI A;  4JI4 C;  3UOW A;  5BST A;  2BJO A;  1M6X C;  5KYT A;  3CQ2 A;  1PG4 A;  2PN2 A;  1XMQ C;  4NOZ A;  3E7X A;  1QM4 A;  4WS9 A;  5BSM A;  2CXC A;  1MKY A;  1V25 A;  4DR1 C;  1IBK C;  1NYE A;  3LNV A;  4LF7 C;  4FUQ A;  4B3S C;  2QVY X;  3A25 A;  4DV4 C;  4L4Q A;  1HNX C;  1XRC A;  4I9F A;  2DPL A;  1NY8 A;  4DR2 C;  1IBM C;  4FUT A;  3AF6 A;  3T1Y C;  3A9V A;  1O92 A;  1AMU A;  4LFC C;  2WD9 A;  4OX9 C;  5BSV A;  1M6X A;  4RLQ A;  4RVN A;  5A19 A;  4KHP C;  4IR7 A;  4ODJ A;  4RM2 A;  2ZTB A;  4XX2 A;  2P20 A;  3PRO C;  4R1M A;  1RG9 A;  2E7G A;  2OBV A;  2YWC A;  2Y4O A;  4JI5 C;  3TUF A;  4K0B A;  3A26 A;  3VNR A;  5A2Q D;  3B7W A;  4RLF A;  1ULT A;  3RV2 A;  4ZJZ A;  2BH1 X;  3FCC A;  2QVX X;  3S82 A;  5KEI A;  4OXI A;  3VNS A;  1P7L A;  3CQ1 A;  1XS3 A;  4PRO C;  5IT9 D;  4IZ6 A;  5K8F A;  4ISB A;  4GKJ C;  3R9W A;  3R44 A;  4X65 C;  1O9T A;  5IFI A;  2DYJ A;  5BSR A;  1UWD A;  2UUA C;  3CW8 X;  3AY0 A;  1HR0 C;  1USP A;  4BSZ A;  2CU6 A;  4RM3 A;  4D4G A;  3LAX A;  4RVO A;  2Z51 A;  4LFB C;  4BC9 A;  5LCI A;  5CZV A;  2P2B A;  4R1L A;  1LCI A;  4PUG A;  2OO4 A;  4TPS B;  5K85 A;  2OPL B;  5IWA C;  2QVZ X;  1IBL C;  3I08 A;  4BC7 A;  3PBK A;  1FUG A;  4I9G A;  4B3M C;  3GR0 A;  4DUY C;  4LF5 C;  4DV2 C;  4JV5 C;  2E8E A;  4KTV A;  3PES A;  1K0R A;  2P2Q A;  2KDN A;  2UXC C;  2D1S A;  1PG3 A;  1IB8 A;  3K6R A;  1UKK A;  3VNQ A;  1JOS A;  4HPV A;  4EAT A;  4DV1 C;  2D1T A;  3N2Q A;  4LF4 C;  4GS5 A;  4PHT A;  1J5E C;  2UUB C;  2E0G A;  3CQ3 A;  3UX3 A;  4FTF A;  1WF3 A;  4PZP A;  1V60 A;  3A9U A;  2ZM6 C;  5AE3 A;  1KKG A;  1LQL A;  3J81 D;  1MDB A;  3IEU A;  1I94 C;  4BBY A;  4G37 A;  5AE1 A;  4WV3 A;  1ZB8 A;  2D7V A;  2PT7 G;  2DHM A;  4X64 C;  4B3R C;  4DV5 C;  5E7Q A;  4JI8 C;  3T1H C;  5BSW A;  2VSQ A;  2MCQ A;  1P4E C;  2ASB A;  2OPL A;  3G7S A;  1WH9 A;  3GKU A;  3J80 D;  1O93 A;  4R0M A;  5LMU C;  1RY2 A;  1EGA A;  3SO4 A;  4NXN C;  3N54 B;  1PU1 A;  3LNO A;  2UXB C;  4AQY C;  3DAY A;  1P4E A;  2P2J A;  1O90 A;  4JM1 A;  3GR1 A;  4DG9 A;  1MD9 A;  4KTT A;  2EGT A;  3NYQ A;  1ZB9 A;  5H9U A;  3ETO A;  5BSU A;  4JI0 C;  1N36 C;  1QWI A;  2PG1 E;  4DV0 C;  1FLO A;  2D1R A;  4MH4 A;  1T5D X;  1YJ7 A;  3FM7 A;  2ZZM A;  3IML A;  2KZ0 A;  4X62 C;  2HJG A;  3IEV A;  1TH5 A;  3C5E A;  3NYR A;  2F4V C;  1HH2 P;  5A1G A;  2V7B A;  4DV3 C;  4BCA A;  5FLX D;  4B3T C;  3A4I A;  2ZZN A;  5ADZ A;  1N2F A;  4GXR A;  4DR6 C;  3EER A; 
#chains in the Genus database with same CATH homology
 1XNQ C;  3NI2 A;  3ETC A;  3JAM D;  4JI1 C;  3LGX A;  4LE5 A;  4D4I A;  2JMP A;  2YWB A;  4D57 A;  1XMO C;  4G36 A;  2P2F A;  2P02 A;  3UZ0 A;  5AE2 A;  3J7A D;  5BUQ A;  1HNZ C;  3EQ6 A;  2HHH C;  1MXC A;  5GTD A;  1ML8 A;  3L8C A;  3CW9 A;  4YY3 C;  3GPC A;  3OTO C;  1XNR C;  2UU9 C;  2D28 C;  1XRA A;  3TQI A;  3RG2 A;  4DCU A;  1T5H X;  3FCE A;  2E8C A;  2VZE A;  4L2Z A;  2Y27 A;  5A1I A;  1MXB A;  2P2M A;  4DR7 C;  4NDN A;  1N33 C;  2D1Q A;  4D56 A;  4DV6 C;  4YHH C;  3LUS A;  4DV7 C;  3CJE A;  1N34 C;  3NPD A;  4LF8 C;  5LMN C;  3DLP X;  1HNW C;  4DR3 C;  5JRH A;  5DV9 A;  1N32 C;  1USP B;  1PA4 A;  4DR4 C;  1MXA A;  1GPM A;  5BUR A;  2XR1 A;  1L2F A;  1VLA A;  4G1I A;  4X66 C;  5KYV A;  3L95 X;  3H2T A;  4DUZ C;  1BA3 A;  5T8S A;  4JYA C;  4LF6 C;  2WP0 C;  2YCB A;  1FJG C;  4MTN A;  4JI6 C;  4JI3 C;  2QL8 A;  4DR5 C;  3DHV A;  3AF5 A;  3IPL A;  5BUS A;  4GXQ A;  2E5L C;  2KZF A;  2QW0 X;  4GKK C;  4U5Y D;  3E7W A;  4K0K C;  4DCS A;  4RMN A;  2ATW A;  4JI2 C;  3TDE A;  1MDF A;  2ONF A;  2D27 A;  4LFA C;  3KXW A;  4L7I A;  4DCV A;  2VQE C;  2AYA A;  4DG8 A;  4DCT A;  2UUC C;  2E8F A;  3I07 A;  5T8T A;  1XRB A;  4NXM C;  4LF9 C;  1V26 A;  2CY1 A;  2PRO A;  2Y4N A;  2UXD C;  4OYC A;  3R9X A;  5CZX A;  4ZLP A;  2VQF C;  5BR8 C;  4JI7 C;  4JI4 C;  3UOW A;  5BST A;  2BJO A;  5KYT A;  1PG4 A;  2PN2 A;  1XMQ C;  4NOZ A;  3E7X A;  1QM4 A;  4WS9 A;  5BSM A;  2CXC A;  1MKY A;  1V25 A;  4DR1 C;  1IBK C;  1NYE A;  3LNV A;  4LF7 C;  4FUQ A;  4B3S C;  2QVY X;  4DV4 C;  4L4Q A;  1HNX C;  1XRC A;  4I9F A;  2DPL A;  4DR2 C;  1IBM C;  4FUT A;  3AF6 A;  3T1Y C;  3A9V A;  1O92 A;  1AMU A;  4LFC C;  2WD9 A;  4OX9 C;  5BSV A;  4RLQ A;  4RVN A;  5A19 A;  4KHP C;  4IR7 A;  4ODJ A;  4RM2 A;  4XX2 A;  2P20 A;  3PRO C;  4R1M A;  1RG9 A;  2E7G A;  2OBV A;  2YWC A;  2Y4O A;  4JI5 C;  3TUF A;  4K0B A;  3VNR A;  5A2Q D;  3B7W A;  4RLF A;  1ULT A;  3RV2 A;  4ZJZ A;  2BH1 X;  3FCC A;  2QVX X;  3S82 A;  5KEI A;  4OXI A;  3VNS A;  1P7L A;  4PRO C;  5IT9 D;  4IZ6 A;  5K8F A;  4ISB A;  4GKJ C;  3R9W A;  3R44 A;  4X65 C;  1O9T A;  5IFI A;  2DYJ A;  5BSR A;  2UUA C;  3CW8 X;  1HR0 C;  1USP A;  4BSZ A;  4RM3 A;  4D4G A;  3LAX A;  4RVO A;  4LFB C;  4BC9 A;  5CZV A;  2P2B A;  4R1L A;  1LCI A;  2OO4 A;  4TPS B;  5K85 A;  2OPL B;  5IWA C;  2QVZ X;  1IBL C;  3I08 A;  4BC7 A;  3PBK A;  1FUG A;  4I9G A;  4B3M C;  3GR0 A;  4DUY C;  4LF5 C;  4DV2 C;  4JV5 C;  2E8E A;  4KTV A;  3PES A;  1K0R A;  2P2Q A;  2UXC C;  2D1S A;  1PG3 A;  1UKK A;  3VNQ A;  1JOS A;  4HPV A;  4EAT A;  4DV1 C;  4LF4 C;  2D1T A;  3N2Q A;  4GS5 A;  4PHT A;  1J5E C;  2UUB C;  2E0G A;  4FTF A;  1WF3 A;  4PZP A;  3A9U A;  2ZM6 C;  5AE3 A;  1KKG A;  1LQL A;  3J81 D;  1MDB A;  3IEU A;  1I94 C;  4BBY A;  4G37 A;  5AE1 A;  4WV3 A;  1ZB8 A;  2D7V A;  2PT7 G;  4X64 C;  4B3R C;  4DV5 C;  5E7Q A;  4JI8 C;  3T1H C;  5BSW A;  2VSQ A;  2ASB A;  2OPL A;  3G7S A;  1WH9 A;  3GKU A;  3J80 D;  1O93 A;  4R0M A;  5LMU C;  1RY2 A;  1EGA A;  3SO4 A;  4NXN C;  3N54 B;  2UXB C;  4AQY C;  3DAY A;  2P2J A;  1O90 A;  4JM1 A;  3GR1 A;  4DG9 A;  1MD9 A;  4KTT A;  2EGT A;  3NYQ A;  1ZB9 A;  5H9U A;  3ETO A;  5BSU A;  4JI0 C;  1N36 C;  1QWI A;  4DV0 C;  2D1R A;  4MH4 A;  1T5D X;  1YJ7 A;  3IML A;  4X62 C;  2HJG A;  3IEV A;  3C5E A;  3NYR A;  2F4V C;  1HH2 P;  5A1G A;  2V7B A;  4DV3 C;  4BCA A;  5FLX D;  4B3T C;  3A4I A;  5ADZ A;  1N2F A;  4GXR A;  4DR6 C;  3EER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...