4NXMC

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 47
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4nxmC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4nxmC02
4X64C 1K0RA 1ML8A 1ZB8A 3AF5A 5LMNC 4JI0C 4DR1C 1USPA 4KHPC 1L2FA 2UUCC 4LF4C 5BR8C 3R9WA 1HR0C 4DR6C 4LFBC 4DUYC 2KZFA 1N34C 2UUAC 4GKJC 2ZM6C 1JOSA 2UXCC 2PT7G 4DV6C 4DR5C 1NYEA 2E7GA 1HNWC 3T1HC 3AF6A 4GKKC 2QL8A 2CY1A 4DCVA 4LF7C 4AQYC 4NXNC 1UKKA 4DV7C 4DR7C 4JI3C 4DCUA 4X65C 4MTNA 3T1YC 4B3RC 2UU9C 1XNQC 2ASBA 4NOZA 4XX2A 4JI4C 2ONFA 1PA4A 3R9XA 1EGAA 4DV4C 3IEUA 3OTOC 4DV3C 2OPLA 2HHHC 4JI1C 3J7AD 1MKYA 4NXMC 2F4VC 2VQFC 1J5EC 4K0KC 4JYAC 4DV1C 1N32C 2XR1A 1KKGA 4LFCC 4B3SC 4LF5C 2E8CA 5LMUC 1WH9A 4X66C 1N33C 1QWIA 1WF3A 2ATWA 2PN2A 3GKUA 4OX9C 3IEVA 2DYJA 2D7VA 4DUZC 2E8FA 2HJGA 4LFAC 4LF8C 1IBKC 1N36C 1VLAA 3J80D 1LQLA 5IT9D 1FJGC 4JI2C 2UUBC 4LF9C 1I94C 3CJEA 4BSZA 2EGTA 2E5LC 1XNRC 4DR4C 4JI6C 2BJOA 2E8EA 3EERA 4DV5C 1IBMC 1N2FA 4DR2C 3LUSA 1IBLC 4MH4A 1HNZC 1USPB 5FLXD 4DR3C 4B3TC 2UXDC 4YY3C 1XMQC 1HNXC 1HH2P 4DCSA 4JI7C 4B3MC 1XMOC 3JAMD 2OPLB 4LF6C 2JMPA 4JI5C 4DV2C 4DV0C 2YCBA 3I07A 3J81D 2UXBC 5IWAC 4DCTA 2VQEC 4JV5C 2CXCA 1ZB9A 4X62C 4JI8C 5A2QD 4YHHC
chains in the Genus database with same CATH superfamily
2P2MA 3AF5A 3GR0A 3FCCA 4PROC 2P02A 4DG9A 4LF4C 5BR8C 1M6XA 4DR6C 4LFBC 1MD9A 1TH5A 2KZFA 4G36A 5T8SA 1MDBA 2ZM6C 4DV6C 1QM4A 1MDFA 2CY1A 2KDNA 1UKKA 2AYAA 4D56A 5BUSA 3R44A 3CW8X 1YJ7A 1PA4A 4D4GA 3A26A 3OTOC 1O92A 1XRCA 2HHHC 1XRAA 4JI1C 4R1MA 5BSMA 1MKYA 1NY8A 3CQ2A 4NXMC 2E0GA 2D27A 3UEBA 3C5EA 3N2QA 2M5OA 5CZXA 2E8CA 3UX2A 3VNQA 2P20A 2PROA 1WH9A 2D28C 1WF3A 2PN2A 2YWCA 2YWBA 4EATA 4LFAC 3A9UA 1UWDA 3NPDA 5IT9D 2Z51A 4ODJA 4JI2C 1ULTA 2PG1E 5A1GA 3E7XA 4BSZA 1XNRC 3DAYA 4I9FA 3LNVA 3TUFA 4DR2C 5FLXD 4DR3C 4B3TC 4B3MC 1XMOC 3JAMD 4GS5A 3VNSA 4JI5C 4GXQA 4PUHA 4TPSB 5AE1A 5JRHA 1ZB9A 4X62C 3NYRA 2QVXX 1MXCA 3E7WA 3IMLA 1ZB8A 4DR1C 1IB8A 2KZ0A 3R9WA 2WD9A 5T8TA 3RG2A 1NYEA 3T1HC 4L4QA 1MXBA 4GXRA 4LF7C 2MM9A 2D1RA 4WS9A 3T1YC 2UU9C 4NOZA 4XX2A 1LCIA 1P4EC 2MMAB 1RY2A 4DV4C 3PBKA 4DV3C 3TQIA 4RMNA 2F4VC 2VQFC 4K0KC 5E7QA 4DV1C 2XR1A 3UOWA 1GPMA 2Y4OA 4LFCC 4G1IA 4LF5C 4RM3A 2MCQA 3DLPX 4NDNA 2D1SA 4ISBA 1VEHA 1WCJA 1QWIA 2ATWA 4OX9C 2P2BA 1O90A 2VSQA 2Y27A 4PHTA 3PESA 2OBVA 4JM1A 4OYCA 1VLAA 2ZZNA 2Y4NA 3J80D 4LF9C 3PROC 5A1IA 2V7BA 2E5LC 1PG4A 3EERA 4FUQA 1M6XC 3LAXA 1IBLC 2DHMA 1USPB 1XMQC 2CU6A 5BURA 4DCSA 2OPLB 1XS3A 2M5HA 4LE5A 2YCBA 4DV0C 2UXBC 3FM7A 3RV2A 2OO4A 3GPCA 2CXCA 5K85A 4JV5C 4FTFA 4K0BA 1K0RA 2QVYX 2P2QA 1USPA 3DHVA 3L8CA 4U5YD 3G7SA 1HR0C 1YGTA 3CW9A 1N34C 3L95X 2UXCC 2PT7G 4DR5C 3IPLA 1HNWC 5AE3A 4BC9A 3AF6A 4ZJZA 2QL8A 4DCVA 4AQYC 4NXNC 4DV7C 4OXIA 4JI3C 4DCUA 4X65C 4MTNA 4B3RC 2QVZX 1XNQC 2ASBA 2P2FA 4D57A 4ZLPA 4JI4C 1XDXA 2BH1X 5LCIA 3R9XA 1XRBA 3IEUA 1FUGA 4I9GA 3UZ0A 5GTDA 3NYQA 1J5EC 4JYAC 4L7IA 3H2TA 4WV3A 1N32C 5H9UA 3GR1A 4RLFA 5LMUC 4FUTA 2NCLA 5CZVA 4X66C 5BUQA 3GKUA 4G37A 4BBYA 5BSRA 1O9TA 2D7VA 2HJGA 4LF8C 1IBKC 1N36C 1V25A 4BCAA 3ETCA 1FJGC 5IFIA 4KTTA 4RLQA 1AMUA 1I94C 4DR4C 4JI6C 1O93A 2E8EA 1MXAA 4DG8A 1N2FA 3LUSA 1HNZC 4RM2A 3VNRA 2UXDC 4YY3C 1HNXC 1HH2P 4RVNA 1PU1A 5DV9A 4LF6C 4PUGA 4JI8C 3N54B 2QW0X 4X64C 1V60A 1ML8A 1T5DX 5KYTA 5LMNC 1RG9A 1V26A 4JI0C 4KHPC 1L2FA 2UUCC 4R1LA 3CQ1A 4DUYC 1T5HX 2UUAC 4GKJC 3CQ3A 3K6RA 1JOSA 3A25A 2E7GA 3TDEA 4GKKC 3S82A 2D1QA 4DR7C 3FCEA 4L2ZA 2ONFA 4PZPA 4RVOA 4R0MA 1EGAA 4D4IA 3I08A 2JNVA 2OPLA 5BSVA 4IZ6A 3NI2A 2DPLA 3J7AD 3B7WA 5ADZA 2YX1A 1KKGA 2ZZMA 4B3SC 5A19A 4HPVA 3LNOA 4IR7A 2D1TA 1P7LA 1N33C 1BA3A 4KTVA 2WP0C 5BSTA 3IEVA 3KXWA 2DYJA 1P4EA 1FLOA 4DUZC 2E8FA 3SO4A 5BSUA 5K8FA 3ETOA 1LQLA 3UX3A 3O2EA 3LGXA 3A9VA 1PG3A 2UUBC 3AY0A 3CJEA 2EGTA 2BJOA 3A4IA 4DV5C 1IBMC 4BC7A 4MH4A 2ZTBA 2VZEA 4JI7C 5BSWA 2P2JA 2JMPA 5AE2A 4DV2C 4PUIA 3I07A 3J81D 5KEIA 5IWAC 4DCTA 2VQEC 3EQ6A 1XHJA 5KYVA 3TR3A 5A2QD 4YHHC
chains in the Genus database with same CATH topology
2P2MA 3AF5A 3GR0A 3FCCA 4PROC 2P02A 4DG9A 4LF4C 5BR8C 4DR6C 4LFBC 1MD9A 2KZFA 4G36A 5T8SA 1MDBA 2ZM6C 4DV6C 1QM4A 1MDFA 2CY1A 1UKKA 2AYAA 4D56A 5BUSA 3R44A 3CW8X 1YJ7A 1PA4A 4D4GA 3OTOC 1O92A 1XRCA 2HHHC 1XRAA 4JI1C 4R1MA 5BSMA 1MKYA 4NXMC 2E0GA 2D27A 3C5EA 3N2QA 5CZXA 2E8CA 3VNQA 2P20A 2PROA 1WH9A 2D28C 1WF3A 2PN2A 2YWCA 2YWBA 4EATA 4LFAC 3A9UA 3NPDA 5IT9D 4ODJA 4JI2C 1ULTA 5A1GA 3E7XA 4BSZA 1XNRC 3DAYA 4I9FA 3LNVA 3TUFA 4DR2C 5FLXD 4DR3C 4B3TC 4B3MC 1XMOC 3JAMD 4GS5A 3VNSA 4JI5C 4GXQA 4TPSB 5AE1A 5JRHA 1ZB9A 4X62C 3NYRA 2QVXX 1MXCA 3E7WA 3IMLA 1ZB8A 4DR1C 3R9WA 2WD9A 5T8TA 3RG2A 1NYEA 3T1HC 4L4QA 1MXBA 4GXRA 4LF7C 2D1RA 4WS9A 3T1YC 2UU9C 4NOZA 4XX2A 1LCIA 1RY2A 4DV4C 3PBKA 4DV3C 3TQIA 4RMNA 2F4VC 2VQFC 4K0KC 5E7QA 4DV1C 2XR1A 3UOWA 1GPMA 2Y4OA 4LFCC 4G1IA 4LF5C 4RM3A 3DLPX 4NDNA 2D1SA 4ISBA 1QWIA 2ATWA 4OX9C 2P2BA 1O90A 2VSQA 2Y27A 4PHTA 3PESA 2OBVA 4JM1A 4OYCA 1VLAA 2Y4NA 3J80D 4LF9C 3PROC 5A1IA 2V7BA 2E5LC 1PG4A 3EERA 4FUQA 3LAXA 1IBLC 1USPB 1XMQC 5BURA 4DCSA 2OPLB 4LE5A 2YCBA 4DV0C 2UXBC 3RV2A 2OO4A 3GPCA 2CXCA 5K85A 4JV5C 4FTFA 4K0BA 1K0RA 2QVYX 2P2QA 1USPA 3DHVA 3L8CA 4U5YD 3G7SA 1HR0C 3CW9A 1N34C 3L95X 2UXCC 2PT7G 4DR5C 3IPLA 1HNWC 5AE3A 4BC9A 3AF6A 4ZJZA 2QL8A 4DCVA 4AQYC 4NXNC 4DV7C 4OXIA 4JI3C 4DCUA 4X65C 4MTNA 4B3RC 2QVZX 1XNQC 2ASBA 2P2FA 4D57A 4ZLPA 4JI4C 2BH1X 3R9XA 1XRBA 3IEUA 1FUGA 4I9GA 3UZ0A 5GTDA 3NYQA 1J5EC 4JYAC 4L7IA 3H2TA 4WV3A 1N32C 5H9UA 3GR1A 4RLFA 5LMUC 4FUTA 5CZVA 4X66C 5BUQA 3GKUA 4G37A 4BBYA 5BSRA 1O9TA 2D7VA 2HJGA 4LF8C 1IBKC 1N36C 1V25A 4BCAA 3ETCA 1FJGC 5IFIA 4KTTA 4RLQA 1AMUA 1I94C 4DR4C 4JI6C 1O93A 2E8EA 1MXAA 4DG8A 1N2FA 3LUSA 1HNZC 4RM2A 3VNRA 2UXDC 4YY3C 1HNXC 1HH2P 4RVNA 5DV9A 4LF6C 4JI8C 3N54B 2QW0X 4X64C 1ML8A 1T5DX 5KYTA 5LMNC 1RG9A 1V26A 4JI0C 4KHPC 1L2FA 2UUCC 4R1LA 4DUYC 1T5HX 2UUAC 4GKJC 1JOSA 2E7GA 3TDEA 4GKKC 3S82A 2D1QA 4DR7C 3FCEA 4L2ZA 2ONFA 4PZPA 4RVOA 4R0MA 1EGAA 4D4IA 3I08A 2OPLA 5BSVA 4IZ6A 3NI2A 2DPLA 3J7AD 3B7WA 5ADZA 1KKGA 4B3SC 5A19A 4HPVA 4IR7A 2D1TA 1P7LA 1N33C 1BA3A 4KTVA 2WP0C 5BSTA 3IEVA 3KXWA 2DYJA 4DUZC 2E8FA 3SO4A 5BSUA 5K8FA 3ETOA 1LQLA 3LGXA 3A9VA 1PG3A 2UUBC 3CJEA 2EGTA 2BJOA 3A4IA 4DV5C 1IBMC 4BC7A 4MH4A 2VZEA 4JI7C 5BSWA 2P2JA 2JMPA 5AE2A 4DV2C 3J81D 3I07A 5KEIA 5IWAC 4DCTA 2VQEC 3EQ6A 5KYVA 5A2QD 4YHHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 C;  1K0R A;  1ML8 A;  1ZB8 A;  3AF5 A;  5LMN C;  4JI0 C;  4DR1 C;  1USP A;  4KHP C;  1L2F A;  2UUC C;  4LF4 C;  5BR8 C;  3R9W A;  1HR0 C;  4DR6 C;  4LFB C;  4DUY C;  2KZF A;  1N34 C;  2UUA C;  4GKJ C;  2ZM6 C;  1JOS A;  2UXC C;  2PT7 G;  4DV6 C;  4DR5 C;  1NYE A;  2E7G A;  1HNW C;  3T1H C;  3AF6 A;  4GKK C;  2QL8 A;  2CY1 A;  4DCV A;  4LF7 C;  4AQY C;  4NXN C;  1UKK A;  4DV7 C;  4DR7 C;  4JI3 C;  4DCU A;  4X65 C;  4MTN A;  3T1Y C;  4B3R C;  2UU9 C;  1XNQ C;  2ASB A;  4NOZ A;  4XX2 A;  4JI4 C;  2ONF A;  1PA4 A;  3R9X A;  1EGA A;  4DV4 C;  3IEU A;  3OTO C;  4DV3 C;  2OPL A;  2HHH C;  4JI1 C;  3J7A D;  1MKY A;  4NXM C;  2F4V C;  2VQF C;  1J5E C;  4K0K C;  4JYA C;  4DV1 C;  1N32 C;  2XR1 A;  1KKG A;  4LFC C;  4B3S C;  4LF5 C;  2E8C A;  5LMU C;  1WH9 A;  4X66 C;  1N33 C;  1QWI A;  1WF3 A;  2ATW A;  2PN2 A;  3GKU A;  4OX9 C;  3IEV A;  2DYJ A;  2D7V A;  4DUZ C;  2E8F A;  2HJG A;  4LFA C;  4LF8 C;  1IBK C;  1N36 C;  1VLA A;  3J80 D;  1LQL A;  5IT9 D;  1FJG C;  4JI2 C;  2UUB C;  4LF9 C;  1I94 C;  3CJE A;  4BSZ A;  2EGT A;  2E5L C;  1XNR C;  4DR4 C;  4JI6 C;  2BJO A;  2E8E A;  3EER A;  4DV5 C;  1IBM C;  1N2F A;  4DR2 C;  3LUS A;  1IBL C;  4MH4 A;  1HNZ C;  1USP B;  5FLX D;  4DR3 C;  4B3T C;  2UXD C;  4YY3 C;  1XMQ C;  1HNX C;  1HH2 P;  4DCS A;  4JI7 C;  4B3M C;  1XMO C;  3JAM D;  2OPL B;  4LF6 C;  2JMP A;  4JI5 C;  4DV2 C;  4DV0 C;  2YCB A;  3I07 A;  3J81 D;  2UXB C;  5IWA C;  4DCT A;  2VQE C;  4JV5 C;  2CXC A;  1ZB9 A;  4X62 C;  4JI8 C;  5A2Q D;  4YHH C; 
#chains in the Genus database with same CATH topology
 2P2M A;  3AF5 A;  3GR0 A;  3FCC A;  4PRO C;  2P02 A;  4DG9 A;  4LF4 C;  5BR8 C;  1M6X A;  4DR6 C;  4LFB C;  1MD9 A;  1TH5 A;  2KZF A;  4G36 A;  5T8S A;  1MDB A;  2ZM6 C;  4DV6 C;  1QM4 A;  1MDF A;  2CY1 A;  2KDN A;  1UKK A;  2AYA A;  4D56 A;  5BUS A;  3R44 A;  3CW8 X;  1YJ7 A;  1PA4 A;  4D4G A;  3A26 A;  3OTO C;  1O92 A;  1XRC A;  2HHH C;  1XRA A;  4JI1 C;  4R1M A;  5BSM A;  1MKY A;  1NY8 A;  3CQ2 A;  4NXM C;  2E0G A;  2D27 A;  3UEB A;  3C5E A;  3N2Q A;  2M5O A;  5CZX A;  2E8C A;  3UX2 A;  3VNQ A;  2P20 A;  2PRO A;  1WH9 A;  2D28 C;  1WF3 A;  2PN2 A;  2YWC A;  2YWB A;  4EAT A;  4LFA C;  3A9U A;  1UWD A;  3NPD A;  5IT9 D;  2Z51 A;  4ODJ A;  4JI2 C;  1ULT A;  2PG1 E;  5A1G A;  3E7X A;  4BSZ A;  1XNR C;  3DAY A;  4I9F A;  3LNV A;  3TUF A;  4DR2 C;  5FLX D;  4DR3 C;  4B3T C;  4B3M C;  1XMO C;  3JAM D;  4GS5 A;  3VNS A;  4JI5 C;  4GXQ A;  4PUH A;  4TPS B;  5AE1 A;  5JRH A;  1ZB9 A;  4X62 C;  3NYR A;  2QVX X;  1MXC A;  3E7W A;  3IML A;  1ZB8 A;  4DR1 C;  1IB8 A;  2KZ0 A;  3R9W A;  2WD9 A;  5T8T A;  3RG2 A;  1NYE A;  3T1H C;  4L4Q A;  1MXB A;  4GXR A;  4LF7 C;  2MM9 A;  2D1R A;  4WS9 A;  3T1Y C;  2UU9 C;  4NOZ A;  4XX2 A;  1LCI A;  1P4E C;  2MMA B;  1RY2 A;  4DV4 C;  3PBK A;  4DV3 C;  3TQI A;  4RMN A;  2F4V C;  2VQF C;  4K0K C;  5E7Q A;  4DV1 C;  2XR1 A;  3UOW A;  1GPM A;  2Y4O A;  4LFC C;  4G1I A;  4LF5 C;  4RM3 A;  2MCQ A;  3DLP X;  4NDN A;  2D1S A;  4ISB A;  1VEH A;  1WCJ A;  1QWI A;  2ATW A;  4OX9 C;  2P2B A;  1O90 A;  2VSQ A;  2Y27 A;  4PHT A;  3PES A;  2OBV A;  4JM1 A;  4OYC A;  1VLA A;  2ZZN A;  2Y4N A;  3J80 D;  4LF9 C;  3PRO C;  5A1I A;  2V7B A;  2E5L C;  1PG4 A;  3EER A;  4FUQ A;  1M6X C;  3LAX A;  1IBL C;  2DHM A;  1USP B;  1XMQ C;  2CU6 A;  5BUR A;  4DCS A;  2OPL B;  1XS3 A;  2M5H A;  4LE5 A;  2YCB A;  4DV0 C;  2UXB C;  3FM7 A;  3RV2 A;  2OO4 A;  3GPC A;  2CXC A;  5K85 A;  4JV5 C;  4FTF A;  4K0B A;  1K0R A;  2QVY X;  2P2Q A;  1USP A;  3DHV A;  3L8C A;  4U5Y D;  3G7S A;  1HR0 C;  1YGT A;  3CW9 A;  1N34 C;  3L95 X;  2UXC C;  2PT7 G;  4DR5 C;  3IPL A;  1HNW C;  5AE3 A;  4BC9 A;  3AF6 A;  4ZJZ A;  2QL8 A;  4DCV A;  4AQY C;  4NXN C;  4DV7 C;  4OXI A;  4JI3 C;  4DCU A;  4X65 C;  4MTN A;  4B3R C;  2QVZ X;  1XNQ C;  2ASB A;  2P2F A;  4D57 A;  4ZLP A;  4JI4 C;  1XDX A;  2BH1 X;  5LCI A;  3R9X A;  1XRB A;  3IEU A;  1FUG A;  4I9G A;  3UZ0 A;  5GTD A;  3NYQ A;  1J5E C;  4JYA C;  4L7I A;  3H2T A;  4WV3 A;  1N32 C;  5H9U A;  3GR1 A;  4RLF A;  5LMU C;  4FUT A;  2NCL A;  5CZV A;  4X66 C;  5BUQ A;  3GKU A;  4G37 A;  4BBY A;  5BSR A;  1O9T A;  2D7V A;  2HJG A;  4LF8 C;  1IBK C;  1N36 C;  1V25 A;  4BCA A;  3ETC A;  1FJG C;  5IFI A;  4KTT A;  4RLQ A;  1AMU A;  1I94 C;  4DR4 C;  4JI6 C;  1O93 A;  2E8E A;  1MXA A;  4DG8 A;  1N2F A;  3LUS A;  1HNZ C;  4RM2 A;  3VNR A;  2UXD C;  4YY3 C;  1HNX C;  1HH2 P;  4RVN A;  1PU1 A;  5DV9 A;  4LF6 C;  4PUG A;  4JI8 C;  3N54 B;  2QW0 X;  4X64 C;  1V60 A;  1ML8 A;  1T5D X;  5KYT A;  5LMN C;  1RG9 A;  1V26 A;  4JI0 C;  4KHP C;  1L2F A;  2UUC C;  4R1L A;  3CQ1 A;  4DUY C;  1T5H X;  2UUA C;  4GKJ C;  3CQ3 A;  3K6R A;  1JOS A;  3A25 A;  2E7G A;  3TDE A;  4GKK C;  3S82 A;  2D1Q A;  4DR7 C;  3FCE A;  4L2Z A;  2ONF A;  4PZP A;  4RVO A;  4R0M A;  1EGA A;  4D4I A;  3I08 A;  2JNV A;  2OPL A;  5BSV A;  4IZ6 A;  3NI2 A;  2DPL A;  3J7A D;  3B7W A;  5ADZ A;  2YX1 A;  1KKG A;  2ZZM A;  4B3S C;  5A19 A;  4HPV A;  3LNO A;  4IR7 A;  2D1T A;  1P7L A;  1N33 C;  1BA3 A;  4KTV A;  2WP0 C;  5BST A;  3IEV A;  3KXW A;  2DYJ A;  1P4E A;  1FLO A;  4DUZ C;  2E8F A;  3SO4 A;  5BSU A;  5K8F A;  3ETO A;  1LQL A;  3UX3 A;  3O2E A;  3LGX A;  3A9V A;  1PG3 A;  2UUB C;  3AY0 A;  3CJE A;  2EGT A;  2BJO A;  3A4I A;  4DV5 C;  1IBM C;  4BC7 A;  4MH4 A;  2ZTB A;  2VZE A;  4JI7 C;  5BSW A;  2P2J A;  2JMP A;  5AE2 A;  4DV2 C;  4PUI A;  3I07 A;  3J81 D;  5KEI A;  5IWA C;  4DCT A;  2VQE C;  3EQ6 A;  1XHJ A;  5KYV A;  3TR3 A;  5A2Q D;  4YHH C; 
#chains in the Genus database with same CATH homology
 2P2M A;  3AF5 A;  3GR0 A;  3FCC A;  4PRO C;  2P02 A;  4DG9 A;  4LF4 C;  5BR8 C;  4DR6 C;  4LFB C;  1MD9 A;  2KZF A;  4G36 A;  5T8S A;  1MDB A;  2ZM6 C;  4DV6 C;  1QM4 A;  1MDF A;  2CY1 A;  1UKK A;  2AYA A;  4D56 A;  5BUS A;  3R44 A;  3CW8 X;  1YJ7 A;  1PA4 A;  4D4G A;  3OTO C;  1O92 A;  1XRC A;  2HHH C;  1XRA A;  4JI1 C;  4R1M A;  5BSM A;  1MKY A;  4NXM C;  2E0G A;  2D27 A;  3C5E A;  3N2Q A;  5CZX A;  2E8C A;  3VNQ A;  2P20 A;  2PRO A;  1WH9 A;  2D28 C;  1WF3 A;  2PN2 A;  2YWC A;  2YWB A;  4EAT A;  4LFA C;  3A9U A;  3NPD A;  5IT9 D;  4ODJ A;  4JI2 C;  1ULT A;  5A1G A;  3E7X A;  4BSZ A;  1XNR C;  3DAY A;  4I9F A;  3LNV A;  3TUF A;  4DR2 C;  5FLX D;  4DR3 C;  4B3T C;  4B3M C;  1XMO C;  3JAM D;  4GS5 A;  3VNS A;  4JI5 C;  4GXQ A;  4TPS B;  5AE1 A;  5JRH A;  1ZB9 A;  4X62 C;  3NYR A;  2QVX X;  1MXC A;  3E7W A;  3IML A;  1ZB8 A;  4DR1 C;  3R9W A;  2WD9 A;  5T8T A;  3RG2 A;  1NYE A;  3T1H C;  4L4Q A;  1MXB A;  4GXR A;  4LF7 C;  2D1R A;  4WS9 A;  3T1Y C;  2UU9 C;  4NOZ A;  4XX2 A;  1LCI A;  1RY2 A;  4DV4 C;  3PBK A;  4DV3 C;  3TQI A;  4RMN A;  2F4V C;  2VQF C;  4K0K C;  5E7Q A;  4DV1 C;  2XR1 A;  3UOW A;  1GPM A;  2Y4O A;  4LFC C;  4G1I A;  4LF5 C;  4RM3 A;  3DLP X;  4NDN A;  2D1S A;  4ISB A;  1QWI A;  2ATW A;  4OX9 C;  2P2B A;  1O90 A;  2VSQ A;  2Y27 A;  4PHT A;  3PES A;  2OBV A;  4JM1 A;  4OYC A;  1VLA A;  2Y4N A;  3J80 D;  4LF9 C;  3PRO C;  5A1I A;  2V7B A;  2E5L C;  1PG4 A;  3EER A;  4FUQ A;  3LAX A;  1IBL C;  1USP B;  1XMQ C;  5BUR A;  4DCS A;  2OPL B;  4LE5 A;  2YCB A;  4DV0 C;  2UXB C;  3RV2 A;  2OO4 A;  3GPC A;  2CXC A;  5K85 A;  4JV5 C;  4FTF A;  4K0B A;  1K0R A;  2QVY X;  2P2Q A;  1USP A;  3DHV A;  3L8C A;  4U5Y D;  3G7S A;  1HR0 C;  3CW9 A;  1N34 C;  3L95 X;  2UXC C;  2PT7 G;  4DR5 C;  3IPL A;  1HNW C;  5AE3 A;  4BC9 A;  3AF6 A;  4ZJZ A;  2QL8 A;  4DCV A;  4AQY C;  4NXN C;  4DV7 C;  4OXI A;  4JI3 C;  4DCU A;  4X65 C;  4MTN A;  4B3R C;  2QVZ X;  1XNQ C;  2ASB A;  2P2F A;  4D57 A;  4ZLP A;  4JI4 C;  2BH1 X;  3R9X A;  1XRB A;  3IEU A;  1FUG A;  4I9G A;  3UZ0 A;  5GTD A;  3NYQ A;  1J5E C;  4JYA C;  4L7I A;  3H2T A;  4WV3 A;  1N32 C;  5H9U A;  3GR1 A;  4RLF A;  5LMU C;  4FUT A;  5CZV A;  4X66 C;  5BUQ A;  3GKU A;  4G37 A;  4BBY A;  5BSR A;  1O9T A;  2D7V A;  2HJG A;  4LF8 C;  1IBK C;  1N36 C;  1V25 A;  4BCA A;  3ETC A;  1FJG C;  5IFI A;  4KTT A;  4RLQ A;  1AMU A;  1I94 C;  4DR4 C;  4JI6 C;  1O93 A;  2E8E A;  1MXA A;  4DG8 A;  1N2F A;  3LUS A;  1HNZ C;  4RM2 A;  3VNR A;  2UXD C;  4YY3 C;  1HNX C;  1HH2 P;  4RVN A;  5DV9 A;  4LF6 C;  4JI8 C;  3N54 B;  2QW0 X;  4X64 C;  1ML8 A;  1T5D X;  5KYT A;  5LMN C;  1RG9 A;  1V26 A;  4JI0 C;  4KHP C;  1L2F A;  2UUC C;  4R1L A;  4DUY C;  1T5H X;  2UUA C;  4GKJ C;  1JOS A;  2E7G A;  3TDE A;  4GKK C;  3S82 A;  2D1Q A;  4DR7 C;  3FCE A;  4L2Z A;  2ONF A;  4PZP A;  4RVO A;  4R0M A;  1EGA A;  4D4I A;  3I08 A;  2OPL A;  5BSV A;  4IZ6 A;  3NI2 A;  2DPL A;  3J7A D;  3B7W A;  5ADZ A;  1KKG A;  4B3S C;  5A19 A;  4HPV A;  4IR7 A;  2D1T A;  1P7L A;  1N33 C;  1BA3 A;  4KTV A;  2WP0 C;  5BST A;  3IEV A;  3KXW A;  2DYJ A;  4DUZ C;  2E8F A;  3SO4 A;  5BSU A;  5K8F A;  3ETO A;  1LQL A;  3LGX A;  3A9V A;  1PG3 A;  2UUB C;  3CJE A;  2EGT A;  2BJO A;  3A4I A;  4DV5 C;  1IBM C;  4BC7 A;  4MH4 A;  2VZE A;  4JI7 C;  5BSW A;  2P2J A;  2JMP A;  5AE2 A;  4DV2 C;  3J81 D;  3I07 A;  5KEI A;  5IWA C;  4DCT A;  2VQE C;  3EQ6 A;  5KYV A;  5A2Q D;  4YHH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...