4NXMC

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 47
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4nxmC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4nxmC02
4JYAC 1I94C 2D7VA 4DV3C 4LF8C 2UXDC 1N36C 1HR0C 1ZB9A 3GKUA 3R9XA 2JMPA 1XMOC 4LF4C 2ATWA 4JV5C 1N33C 4JI8C 3JAMD 3EERA 3J81D 5IWAC 2PN2A 2UUAC 4AQYC 4B3SC 1EGAA 4DR7C 1ML8A 4DR2C 1IBMC 4KHPC 1HNXC 4DUYC 1HNWC 4DCVA 2EGTA 4LFCC 5IT9D 3LUSA 2CXCA 4GKKC 5BR8C 4JI0C 2UXBC 4XX2A 4YHHC 4LF9C 5LMUC 4JI5C 2ASBA 4DCSA 2YCBA 1UKKA 2E7GA 2HHHC 4DCTA 4DUZC 2OPLA 1HH2P 4MTNA 4DV0C 5FLXD 4DR5C 2VQEC 4DV1C 4JI2C 4BSZA 2BJOA 1HNZC 2UXCC 4DV2C 1QWIA 4DR4C 3CJEA 1N32C 1XNRC 4DV4C 1KKGA 1WH9A 3T1HC 2CY1A 2ONFA 2XR1A 2HJGA 1XNQC 2E5LC 1LQLA 2PT7G 3AF5A 1JOSA 1VLAA 2KZFA 5LMNC 2E8FA 4JI6C 4JI7C 4DR1C 2QL8A 4JI1C 4NXNC 1FJGC 2UUCC 4B3RC 2DYJA 1L2FA 4JI4C 2OPLB 3OTOC 4DR3C 1N34C 4DCUA 4LF5C 1MKYA 1USPA 3IEVA 4DV7C 1NYEA 5A2QD 3I07A 2E8CA 4LF7C 2F4VC 4B3MC 3J7AD 1WF3A 1ZB8A 3J80D 4B3TC 4K0KC 4GKJC 1J5EC 3IEUA 4DV6C 4MH4A 1XMQC 2UUBC 1PA4A 4NXMC 1IBKC 1IBLC 4X62C 4X65C 4OX9C 4YY3C 4DV5C 1K0RA 2ZM6C 4DR6C 4LF6C 2UU9C 1N2FA 4X66C 4JI3C 2E8EA 4X64C 4LFAC 4LFBC 1USPB 3AF6A 2VQFC 3R9WA 3T1YC 4NOZA
chains in the Genus database with same CATH superfamily
2D7VA 3CQ3A 4DV3C 2YX1A 4ZLPA 2UXDC 4NDNA 1HR0C 3TUFA 1ZB9A 2D1RA 3GKUA 5BSRA 2P02A 3H2TA 5BSUA 3EERA 3A4IA 5ADZA 2UUAC 2PN2A 1M6XC 4DR7C 4KHPC 3A25A 3E7XA 3AY0A 2EGTA 2P2FA 3UEBA 2UXBC 3EQ6A 5LMUC 2MMAB 4KTVA 2ASBA 2YCBA 3VNQA 2NCLA 5A1GA 3N54B 2MM9A 1WCJA 4DV1C 4JI2C 3VNRA 1HNZC 2UXCC 5GTDA 1N32C 3S82A 3ETCA 1KKGA 1PU1A 2P2JA 5KEIA 4LE5A 2E5LC 1LQLA 1VLAA 3O2EA 1XS3A 4JI6C 2OBVA 2QL8A 4NXNC 4B3RC 4R1MA 4JI4C 5K8FA 4RMNA 4RLFA 1N34C 1FLOA 2YWCA 1NYEA 1XHJA 2F4VC 3UX3A 1WF3A 3NI2A 5DV9A 1YJ7A 4MH4A 4ZJZA 3PBKA 1O90A 2M5OA 4X62C 4RM2A 2D28C 5BSWA 2UU9C 4JI3C 2E8EA 3KXWA 4LFAC 4RM3A 2KDNA 1USPB 1UWDA 2D27A 3R9WA 3T1YC 2PG1E 1I94C 3G7SA 1N36C 4L7IA 1T5HX 2VZEA 1PG4A 3CQ2A 2JMPA 1XMOC 4JM1A 1XRAA 1N33C 4JI8C 3JAMD 3IMLA 3FM7A 3J81D 3TDEA 1ML8A 1IBMC 4RVOA 1VEHA 1HNXC 2D1QA 2M5HA 4OYCA 4GKKC 4XX2A 3NYQA 5BUQA 3C5EA 4DCSA 1XRBA 4D4GA 4MTNA 3TR3A 5FLXD 3LGXA 4DV2C 2QW0X 4DV4C 3GR1A 1WH9A 1V26A 1MXAA 2ONFA 3A9UA 1O93A 2E8FA 3IPLA 5BSVA 4JI7C 5KYTA 5T8TA 5A1IA 2BH1X 5BSTA 2OPLB 4D56A 4DCUA 4LF5C 5BUSA 3FCCA 1USPA 3IEVA 2WD9A 2E8CA 1XDXA 3J7AD 4D57A 3LNOA 1O92A 5CZVA 1V25A 2KZ0A 3E7WA 4G37A 4L2ZA 4K0KC 4GKJC 1J5EC 1XMQC 2UUBC 1LCIA 1PA4A 1IBKC 5AE2A 2QVXX 1TH5A 4X65C 4DV5C 2PROA 2YWBA 3TQIA 3DHVA 4U5YD 4RLQA 4PROC 2ZTBA 3NYRA 2D1SA 1MDBA 3A26A 2ATWA 2D1TA 4JV5C 2ZZNA 4AQYC 4B3SC 3CW9A 4FUTA 4PZPA 1P4EA 5LCIA 3LUSA 2P2BA 5BR8C 4JI0C 4YHHC 5AE1A 4JI5C 1UKKA 3L8CA 2HHHC 4DUZC 2OPLA 4DV0C 1ULTA 2BJOA 4WS9A 3DAYA 1QWIA 4DR4C 3VNSA 1XNRC 3T1HC 2VSQA 2CY1A 3LNVA 2HJGA 2PT7G 1JOSA 1MDFA 3K6RA 4DR1C 4JI1C 1FJGC 2UUCC 1L2FA 5E7QA 4RVNA 4R1LA 3OTOC 4DR3C 3A9VA 1P4EC 1RY2A 5K85A 2OO4A 3PROC 3RG2A 4PUGA 4PUIA 5A2QD 1NY8A 4LF7C 1BA3A 5BURA 2DPLA 3N2QA 4EATA 4DV6C 1P7LA 4L4QA 2WP0C 1IBLC 2E0GA 4YY3C 5BSMA 5KYVA 1PG3A 4I9FA 3AF6A 4JYAC 3GR0A 4LF8C 4OXIA 3R9XA 2MCQA 2Y4OA 4LF4C 2P2MA 1V60A 3FCEA 3CW8X 4R0MA 4FUQA 5IWAC 1EGAA 2QVYX 4ODJA 5H9UA 4DR2C 3CQ1A 4I9GA 3UOWA 5T8SA 2AYAA 5CZXA 4DUYC 1HNWC 4ISBA 4DCVA 4LFCC 5IT9D 4TPSB 2CXCA 4KTTA 4LF9C 3UZ0A 5A19A 3UX2A 1YGTA 2Y4NA 2E7GA 4DCTA 1QM4A 2QVZX 1HH2P 2ZZMA 4G1IA 4DR5C 2VQEC 4BSZA 3CJEA 3GPCA 4FTFA 3LAXA 4PHTA 1IB8A 5AE3A 3L95X 4WV3A 3DLPX 2XR1A 4K0BA 1XNQC 3AF5A 2KZFA 2P2QA 4IZ6A 5LMNC 3B7WA 2DYJA 1RG9A 3NPDA 1MXBA 4GS5A 4BC9A 4D4IA 5IFIA 4GXQA 4HPVA 1MKYA 1M6XA 3R44A 4DV7C 1FUGA 3RV2A 4IR7A 3I07A 1MD9A 1AMUA 4B3MC 3ETOA 3PESA 2Y27A 4BC7A 4B3TC 1ZB8A 1GPMA 3J80D 4G36A 2DHMA 3IEUA 5JRHA 1MXCA 4NXMC 2CU6A 4BCAA 1O9TA 4GXRA 4OX9C 4DG8A 2JNVA 1K0RA 2ZM6C 4DR6C 4LF6C 4BBYA 4DG9A 1N2FA 1T5DX 2V7BA 2P20A 3I08A 3SO4A 4X66C 2Z51A 4X64C 4LFBC 1XRCA 4PUHA 2VQFC 4NOZA
chains in the Genus database with same CATH topology
2D7VA 4DV3C 4ZLPA 2UXDC 4NDNA 1HR0C 3TUFA 1ZB9A 2D1RA 3GKUA 5BSRA 2P02A 3H2TA 5BSUA 3EERA 3A4IA 5ADZA 2UUAC 2PN2A 4DR7C 4KHPC 3E7XA 2EGTA 2P2FA 2UXBC 3EQ6A 5LMUC 4KTVA 2ASBA 2YCBA 3VNQA 5A1GA 3N54B 4DV1C 4JI2C 3VNRA 1HNZC 2UXCC 5GTDA 1N32C 3S82A 3ETCA 1KKGA 2P2JA 5KEIA 4LE5A 2E5LC 1LQLA 1VLAA 4JI6C 2OBVA 2QL8A 4NXNC 4B3RC 4R1MA 4JI4C 5K8FA 4RMNA 4RLFA 1N34C 2YWCA 1NYEA 2F4VC 1WF3A 3NI2A 1YJ7A 5DV9A 4MH4A 4ZJZA 3PBKA 1O90A 4X62C 4RM2A 2D28C 5BSWA 2UU9C 4JI3C 2E8EA 3KXWA 4LFAC 4RM3A 1USPB 2D27A 3R9WA 3T1YC 1I94C 3G7SA 1N36C 4L7IA 1T5HX 2VZEA 1PG4A 2JMPA 1XMOC 4JM1A 1XRAA 1N33C 4JI8C 3JAMD 3IMLA 3J81D 3TDEA 1ML8A 1IBMC 4RVOA 1HNXC 2D1QA 4OYCA 4GKKC 4XX2A 3NYQA 5BUQA 3C5EA 4DCSA 1XRBA 4D4GA 4MTNA 5FLXD 3LGXA 4DV2C 2QW0X 4DV4C 3GR1A 1WH9A 1V26A 1MXAA 2ONFA 3A9UA 1O93A 2E8FA 3IPLA 5BSVA 4JI7C 5KYTA 5T8TA 5A1IA 2BH1X 5BSTA 2OPLB 4D56A 4DCUA 4LF5C 5BUSA 3FCCA 1USPA 3IEVA 2WD9A 2E8CA 3J7AD 4D57A 1O92A 5CZVA 1V25A 3E7WA 4G37A 4L2ZA 4K0KC 4GKJC 1J5EC 1XMQC 2UUBC 1LCIA 1PA4A 1IBKC 5AE2A 2QVXX 4X65C 4DV5C 2PROA 2YWBA 3TQIA 3DHVA 4U5YD 4RLQA 4PROC 3NYRA 2D1SA 1MDBA 2ATWA 2D1TA 4JV5C 4AQYC 4B3SC 3CW9A 4FUTA 4PZPA 3LUSA 2P2BA 5BR8C 4JI0C 4YHHC 5AE1A 4JI5C 1UKKA 3L8CA 2HHHC 4DUZC 2OPLA 4DV0C 1ULTA 2BJOA 4WS9A 3DAYA 1QWIA 4DR4C 3VNSA 1XNRC 3T1HC 2VSQA 2CY1A 3LNVA 2HJGA 2PT7G 1JOSA 1MDFA 4DR1C 4JI1C 1FJGC 2UUCC 1L2FA 5E7QA 4RVNA 4R1LA 3OTOC 4DR3C 3A9VA 1RY2A 5K85A 2OO4A 3PROC 3RG2A 5A2QD 4LF7C 1BA3A 5BURA 2DPLA 3N2QA 4EATA 4DV6C 1P7LA 4L4QA 2WP0C 1IBLC 2E0GA 4YY3C 5BSMA 5KYVA 1PG3A 4I9FA 3AF6A 4JYAC 3GR0A 4LF8C 4OXIA 3R9XA 2Y4OA 4LF4C 2P2MA 3FCEA 3CW8X 4R0MA 4FUQA 5IWAC 1EGAA 2QVYX 4ODJA 5H9UA 4DR2C 3UOWA 4I9GA 5T8SA 2AYAA 5CZXA 4DUYC 1HNWC 4ISBA 4DCVA 4LFCC 5IT9D 4TPSB 2CXCA 4KTTA 4LF9C 3UZ0A 5A19A 2Y4NA 2E7GA 4DCTA 1QM4A 2QVZX 1HH2P 4G1IA 4DR5C 2VQEC 4BSZA 3CJEA 3GPCA 4FTFA 3LAXA 4PHTA 5AE3A 3L95X 4WV3A 3DLPX 2XR1A 4K0BA 1XNQC 3AF5A 2KZFA 2P2QA 4IZ6A 5LMNC 3B7WA 2DYJA 1RG9A 3NPDA 1MXBA 4GS5A 4BC9A 4D4IA 5IFIA 4GXQA 4HPVA 1MKYA 3R44A 4DV7C 1FUGA 3RV2A 4IR7A 3I07A 1MD9A 1AMUA 4B3MC 3ETOA 3PESA 2Y27A 4BC7A 4B3TC 3J80D 1ZB8A 1GPMA 4G36A 3IEUA 5JRHA 1MXCA 4NXMC 4BCAA 1O9TA 4GXRA 4OX9C 4DG8A 1K0RA 2ZM6C 4DR6C 4LF6C 4BBYA 4DG9A 1N2FA 1T5DX 2V7BA 2P20A 3I08A 3SO4A 4X66C 4X64C 4LFBC 1XRCA 2VQFC 4NOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA C;  1I94 C;  2D7V A;  4DV3 C;  4LF8 C;  2UXD C;  1N36 C;  1HR0 C;  1ZB9 A;  3GKU A;  3R9X A;  2JMP A;  1XMO C;  4LF4 C;  2ATW A;  4JV5 C;  1N33 C;  4JI8 C;  3JAM D;  3EER A;  3J81 D;  5IWA C;  2PN2 A;  2UUA C;  4AQY C;  4B3S C;  1EGA A;  4DR7 C;  1ML8 A;  4DR2 C;  1IBM C;  4KHP C;  1HNX C;  4DUY C;  1HNW C;  4DCV A;  2EGT A;  4LFC C;  5IT9 D;  3LUS A;  2CXC A;  4GKK C;  5BR8 C;  4JI0 C;  2UXB C;  4XX2 A;  4YHH C;  4LF9 C;  5LMU C;  4JI5 C;  2ASB A;  4DCS A;  2YCB A;  1UKK A;  2E7G A;  2HHH C;  4DCT A;  4DUZ C;  2OPL A;  1HH2 P;  4MTN A;  4DV0 C;  5FLX D;  4DR5 C;  2VQE C;  4DV1 C;  4JI2 C;  4BSZ A;  2BJO A;  1HNZ C;  2UXC C;  4DV2 C;  1QWI A;  4DR4 C;  3CJE A;  1N32 C;  1XNR C;  4DV4 C;  1KKG A;  1WH9 A;  3T1H C;  2CY1 A;  2ONF A;  2XR1 A;  2HJG A;  1XNQ C;  2E5L C;  1LQL A;  2PT7 G;  3AF5 A;  1JOS A;  1VLA A;  2KZF A;  5LMN C;  2E8F A;  4JI6 C;  4JI7 C;  4DR1 C;  2QL8 A;  4JI1 C;  4NXN C;  1FJG C;  2UUC C;  4B3R C;  2DYJ A;  1L2F A;  4JI4 C;  2OPL B;  3OTO C;  4DR3 C;  1N34 C;  4DCU A;  4LF5 C;  1MKY A;  1USP A;  3IEV A;  4DV7 C;  1NYE A;  5A2Q D;  3I07 A;  2E8C A;  4LF7 C;  2F4V C;  4B3M C;  3J7A D;  1WF3 A;  1ZB8 A;  3J80 D;  4B3T C;  4K0K C;  4GKJ C;  1J5E C;  3IEU A;  4DV6 C;  4MH4 A;  1XMQ C;  2UUB C;  1PA4 A;  4NXM C;  1IBK C;  1IBL C;  4X62 C;  4X65 C;  4OX9 C;  4YY3 C;  4DV5 C;  1K0R A;  2ZM6 C;  4DR6 C;  4LF6 C;  2UU9 C;  1N2F A;  4X66 C;  4JI3 C;  2E8E A;  4X64 C;  4LFA C;  4LFB C;  1USP B;  3AF6 A;  2VQF C;  3R9W A;  3T1Y C;  4NOZ A; 
#chains in the Genus database with same CATH topology
 2D7V A;  3CQ3 A;  4DV3 C;  2YX1 A;  4ZLP A;  2UXD C;  4NDN A;  1HR0 C;  3TUF A;  1ZB9 A;  2D1R A;  3GKU A;  5BSR A;  2P02 A;  3H2T A;  5BSU A;  3EER A;  3A4I A;  5ADZ A;  2UUA C;  2PN2 A;  1M6X C;  4DR7 C;  4KHP C;  3A25 A;  3E7X A;  3AY0 A;  2EGT A;  2P2F A;  3UEB A;  2UXB C;  3EQ6 A;  5LMU C;  2MMA B;  4KTV A;  2ASB A;  2YCB A;  3VNQ A;  2NCL A;  5A1G A;  3N54 B;  2MM9 A;  1WCJ A;  4DV1 C;  4JI2 C;  3VNR A;  1HNZ C;  2UXC C;  5GTD A;  1N32 C;  3S82 A;  3ETC A;  1KKG A;  1PU1 A;  2P2J A;  5KEI A;  4LE5 A;  2E5L C;  1LQL A;  1VLA A;  3O2E A;  1XS3 A;  4JI6 C;  2OBV A;  2QL8 A;  4NXN C;  4B3R C;  4R1M A;  4JI4 C;  5K8F A;  4RMN A;  4RLF A;  1N34 C;  1FLO A;  2YWC A;  1NYE A;  1XHJ A;  2F4V C;  3UX3 A;  1WF3 A;  3NI2 A;  5DV9 A;  1YJ7 A;  4MH4 A;  4ZJZ A;  3PBK A;  1O90 A;  2M5O A;  4X62 C;  4RM2 A;  2D28 C;  5BSW A;  2UU9 C;  4JI3 C;  2E8E A;  3KXW A;  4LFA C;  4RM3 A;  2KDN A;  1USP B;  1UWD A;  2D27 A;  3R9W A;  3T1Y C;  2PG1 E;  1I94 C;  3G7S A;  1N36 C;  4L7I A;  1T5H X;  2VZE A;  1PG4 A;  3CQ2 A;  2JMP A;  1XMO C;  4JM1 A;  1XRA A;  1N33 C;  4JI8 C;  3JAM D;  3IML A;  3FM7 A;  3J81 D;  3TDE A;  1ML8 A;  1IBM C;  4RVO A;  1VEH A;  1HNX C;  2D1Q A;  2M5H A;  4OYC A;  4GKK C;  4XX2 A;  3NYQ A;  5BUQ A;  3C5E A;  4DCS A;  1XRB A;  4D4G A;  4MTN A;  3TR3 A;  5FLX D;  3LGX A;  4DV2 C;  2QW0 X;  4DV4 C;  3GR1 A;  1WH9 A;  1V26 A;  1MXA A;  2ONF A;  3A9U A;  1O93 A;  2E8F A;  3IPL A;  5BSV A;  4JI7 C;  5KYT A;  5T8T A;  5A1I A;  2BH1 X;  5BST A;  2OPL B;  4D56 A;  4DCU A;  4LF5 C;  5BUS A;  3FCC A;  1USP A;  3IEV A;  2WD9 A;  2E8C A;  1XDX A;  3J7A D;  4D57 A;  3LNO A;  1O92 A;  5CZV A;  1V25 A;  2KZ0 A;  3E7W A;  4G37 A;  4L2Z A;  4K0K C;  4GKJ C;  1J5E C;  1XMQ C;  2UUB C;  1LCI A;  1PA4 A;  1IBK C;  5AE2 A;  2QVX X;  1TH5 A;  4X65 C;  4DV5 C;  2PRO A;  2YWB A;  3TQI A;  3DHV A;  4U5Y D;  4RLQ A;  4PRO C;  2ZTB A;  3NYR A;  2D1S A;  1MDB A;  3A26 A;  2ATW A;  2D1T A;  4JV5 C;  2ZZN A;  4AQY C;  4B3S C;  3CW9 A;  4FUT A;  4PZP A;  1P4E A;  5LCI A;  3LUS A;  2P2B A;  5BR8 C;  4JI0 C;  4YHH C;  5AE1 A;  4JI5 C;  1UKK A;  3L8C A;  2HHH C;  4DUZ C;  2OPL A;  4DV0 C;  1ULT A;  2BJO A;  4WS9 A;  3DAY A;  1QWI A;  4DR4 C;  3VNS A;  1XNR C;  3T1H C;  2VSQ A;  2CY1 A;  3LNV A;  2HJG A;  2PT7 G;  1JOS A;  1MDF A;  3K6R A;  4DR1 C;  4JI1 C;  1FJG C;  2UUC C;  1L2F A;  5E7Q A;  4RVN A;  4R1L A;  3OTO C;  4DR3 C;  3A9V A;  1P4E C;  1RY2 A;  5K85 A;  2OO4 A;  3PRO C;  3RG2 A;  4PUG A;  4PUI A;  5A2Q D;  1NY8 A;  4LF7 C;  1BA3 A;  5BUR A;  2DPL A;  3N2Q A;  4EAT A;  4DV6 C;  1P7L A;  4L4Q A;  2WP0 C;  1IBL C;  2E0G A;  4YY3 C;  5BSM A;  5KYV A;  1PG3 A;  4I9F A;  3AF6 A;  4JYA C;  3GR0 A;  4LF8 C;  4OXI A;  3R9X A;  2MCQ A;  2Y4O A;  4LF4 C;  2P2M A;  1V60 A;  3FCE A;  3CW8 X;  4R0M A;  4FUQ A;  5IWA C;  1EGA A;  2QVY X;  4ODJ A;  5H9U A;  4DR2 C;  3CQ1 A;  4I9G A;  3UOW A;  5T8S A;  2AYA A;  5CZX A;  4DUY C;  1HNW C;  4ISB A;  4DCV A;  4LFC C;  5IT9 D;  4TPS B;  2CXC A;  4KTT A;  4LF9 C;  3UZ0 A;  5A19 A;  3UX2 A;  1YGT A;  2Y4N A;  2E7G A;  4DCT A;  1QM4 A;  2QVZ X;  1HH2 P;  2ZZM A;  4G1I A;  4DR5 C;  2VQE C;  4BSZ A;  3CJE A;  3GPC A;  4FTF A;  3LAX A;  4PHT A;  1IB8 A;  5AE3 A;  3L95 X;  4WV3 A;  3DLP X;  2XR1 A;  4K0B A;  1XNQ C;  3AF5 A;  2KZF A;  2P2Q A;  4IZ6 A;  5LMN C;  3B7W A;  2DYJ A;  1RG9 A;  3NPD A;  1MXB A;  4GS5 A;  4BC9 A;  4D4I A;  5IFI A;  4GXQ A;  4HPV A;  1MKY A;  1M6X A;  3R44 A;  4DV7 C;  1FUG A;  3RV2 A;  4IR7 A;  3I07 A;  1MD9 A;  1AMU A;  4B3M C;  3ETO A;  3PES A;  2Y27 A;  4BC7 A;  4B3T C;  1ZB8 A;  1GPM A;  3J80 D;  4G36 A;  2DHM A;  3IEU A;  5JRH A;  1MXC A;  4NXM C;  2CU6 A;  4BCA A;  1O9T A;  4GXR A;  4OX9 C;  4DG8 A;  2JNV A;  1K0R A;  2ZM6 C;  4DR6 C;  4LF6 C;  4BBY A;  4DG9 A;  1N2F A;  1T5D X;  2V7B A;  2P20 A;  3I08 A;  3SO4 A;  4X66 C;  2Z51 A;  4X64 C;  4LFB C;  1XRC A;  4PUH A;  2VQF C;  4NOZ A; 
#chains in the Genus database with same CATH homology
 2D7V A;  4DV3 C;  4ZLP A;  2UXD C;  4NDN A;  1HR0 C;  3TUF A;  1ZB9 A;  2D1R A;  3GKU A;  5BSR A;  2P02 A;  3H2T A;  5BSU A;  3EER A;  3A4I A;  5ADZ A;  2UUA C;  2PN2 A;  4DR7 C;  4KHP C;  3E7X A;  2EGT A;  2P2F A;  2UXB C;  3EQ6 A;  5LMU C;  4KTV A;  2ASB A;  2YCB A;  3VNQ A;  5A1G A;  3N54 B;  4DV1 C;  4JI2 C;  3VNR A;  1HNZ C;  2UXC C;  5GTD A;  1N32 C;  3S82 A;  3ETC A;  1KKG A;  2P2J A;  5KEI A;  4LE5 A;  2E5L C;  1LQL A;  1VLA A;  4JI6 C;  2OBV A;  2QL8 A;  4NXN C;  4B3R C;  4R1M A;  4JI4 C;  5K8F A;  4RMN A;  4RLF A;  1N34 C;  2YWC A;  1NYE A;  2F4V C;  1WF3 A;  3NI2 A;  1YJ7 A;  5DV9 A;  4MH4 A;  4ZJZ A;  3PBK A;  1O90 A;  4X62 C;  4RM2 A;  2D28 C;  5BSW A;  2UU9 C;  4JI3 C;  2E8E A;  3KXW A;  4LFA C;  4RM3 A;  1USP B;  2D27 A;  3R9W A;  3T1Y C;  1I94 C;  3G7S A;  1N36 C;  4L7I A;  1T5H X;  2VZE A;  1PG4 A;  2JMP A;  1XMO C;  4JM1 A;  1XRA A;  1N33 C;  4JI8 C;  3JAM D;  3IML A;  3J81 D;  3TDE A;  1ML8 A;  1IBM C;  4RVO A;  1HNX C;  2D1Q A;  4OYC A;  4GKK C;  4XX2 A;  3NYQ A;  5BUQ A;  3C5E A;  4DCS A;  1XRB A;  4D4G A;  4MTN A;  5FLX D;  3LGX A;  4DV2 C;  2QW0 X;  4DV4 C;  3GR1 A;  1WH9 A;  1V26 A;  1MXA A;  2ONF A;  3A9U A;  1O93 A;  2E8F A;  3IPL A;  5BSV A;  4JI7 C;  5KYT A;  5T8T A;  5A1I A;  2BH1 X;  5BST A;  2OPL B;  4D56 A;  4DCU A;  4LF5 C;  5BUS A;  3FCC A;  1USP A;  3IEV A;  2WD9 A;  2E8C A;  3J7A D;  4D57 A;  1O92 A;  5CZV A;  1V25 A;  3E7W A;  4G37 A;  4L2Z A;  4K0K C;  4GKJ C;  1J5E C;  1XMQ C;  2UUB C;  1LCI A;  1PA4 A;  1IBK C;  5AE2 A;  2QVX X;  4X65 C;  4DV5 C;  2PRO A;  2YWB A;  3TQI A;  3DHV A;  4U5Y D;  4RLQ A;  4PRO C;  3NYR A;  2D1S A;  1MDB A;  2ATW A;  2D1T A;  4JV5 C;  4AQY C;  4B3S C;  3CW9 A;  4FUT A;  4PZP A;  3LUS A;  2P2B A;  5BR8 C;  4JI0 C;  4YHH C;  5AE1 A;  4JI5 C;  1UKK A;  3L8C A;  2HHH C;  4DUZ C;  2OPL A;  4DV0 C;  1ULT A;  2BJO A;  4WS9 A;  3DAY A;  1QWI A;  4DR4 C;  3VNS A;  1XNR C;  3T1H C;  2VSQ A;  2CY1 A;  3LNV A;  2HJG A;  2PT7 G;  1JOS A;  1MDF A;  4DR1 C;  4JI1 C;  1FJG C;  2UUC C;  1L2F A;  5E7Q A;  4RVN A;  4R1L A;  3OTO C;  4DR3 C;  3A9V A;  1RY2 A;  5K85 A;  2OO4 A;  3PRO C;  3RG2 A;  5A2Q D;  4LF7 C;  1BA3 A;  5BUR A;  2DPL A;  3N2Q A;  4EAT A;  4DV6 C;  1P7L A;  4L4Q A;  2WP0 C;  1IBL C;  2E0G A;  4YY3 C;  5BSM A;  5KYV A;  1PG3 A;  4I9F A;  3AF6 A;  4JYA C;  3GR0 A;  4LF8 C;  4OXI A;  3R9X A;  2Y4O A;  4LF4 C;  2P2M A;  3FCE A;  3CW8 X;  4R0M A;  4FUQ A;  5IWA C;  1EGA A;  2QVY X;  4ODJ A;  5H9U A;  4DR2 C;  3UOW A;  4I9G A;  5T8S A;  2AYA A;  5CZX A;  4DUY C;  1HNW C;  4ISB A;  4DCV A;  4LFC C;  5IT9 D;  4TPS B;  2CXC A;  4KTT A;  4LF9 C;  3UZ0 A;  5A19 A;  2Y4N A;  2E7G A;  4DCT A;  1QM4 A;  2QVZ X;  1HH2 P;  4G1I A;  4DR5 C;  2VQE C;  4BSZ A;  3CJE A;  3GPC A;  4FTF A;  3LAX A;  4PHT A;  5AE3 A;  3L95 X;  4WV3 A;  3DLP X;  2XR1 A;  4K0B A;  1XNQ C;  3AF5 A;  2KZF A;  2P2Q A;  4IZ6 A;  5LMN C;  3B7W A;  2DYJ A;  1RG9 A;  3NPD A;  1MXB A;  4GS5 A;  4BC9 A;  4D4I A;  5IFI A;  4GXQ A;  4HPV A;  1MKY A;  3R44 A;  4DV7 C;  1FUG A;  3RV2 A;  4IR7 A;  3I07 A;  1MD9 A;  1AMU A;  4B3M C;  3ETO A;  3PES A;  2Y27 A;  4BC7 A;  4B3T C;  3J80 D;  1ZB8 A;  1GPM A;  4G36 A;  3IEU A;  5JRH A;  1MXC A;  4NXM C;  4BCA A;  1O9T A;  4GXR A;  4OX9 C;  4DG8 A;  1K0R A;  2ZM6 C;  4DR6 C;  4LF6 C;  4BBY A;  4DG9 A;  1N2F A;  1T5D X;  2V7B A;  2P20 A;  3I08 A;  3SO4 A;  4X66 C;  4X64 C;  4LFB C;  1XRC A;  2VQF C;  4NOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...