2HHHC

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2hhhC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2hhhC02
1QWIA 1ZB9A 2UXCC 4GKKC 4DV7C 4JI1C 2D7VA 1NYEA 1IBMC 1HH2P 1LQLA 4DR6C 4X65C 3GKUA 3AF5A 4JI3C 1N2FA 4YY3C 3AF6A 2VQEC 4DV0C 4JI6C 1HR0C 1WF3A 4LF7C 3JAMD 2YCBA 4JI8C 5LMUC 4DUZC 1PA4A 1FJGC 3CJEA 4DCUA 4JV5C 3LUSA 1HNWC 4LF4C 2VQFC 1ML8A 2UU9C 4DV4C 2E5LC 2E8EA 4B3MC 4LF6C 4DR5C 1XNQC 5IT9D 3OTOC 5LMNC 1WH9A 2PT7G 4MH4A 4MTNA 4DCVA 5BR8C 4AQYC 2CY1A 4X66C 2HJGA 2QL8A 2KZFA 1L2FA 2OPLB 1I94C 3EERA 4XX2A 4B3TC 2ZM6C 4GKJC 4JI5C 3R9WA 4JYAC 2UXDC 3IEVA 4X64C 3J80D 1USPB 4NOZA 1HNXC 2UUBC 2EGTA 2PN2A 2ATWA 4DR7C 4LFAC 2E8CA 2E8FA 3IEUA 4LF8C 4KHPC 4LFBC 1ZB8A 4LF5C 4X62C 4DR1C 4JI2C 4DV3C 1XMOC 4DR2C 1J5EC 4B3SC 1N32C 4DV6C 2DYJA 4JI4C 2XR1A 4DCSA 4DR4C 3T1HC 1KKGA 1MKYA 4DR3C 4DV2C 1K0RA 2ONFA 3J7AD 4JI0C 4DCTA 4YHHC 2UUAC 1EGAA 4B3RC 4K0KC 4BSZA 3R9XA 2UUCC 3T1YC 2CXCA 4NXMC 4LFCC 1JOSA 2JMPA 2OPLA 1UKKA 1VLAA 1XNRC 1N33C 4DUYC 1N36C 5A2QD 4DV1C 1IBKC 3I07A 1IBLC 2UXBC 1HNZC 1XMQC 1USPA 3J81D 4DV5C 4LF9C 4OX9C 5IWAC 1N34C 4NXNC 2F4VC 2E7GA 2ASBA 2HHHC 2BJOA 5FLXD 4JI7C
chains in the Genus database with same CATH superfamily
1M6XA 2WP0C 3FCEA 2UXCC 2QVXX 3S82A 4GKKC 4PHTA 3NYQA 4JI1C 1HH2P 3A4IA 4DR6C 3DLPX 4JI3C 4R0MA 1N2FA 2Z51A 2D1TA 2P2MA 3LNVA 1WF3A 4DG8A 3DHVA 1PA4A 2MMAB 3KXWA 5BURA 4HPVA 2VQFC 2YWBA 1TH5A 4U5YD 5LCIA 4RMNA 4RLFA 4MTNA 1XS3A 1WCJA 2KZFA 1L2FA 3EERA 3TR3A 4G36A 2QW0X 2ZM6C 5K8FA 1USPB 5ADZA 4PROC 3E7WA 3L95X 4LFBC 5KEIA 4X62C 1V26A 4RVNA 3K6RA 1J5EC 3N2QA 4B3SC 1N32C 4DV6C 2ZTBA 1AMUA 3EQ6A 1K0RA 2D28C 3TQIA 4B3RC 3R9XA 3T1YC 4GS5A 2OPLA 1XNRC 1YJ7A 1UWDA 3ETCA 2CU6A 5T8TA 1ULTA 4RVOA 1RY2A 5BUSA 4DV5C 4NXNC 3FCCA 2BJOA 3UX2A 3A26A 1ZB9A 4WV3A 1NYEA 5AE3A 1PU1A 3VNRA 3RG2A 4OYCA 4X65C 3AF6A 2VQEC 1LCIA 1HR0C 2Y4OA 5T8SA 1BA3A 2OO4A 2YCBA 3JAMD 2M5OA 4DUZC 2P2FA 4ZLPA 1HNWC 4ISBA 4NDNA 5CZVA 2UU9C 4D56A 1XNQC 1XDXA 4ZJZA 3OTOC 5LMNC 2JNVA 2PT7G 3LGXA 4DCVA 1P4EA 3VNQA 2KDNA 4X66C 2MM9A 3CW8X 4XX2A 4B3TC 3GR0A 3DAYA 3I08A 4JI5C 4IR7A 4JYAC 4BBYA 3J80D 3IMLA 3A9VA 4G1IA 2ATWA 4DR7C 4LFAC 2E8CA 3TDEA 4KHPC 4DV3C 2P2BA 1O90A 4DR4C 5KYVA 1KKGA 2Y4NA 3FM7A 2ONFA 2QVYX 3ETOA 4RM3A 4BC7A 3IPLA 2UUAC 2P2QA 4K0KC 2CXCA 2V7BA 4NXMC 1IB8A 4WS9A 1UKKA 4FUQA 1IBKC 1IBLC 2UXBC 1USPA 4OXIA 3UX3A 4OX9C 1N34C 3NYRA 4I9GA 2HHHC 3VNSA 4BC9A 5FLXD 4ODJA 4PZPA 2D27A 4DV7C 2D7VA 1LQLA 4D57A 2VZEA 3AF5A 4DV0C 1P7LA 3NPDA 4G37A 3H2TA 5BSTA 5LMUC 1FJGC 3AY0A 1M6XC 2WD9A 1T5HX 5H9UA 4JV5C 1RG9A 4LF4C 3PESA 4DV4C 2E5LC 3GR1A 1T5DX 2E8EA 1XRBA 4LF6C 4FTFA 1P4EC 2D1QA 1PG4A 3SO4A 2NCLA 5BR8C 5BSRA 3LAXA 2QL8A 5K85A 2ZZNA 2P20A 2UXDC 2KZ0A 1XHJA 4NOZA 2EGTA 5KYTA 4RLQA 5DV9A 1XRAA 2E8FA 3IEUA 5IFIA 3L8CA 1QM4A 4LF5C 1XMOC 2DYJA 4RM2A 4BCAA 2ZZMA 1MXBA 3CQ3A 4IZ6A 1XRCA 4DV2C 3UZ0A 4JI0C 4DCTA 4YHHC 1O92A 2DPLA 1EGAA 4BSZA 2UUCC 4LFCC 1JOSA 4K0BA 3TUFA 2VSQA 1GPMA 4DUYC 4FUTA 1N36C 5A2QD 4DV1C 4L7IA 1XMQC 1VEHA 1MXCA 1MXAA 4LF9C 4GXQA 5IWAC 2F4VC 2OBVA 2DHMA 2E7GA 3G7SA 4L2ZA 2P02A 1QWIA 1YGTA 1O93A 3R44A 1IBMC 4JM1A 1V25A 4R1MA 4TPSB 3GKUA 4PUIA 4D4GA 5AE2A 4YY3C 4JI6C 4PUGA 4LF7C 4PUHA 4KTTA 4JI8C 3C5EA 3A25A 5JRHA 1FUGA 3CJEA 4DCUA 3LUSA 1ML8A 5BSWA 3LNOA 4KTVA 4B3MC 5BSVA 3PBKA 4DR5C 1MDBA 2D1RA 2PROA 5AE1A 2YWCA 5IT9D 3CQ2A 2YX1A 1WH9A 3E7XA 2QVZX 3O2EA 5BSUA 4MH4A 4DG9A 4AQYC 2CY1A 1O9TA 2HJGA 2Y27A 5E7QA 2OPLB 1I94C 1V60A 3RV2A 5A1GA 4GKJC 3R9WA 3IEVA 4X64C 3PROC 3UOWA 4GXRA 2D1SA 1HNXC 2UUBC 4D4IA 2PN2A 5BSMA 2P2JA 4L4QA 4LF8C 1NY8A 2MCQA 5A19A 1ZB8A 4DR1C 4JI2C 4LE5A 4DR2C 3CQ1A 5GTDA 1PG3A 3NI2A 4I9FA 3A9UA 4EATA 3GPCA 2XR1A 4JI4C 4DCSA 5A1IA 3T1HC 1MKYA 4DR3C 3J7AD 3N54B 5CZXA 2PG1E 4R1LA 5BUQA 3UEBA 1MD9A 3CW9A 2JMPA 1VLAA 1N33C 1MDFA 3I07A 1HNZC 2BH1X 2M5HA 2E0GA 3J81D 3B7WA 1FLOA 2ASBA 2AYAA 4JI7C
chains in the Genus database with same CATH topology
2WP0C 3FCEA 2UXCC 2QVXX 3S82A 4GKKC 4PHTA 3NYQA 4JI1C 1HH2P 3A4IA 4DR6C 3DLPX 4JI3C 4R0MA 1N2FA 2D1TA 2P2MA 3LNVA 1WF3A 4DG8A 3DHVA 1PA4A 3KXWA 5BURA 4HPVA 2VQFC 2YWBA 4U5YD 4RMNA 4RLFA 4MTNA 2KZFA 1L2FA 3EERA 4G36A 2QW0X 2ZM6C 5K8FA 1USPB 5ADZA 4PROC 3E7WA 3L95X 4LFBC 5KEIA 4X62C 1V26A 4RVNA 1J5EC 3N2QA 4B3SC 1N32C 4DV6C 1AMUA 3EQ6A 1K0RA 2D28C 3TQIA 4B3RC 3R9XA 3T1YC 4GS5A 2OPLA 1XNRC 1YJ7A 3ETCA 5T8TA 1ULTA 4RVOA 1RY2A 5BUSA 4DV5C 4NXNC 3FCCA 2BJOA 1ZB9A 4WV3A 1NYEA 5AE3A 3VNRA 3RG2A 4OYCA 4X65C 3AF6A 2VQEC 1LCIA 1HR0C 2Y4OA 5T8SA 1BA3A 2OO4A 2YCBA 3JAMD 4DUZC 2P2FA 4ZLPA 1HNWC 4ISBA 4NDNA 5CZVA 2UU9C 4D56A 1XNQC 4ZJZA 3OTOC 5LMNC 2PT7G 3LGXA 4DCVA 3VNQA 4X66C 3CW8X 4XX2A 4B3TC 3GR0A 3DAYA 3I08A 4JI5C 4IR7A 4JYAC 4BBYA 3J80D 3IMLA 3A9VA 4G1IA 2ATWA 4DR7C 4LFAC 2E8CA 3TDEA 4KHPC 4DV3C 2P2BA 1O90A 4DR4C 5KYVA 1KKGA 2Y4NA 2ONFA 2QVYX 3ETOA 4RM3A 4BC7A 3IPLA 2UUAC 2P2QA 4K0KC 2CXCA 2V7BA 4NXMC 4WS9A 1UKKA 4FUQA 1IBKC 1IBLC 2UXBC 1USPA 4OXIA 4OX9C 1N34C 3NYRA 4I9GA 2HHHC 3VNSA 4BC9A 5FLXD 4ODJA 4PZPA 2D27A 4DV7C 2D7VA 1LQLA 4D57A 2VZEA 3AF5A 4DV0C 1P7LA 3NPDA 4G37A 3H2TA 5BSTA 5LMUC 1FJGC 2WD9A 1T5HX 5H9UA 4JV5C 1RG9A 4LF4C 3PESA 4DV4C 2E5LC 3GR1A 1T5DX 2E8EA 1XRBA 4LF6C 4FTFA 2D1QA 1PG4A 3SO4A 5BR8C 5BSRA 3LAXA 2QL8A 5K85A 2P20A 2UXDC 4NOZA 2EGTA 5KYTA 4RLQA 5DV9A 1XRAA 2E8FA 3IEUA 5IFIA 3L8CA 1QM4A 4LF5C 1XMOC 2DYJA 4RM2A 4BCAA 1MXBA 4IZ6A 1XRCA 4DV2C 3UZ0A 4JI0C 4DCTA 4YHHC 1O92A 2DPLA 1EGAA 4BSZA 2UUCC 4LFCC 1JOSA 4K0BA 3TUFA 2VSQA 1GPMA 4DUYC 4FUTA 1N36C 5A2QD 4DV1C 4L7IA 1XMQC 1MXCA 1MXAA 4LF9C 4GXQA 5IWAC 2F4VC 2OBVA 2E7GA 3G7SA 4L2ZA 2P02A 1QWIA 1O93A 3R44A 1IBMC 4JM1A 1V25A 4R1MA 4TPSB 3GKUA 4D4GA 5AE2A 4YY3C 4JI6C 4LF7C 4KTTA 4JI8C 3C5EA 5JRHA 1FUGA 3CJEA 4DCUA 3LUSA 1ML8A 5BSWA 4KTVA 4B3MC 5BSVA 3PBKA 4DR5C 1MDBA 2D1RA 2PROA 5AE1A 2YWCA 5IT9D 1WH9A 3E7XA 2QVZX 5BSUA 4MH4A 4DG9A 4AQYC 2CY1A 1O9TA 2HJGA 2Y27A 5E7QA 2OPLB 1I94C 3RV2A 5A1GA 4GKJC 3R9WA 3IEVA 4X64C 3PROC 3UOWA 4GXRA 2D1SA 1HNXC 2UUBC 4D4IA 2PN2A 5BSMA 2P2JA 4L4QA 4LF8C 5A19A 1ZB8A 4DR1C 4JI2C 4LE5A 4DR2C 5GTDA 1PG3A 3NI2A 4I9FA 3A9UA 4EATA 3GPCA 2XR1A 4JI4C 4DCSA 5A1IA 3T1HC 1MKYA 4DR3C 3J7AD 3N54B 5CZXA 4R1LA 5BUQA 1MD9A 3CW9A 2JMPA 1VLAA 1N33C 1MDFA 3I07A 1HNZC 2BH1X 2E0GA 3J81D 3B7WA 2ASBA 2AYAA 4JI7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QWI A;  1ZB9 A;  2UXC C;  4GKK C;  4DV7 C;  4JI1 C;  2D7V A;  1NYE A;  1IBM C;  1HH2 P;  1LQL A;  4DR6 C;  4X65 C;  3GKU A;  3AF5 A;  4JI3 C;  1N2F A;  4YY3 C;  3AF6 A;  2VQE C;  4DV0 C;  4JI6 C;  1HR0 C;  1WF3 A;  4LF7 C;  3JAM D;  2YCB A;  4JI8 C;  5LMU C;  4DUZ C;  1PA4 A;  1FJG C;  3CJE A;  4DCU A;  4JV5 C;  3LUS A;  1HNW C;  4LF4 C;  2VQF C;  1ML8 A;  2UU9 C;  4DV4 C;  2E5L C;  2E8E A;  4B3M C;  4LF6 C;  4DR5 C;  1XNQ C;  5IT9 D;  3OTO C;  5LMN C;  1WH9 A;  2PT7 G;  4MH4 A;  4MTN A;  4DCV A;  5BR8 C;  4AQY C;  2CY1 A;  4X66 C;  2HJG A;  2QL8 A;  2KZF A;  1L2F A;  2OPL B;  1I94 C;  3EER A;  4XX2 A;  4B3T C;  2ZM6 C;  4GKJ C;  4JI5 C;  3R9W A;  4JYA C;  2UXD C;  3IEV A;  4X64 C;  3J80 D;  1USP B;  4NOZ A;  1HNX C;  2UUB C;  2EGT A;  2PN2 A;  2ATW A;  4DR7 C;  4LFA C;  2E8C A;  2E8F A;  3IEU A;  4LF8 C;  4KHP C;  4LFB C;  1ZB8 A;  4LF5 C;  4X62 C;  4DR1 C;  4JI2 C;  4DV3 C;  1XMO C;  4DR2 C;  1J5E C;  4B3S C;  1N32 C;  4DV6 C;  2DYJ A;  4JI4 C;  2XR1 A;  4DCS A;  4DR4 C;  3T1H C;  1KKG A;  1MKY A;  4DR3 C;  4DV2 C;  1K0R A;  2ONF A;  3J7A D;  4JI0 C;  4DCT A;  4YHH C;  2UUA C;  1EGA A;  4B3R C;  4K0K C;  4BSZ A;  3R9X A;  2UUC C;  3T1Y C;  2CXC A;  4NXM C;  4LFC C;  1JOS A;  2JMP A;  2OPL A;  1UKK A;  1VLA A;  1XNR C;  1N33 C;  4DUY C;  1N36 C;  5A2Q D;  4DV1 C;  1IBK C;  3I07 A;  1IBL C;  2UXB C;  1HNZ C;  1XMQ C;  1USP A;  3J81 D;  4DV5 C;  4LF9 C;  4OX9 C;  5IWA C;  1N34 C;  4NXN C;  2F4V C;  2E7G A;  2ASB A;  2HHH C;  2BJO A;  5FLX D;  4JI7 C; 
#chains in the Genus database with same CATH topology
 1M6X A;  2WP0 C;  3FCE A;  2UXC C;  2QVX X;  3S82 A;  4GKK C;  4PHT A;  3NYQ A;  4JI1 C;  1HH2 P;  3A4I A;  4DR6 C;  3DLP X;  4JI3 C;  4R0M A;  1N2F A;  2Z51 A;  2D1T A;  2P2M A;  3LNV A;  1WF3 A;  4DG8 A;  3DHV A;  1PA4 A;  2MMA B;  3KXW A;  5BUR A;  4HPV A;  2VQF C;  2YWB A;  1TH5 A;  4U5Y D;  5LCI A;  4RMN A;  4RLF A;  4MTN A;  1XS3 A;  1WCJ A;  2KZF A;  1L2F A;  3EER A;  3TR3 A;  4G36 A;  2QW0 X;  2ZM6 C;  5K8F A;  1USP B;  5ADZ A;  4PRO C;  3E7W A;  3L95 X;  4LFB C;  5KEI A;  4X62 C;  1V26 A;  4RVN A;  3K6R A;  1J5E C;  3N2Q A;  4B3S C;  1N32 C;  4DV6 C;  2ZTB A;  1AMU A;  3EQ6 A;  1K0R A;  2D28 C;  3TQI A;  4B3R C;  3R9X A;  3T1Y C;  4GS5 A;  2OPL A;  1XNR C;  1YJ7 A;  1UWD A;  3ETC A;  2CU6 A;  5T8T A;  1ULT A;  4RVO A;  1RY2 A;  5BUS A;  4DV5 C;  4NXN C;  3FCC A;  2BJO A;  3UX2 A;  3A26 A;  1ZB9 A;  4WV3 A;  1NYE A;  5AE3 A;  1PU1 A;  3VNR A;  3RG2 A;  4OYC A;  4X65 C;  3AF6 A;  2VQE C;  1LCI A;  1HR0 C;  2Y4O A;  5T8S A;  1BA3 A;  2OO4 A;  2YCB A;  3JAM D;  2M5O A;  4DUZ C;  2P2F A;  4ZLP A;  1HNW C;  4ISB A;  4NDN A;  5CZV A;  2UU9 C;  4D56 A;  1XNQ C;  1XDX A;  4ZJZ A;  3OTO C;  5LMN C;  2JNV A;  2PT7 G;  3LGX A;  4DCV A;  1P4E A;  3VNQ A;  2KDN A;  4X66 C;  2MM9 A;  3CW8 X;  4XX2 A;  4B3T C;  3GR0 A;  3DAY A;  3I08 A;  4JI5 C;  4IR7 A;  4JYA C;  4BBY A;  3J80 D;  3IML A;  3A9V A;  4G1I A;  2ATW A;  4DR7 C;  4LFA C;  2E8C A;  3TDE A;  4KHP C;  4DV3 C;  2P2B A;  1O90 A;  4DR4 C;  5KYV A;  1KKG A;  2Y4N A;  3FM7 A;  2ONF A;  2QVY X;  3ETO A;  4RM3 A;  4BC7 A;  3IPL A;  2UUA C;  2P2Q A;  4K0K C;  2CXC A;  2V7B A;  4NXM C;  1IB8 A;  4WS9 A;  1UKK A;  4FUQ A;  1IBK C;  1IBL C;  2UXB C;  1USP A;  4OXI A;  3UX3 A;  4OX9 C;  1N34 C;  3NYR A;  4I9G A;  2HHH C;  3VNS A;  4BC9 A;  5FLX D;  4ODJ A;  4PZP A;  2D27 A;  4DV7 C;  2D7V A;  1LQL A;  4D57 A;  2VZE A;  3AF5 A;  4DV0 C;  1P7L A;  3NPD A;  4G37 A;  3H2T A;  5BST A;  5LMU C;  1FJG C;  3AY0 A;  1M6X C;  2WD9 A;  1T5H X;  5H9U A;  4JV5 C;  1RG9 A;  4LF4 C;  3PES A;  4DV4 C;  2E5L C;  3GR1 A;  1T5D X;  2E8E A;  1XRB A;  4LF6 C;  4FTF A;  1P4E C;  2D1Q A;  1PG4 A;  3SO4 A;  2NCL A;  5BR8 C;  5BSR A;  3LAX A;  2QL8 A;  5K85 A;  2ZZN A;  2P20 A;  2UXD C;  2KZ0 A;  1XHJ A;  4NOZ A;  2EGT A;  5KYT A;  4RLQ A;  5DV9 A;  1XRA A;  2E8F A;  3IEU A;  5IFI A;  3L8C A;  1QM4 A;  4LF5 C;  1XMO C;  2DYJ A;  4RM2 A;  4BCA A;  2ZZM A;  1MXB A;  3CQ3 A;  4IZ6 A;  1XRC A;  4DV2 C;  3UZ0 A;  4JI0 C;  4DCT A;  4YHH C;  1O92 A;  2DPL A;  1EGA A;  4BSZ A;  2UUC C;  4LFC C;  1JOS A;  4K0B A;  3TUF A;  2VSQ A;  1GPM A;  4DUY C;  4FUT A;  1N36 C;  5A2Q D;  4DV1 C;  4L7I A;  1XMQ C;  1VEH A;  1MXC A;  1MXA A;  4LF9 C;  4GXQ A;  5IWA C;  2F4V C;  2OBV A;  2DHM A;  2E7G A;  3G7S A;  4L2Z A;  2P02 A;  1QWI A;  1YGT A;  1O93 A;  3R44 A;  1IBM C;  4JM1 A;  1V25 A;  4R1M A;  4TPS B;  3GKU A;  4PUI A;  4D4G A;  5AE2 A;  4YY3 C;  4JI6 C;  4PUG A;  4LF7 C;  4PUH A;  4KTT A;  4JI8 C;  3C5E A;  3A25 A;  5JRH A;  1FUG A;  3CJE A;  4DCU A;  3LUS A;  1ML8 A;  5BSW A;  3LNO A;  4KTV A;  4B3M C;  5BSV A;  3PBK A;  4DR5 C;  1MDB A;  2D1R A;  2PRO A;  5AE1 A;  2YWC A;  5IT9 D;  3CQ2 A;  2YX1 A;  1WH9 A;  3E7X A;  2QVZ X;  3O2E A;  5BSU A;  4MH4 A;  4DG9 A;  4AQY C;  2CY1 A;  1O9T A;  2HJG A;  2Y27 A;  5E7Q A;  2OPL B;  1I94 C;  1V60 A;  3RV2 A;  5A1G A;  4GKJ C;  3R9W A;  3IEV A;  4X64 C;  3PRO C;  3UOW A;  4GXR A;  2D1S A;  1HNX C;  2UUB C;  4D4I A;  2PN2 A;  5BSM A;  2P2J A;  4L4Q A;  4LF8 C;  1NY8 A;  2MCQ A;  5A19 A;  1ZB8 A;  4DR1 C;  4JI2 C;  4LE5 A;  4DR2 C;  3CQ1 A;  5GTD A;  1PG3 A;  3NI2 A;  4I9F A;  3A9U A;  4EAT A;  3GPC A;  2XR1 A;  4JI4 C;  4DCS A;  5A1I A;  3T1H C;  1MKY A;  4DR3 C;  3J7A D;  3N54 B;  5CZX A;  2PG1 E;  4R1L A;  5BUQ A;  3UEB A;  1MD9 A;  3CW9 A;  2JMP A;  1VLA A;  1N33 C;  1MDF A;  3I07 A;  1HNZ C;  2BH1 X;  2M5H A;  2E0G A;  3J81 D;  3B7W A;  1FLO A;  2ASB A;  2AYA A;  4JI7 C; 
#chains in the Genus database with same CATH homology
 2WP0 C;  3FCE A;  2UXC C;  2QVX X;  3S82 A;  4GKK C;  4PHT A;  3NYQ A;  4JI1 C;  1HH2 P;  3A4I A;  4DR6 C;  3DLP X;  4JI3 C;  4R0M A;  1N2F A;  2D1T A;  2P2M A;  3LNV A;  1WF3 A;  4DG8 A;  3DHV A;  1PA4 A;  3KXW A;  5BUR A;  4HPV A;  2VQF C;  2YWB A;  4U5Y D;  4RMN A;  4RLF A;  4MTN A;  2KZF A;  1L2F A;  3EER A;  4G36 A;  2QW0 X;  2ZM6 C;  5K8F A;  1USP B;  5ADZ A;  4PRO C;  3E7W A;  3L95 X;  4LFB C;  5KEI A;  4X62 C;  1V26 A;  4RVN A;  1J5E C;  3N2Q A;  4B3S C;  1N32 C;  4DV6 C;  1AMU A;  3EQ6 A;  1K0R A;  2D28 C;  3TQI A;  4B3R C;  3R9X A;  3T1Y C;  4GS5 A;  2OPL A;  1XNR C;  1YJ7 A;  3ETC A;  5T8T A;  1ULT A;  4RVO A;  1RY2 A;  5BUS A;  4DV5 C;  4NXN C;  3FCC A;  2BJO A;  1ZB9 A;  4WV3 A;  1NYE A;  5AE3 A;  3VNR A;  3RG2 A;  4OYC A;  4X65 C;  3AF6 A;  2VQE C;  1LCI A;  1HR0 C;  2Y4O A;  5T8S A;  1BA3 A;  2OO4 A;  2YCB A;  3JAM D;  4DUZ C;  2P2F A;  4ZLP A;  1HNW C;  4ISB A;  4NDN A;  5CZV A;  2UU9 C;  4D56 A;  1XNQ C;  4ZJZ A;  3OTO C;  5LMN C;  2PT7 G;  3LGX A;  4DCV A;  3VNQ A;  4X66 C;  3CW8 X;  4XX2 A;  4B3T C;  3GR0 A;  3DAY A;  3I08 A;  4JI5 C;  4IR7 A;  4JYA C;  4BBY A;  3J80 D;  3IML A;  3A9V A;  4G1I A;  2ATW A;  4DR7 C;  4LFA C;  2E8C A;  3TDE A;  4KHP C;  4DV3 C;  2P2B A;  1O90 A;  4DR4 C;  5KYV A;  1KKG A;  2Y4N A;  2ONF A;  2QVY X;  3ETO A;  4RM3 A;  4BC7 A;  3IPL A;  2UUA C;  2P2Q A;  4K0K C;  2CXC A;  2V7B A;  4NXM C;  4WS9 A;  1UKK A;  4FUQ A;  1IBK C;  1IBL C;  2UXB C;  1USP A;  4OXI A;  4OX9 C;  1N34 C;  3NYR A;  4I9G A;  2HHH C;  3VNS A;  4BC9 A;  5FLX D;  4ODJ A;  4PZP A;  2D27 A;  4DV7 C;  2D7V A;  1LQL A;  4D57 A;  2VZE A;  3AF5 A;  4DV0 C;  1P7L A;  3NPD A;  4G37 A;  3H2T A;  5BST A;  5LMU C;  1FJG C;  2WD9 A;  1T5H X;  5H9U A;  4JV5 C;  1RG9 A;  4LF4 C;  3PES A;  4DV4 C;  2E5L C;  3GR1 A;  1T5D X;  2E8E A;  1XRB A;  4LF6 C;  4FTF A;  2D1Q A;  1PG4 A;  3SO4 A;  5BR8 C;  5BSR A;  3LAX A;  2QL8 A;  5K85 A;  2P20 A;  2UXD C;  4NOZ A;  2EGT A;  5KYT A;  4RLQ A;  5DV9 A;  1XRA A;  2E8F A;  3IEU A;  5IFI A;  3L8C A;  1QM4 A;  4LF5 C;  1XMO C;  2DYJ A;  4RM2 A;  4BCA A;  1MXB A;  4IZ6 A;  1XRC A;  4DV2 C;  3UZ0 A;  4JI0 C;  4DCT A;  4YHH C;  1O92 A;  2DPL A;  1EGA A;  4BSZ A;  2UUC C;  4LFC C;  1JOS A;  4K0B A;  3TUF A;  2VSQ A;  1GPM A;  4DUY C;  4FUT A;  1N36 C;  5A2Q D;  4DV1 C;  4L7I A;  1XMQ C;  1MXC A;  1MXA A;  4LF9 C;  4GXQ A;  5IWA C;  2F4V C;  2OBV A;  2E7G A;  3G7S A;  4L2Z A;  2P02 A;  1QWI A;  1O93 A;  3R44 A;  1IBM C;  4JM1 A;  1V25 A;  4R1M A;  4TPS B;  3GKU A;  4D4G A;  5AE2 A;  4YY3 C;  4JI6 C;  4LF7 C;  4KTT A;  4JI8 C;  3C5E A;  5JRH A;  1FUG A;  3CJE A;  4DCU A;  3LUS A;  1ML8 A;  5BSW A;  4KTV A;  4B3M C;  5BSV A;  3PBK A;  4DR5 C;  1MDB A;  2D1R A;  2PRO A;  5AE1 A;  2YWC A;  5IT9 D;  1WH9 A;  3E7X A;  2QVZ X;  5BSU A;  4MH4 A;  4DG9 A;  4AQY C;  2CY1 A;  1O9T A;  2HJG A;  2Y27 A;  5E7Q A;  2OPL B;  1I94 C;  3RV2 A;  5A1G A;  4GKJ C;  3R9W A;  3IEV A;  4X64 C;  3PRO C;  3UOW A;  4GXR A;  2D1S A;  1HNX C;  2UUB C;  4D4I A;  2PN2 A;  5BSM A;  2P2J A;  4L4Q A;  4LF8 C;  5A19 A;  1ZB8 A;  4DR1 C;  4JI2 C;  4LE5 A;  4DR2 C;  5GTD A;  1PG3 A;  3NI2 A;  4I9F A;  3A9U A;  4EAT A;  3GPC A;  2XR1 A;  4JI4 C;  4DCS A;  5A1I A;  3T1H C;  1MKY A;  4DR3 C;  3J7A D;  3N54 B;  5CZX A;  4R1L A;  5BUQ A;  1MD9 A;  3CW9 A;  2JMP A;  1VLA A;  1N33 C;  1MDF A;  3I07 A;  1HNZ C;  2BH1 X;  2E0G A;  3J81 D;  3B7W A;  2ASB A;  2AYA A;  4JI7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...