4DV2C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv2C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv2C02
4K0KC 1IBKC 2ZM6C 1L2FA 4JI0C 1I94C 4B3TC 4OX9C 4DUYC 4LF5C 4NXNC 1UKKA 4DR5C 2UUAC 4DV2C 2VQFC 4DV6C 1IBMC 4LFAC 4JV5C 4BSZA 4DV4C 1NYEA 5IWAC 3IEVA 1QWIA 4B3RC 1KKGA 5FLXD 2HHHC 4X66C 4LFBC 1WF3A 2QL8A 4JI6C 2OPLA 2KZFA 3CJEA 2OPLB 3OTOC 2HJGA 2ONFA 2ATWA 2JMPA 5LMNC 4X64C 3J80D 4DR1C 4B3SC 2UXBC 1HNWC 4JI8C 4YHHC 4LF7C 1HNZC 4NOZA 1EGAA 2UUBC 3GKUA 4DV0C 4LF9C 4JI4C 4DV7C 1N2FA 4DUZC 4AQYC 4KHPC 4DR7C 1JOSA 2UXDC 1ML8A 1ZB8A 4JYAC 1FJGC 4DR4C 1HR0C 2E7GA 3LUSA 1XMOC 4JI7C 4LFCC 1HH2P 2ASBA 2F4VC 3J7AD 2E8EA 2XR1A 5A2QD 1IBLC 2EGTA 4LF6C 2UU9C 4NXMC 4DR3C 2DYJA 1ZB9A 3AF5A 3I07A 4X65C 1J5EC 1WH9A 2UUCC 4JI5C 4LF8C 1LQLA 2D7VA 4X62C 4DCSA 2E5LC 4DCUA 4DV5C 3T1YC 4DCTA 1HNXC 4JI2C 2CXCA 2PN2A 1USPA 1PA4A 1N34C 1USPB 1XNRC 4DR6C 3JAMD 3J81D 1N32C 1K0RA 2E8CA 1N36C 4DR2C 1XMQC 2VQEC 4DV1C 4DV3C 1N33C 4JI3C 4LF4C 4MTNA 2CY1A 4DCVA 3R9WA 3T1HC 3IEUA 4B3MC 4JI1C 1MKYA 5IT9D 3EERA 3AF6A 2UXCC 5BR8C 4YY3C 1VLAA 2BJOA 4GKKC 4MH4A 4GKJC 3R9XA 4XX2A 2E8FA 2PT7G 1XNQC 2YCBA 5LMUC
chains in the Genus database with same CATH superfamily
1MDBA 3I08A 1IBKC 4JI0C 4B3TC 4OX9C 4DUYC 4KTVA 1YJ7A 3R44A 4GXQA 4DR5C 2VQFC 4DV6C 1IBMC 4ZLPA 4JV5C 4RVOA 4DV4C 5IWAC 1KKGA 1MDFA 1WF3A 4D4GA 2QL8A 4JI6C 3CJEA 2HJGA 2ATWA 2QW0X 5LMNC 4B3SC 3IMLA 1HNWC 4JI8C 1XHJA 4OYCA 5KYVA 1MXBA 4R1LA 2UUBC 1XRAA 4RVNA 2OO4A 4RLQA 3DLPX 4DR7C 2Y4OA 2UXDC 1ML8A 1T5HX 3TDEA 1FJGC 1HR0C 2YWBA 2E7GA 4PHTA 2DPLA 4PROC 2MCQA 2MMAB 4ISBA 4ODJA 5AE3A 2MM9A 5K8FA 5BSRA 1UWDA 5A1GA 1LQLA 4K0BA 3NI2A 4I9GA 1AMUA 4JI2C 2CXCA 1XDXA 4GXRA 1M6XC 1N32C 4PUGA 3VNQA 1GPMA 1K0RA 1PG3A 3UEBA 2VQEC 4DV1C 3GR1A 4FUTA 3C5EA 4LF4C 1XRBA 4JI1C 3IEUA 3K6RA 2BH1X 4RLFA 3EERA 4WS9A 2UXCC 5T8SA 5GTDA 3AY0A 1O90A 3LNOA 4MH4A 3A9VA 2P2FA 3FCCA 2E8FA 3J81D 2WP0C 3CQ2A 3NYQA 4K0KC 5A19A 2V7BA 3PESA 4LF5C 5CZVA 2ZZNA 5AE1A 5BURA 4LFAC 4EATA 1PG4A 3RV2A 1LCIA 3OTOC 4HPVA 3NYRA 5BSMA 3UX2A 2E0GA 3DHVA 3L95X 3TQIA 2ZTBA 2M5HA 5KYTA 2Z51A 1EGAA 5ADZA 2D27A 2Y27A 2DHMA 2KDNA 4KHPC 2NCLA 3LGXA 3A25A 1ZB8A 4JYAC 4DR4C 1XMOC 3LUSA 2ASBA 3ETCA 4R0MA 2F4VC 3IPLA 1IBLC 5A2QD 1MD9A 2EGTA 2P2QA 3RG2A 2UU9C 4NXMC 2DYJA 1J5EC 3UX3A 4X65C 2UUCC 4PZPA 4BBYA 5BSTA 2E5LC 4DCUA 4DV5C 3T1YC 5K85A 4NDNA 2PN2A 1VEHA 3SO4A 4ZJZA 1XNRC 3JAMD 1O93A 4PUHA 4RM3A 4BC9A 1N33C 5BUSA 5AE2A 1PU1A 3N2QA 2P02A 4PUIA 3R9WA 3G7SA 3TR3A 1P4EC 5IT9D 3H2TA 5BR8C 1VLAA 1IB8A 3O2EA 4GKJC 1MKYA 2PT7G 2D1SA 5LMUC 5JRHA 1L2FA 1I94C 5DV9A 2P2MA 4NXNC 1UKKA 3FM7A 1V25A 3CW8X 2D1RA 5LCIA 4D56A 1NYEA 3IEVA 1QWIA 4B3RC 4G1IA 2HHHC 4X66C 2OPLA 2OPLB 3N54B 5IFIA 2QVYX 4BCAA 5T8TA 1M6XA 5BSUA 4FTFA 2JMPA 3J80D 2VZEA 3VNSA 2UXBC 2JNVA 4YHHC 1XRCA 1V26A 1HNZC 2D1TA 3A4IA 3GKUA 4DV0C 3UZ0A 4JI4C 4DV7C 4BC7A 4DUZC 4AQYC 1MXCA 4I9FA 4OXIA 4IR7A 2VSQA 1FLOA 2OBVA 2YX1A 4JI7C 2QVXX 4LFCC 4R1MA 3J7AD 2E8EA 3FCEA 2D1QA 5KEIA 4L4QA 1TH5A 1ZB9A 3AF5A 3I07A 2PROA 4LF8C 5BSVA 4KTTA 2D28C 4DCTA 1HNXC 1P7LA 1USPA 1PA4A 1USPB 4DR6C 2P2BA 1WCJA 2PG1E 2E8CA 4IZ6A 1N36C 3CW9A 1RG9A 5BUQA 3LNVA 4JI3C 2CY1A 5E7QA 4LE5A 1MXAA 1O9TA 3AF6A 1RY2A 4L7IA 4D4IA 4GKKC 3GR0A 3UOWA 3R9XA 4XX2A 2M5OA 2YCBA 2ZM6C 1FUGA 3PBKA 2UUAC 4DV2C 4BSZA 3GPCA 4RM2A 4DG8A 5FLXD 4LFBC 4G36A 2KZFA 1T5DX 2ONFA 3KXWA 3VNRA 4JM1A 4DG9A 4X64C 4DR1C 2CU6A 3E7XA 4LF7C 1ULTA 4NOZA 5BSWA 4D57A 4TPSB 4LF9C 3CQ3A 4WV3A 1N2FA 2WD9A 1P4EA 3PROC 4GS5A 1JOSA 3ETOA 1QM4A 2YWCA 3B7WA 1HH2P 3S82A 1O92A 3LAXA 3DAYA 2XR1A 3CQ1A 4FUQA 4G37A 4LF6C 2P20A 1NY8A 2P2JA 4DR3C 1WH9A 4JI5C 2D7VA 4X62C 5CZXA 4DCSA 4U5YD 1N34C 2Y4NA 4DR2C 1BA3A 5A1IA 3A9UA 1XMQC 1YGTA 4DV3C 3L8CA 4MTNA 3E7WA 4DCVA 5H9UA 2QVZX 3T1HC 4B3MC 2KZ0A 4YY3C 1XS3A 1V60A 2BJOA 3TUFA 3NPDA 4L2ZA 2ZZMA 2AYAA 3A26A 4RMNA 3EQ6A 1XNQC
chains in the Genus database with same CATH topology
1MDBA 3I08A 1IBKC 4JI0C 4B3TC 4OX9C 4DUYC 4KTVA 1YJ7A 3R44A 4GXQA 4DR5C 2VQFC 4DV6C 1IBMC 4ZLPA 4JV5C 4RVOA 4DV4C 5IWAC 1KKGA 1MDFA 1WF3A 4D4GA 2QL8A 4JI6C 3CJEA 2HJGA 2ATWA 2QW0X 5LMNC 4B3SC 3IMLA 1HNWC 4JI8C 4OYCA 5KYVA 1MXBA 4R1LA 2UUBC 1XRAA 4RVNA 2OO4A 4RLQA 3DLPX 4DR7C 2Y4OA 2UXDC 1ML8A 1T5HX 3TDEA 1FJGC 1HR0C 2YWBA 2E7GA 4PHTA 2DPLA 4PROC 4ISBA 4ODJA 5AE3A 5K8FA 5BSRA 5A1GA 1LQLA 4K0BA 3NI2A 4I9GA 1AMUA 4JI2C 2CXCA 4GXRA 1N32C 3VNQA 1GPMA 1K0RA 1PG3A 2VQEC 4DV1C 3GR1A 4FUTA 3C5EA 4LF4C 1XRBA 4JI1C 3IEUA 2BH1X 4RLFA 3EERA 4WS9A 2UXCC 5T8SA 5GTDA 1O90A 4MH4A 3A9VA 2P2FA 3FCCA 3J81D 2E8FA 2WP0C 3NYQA 4K0KC 5A19A 2V7BA 3PESA 4LF5C 5CZVA 5AE1A 5BURA 4LFAC 4EATA 1PG4A 3RV2A 1LCIA 3OTOC 4HPVA 3NYRA 5BSMA 2E0GA 3DHVA 3L95X 3TQIA 5KYTA 1EGAA 5ADZA 2D27A 2Y27A 4KHPC 3LGXA 1ZB8A 4JYAC 4DR4C 1XMOC 3LUSA 2ASBA 3ETCA 4R0MA 2F4VC 3IPLA 1IBLC 5A2QD 1MD9A 2EGTA 2P2QA 3RG2A 2UU9C 4NXMC 2DYJA 1J5EC 4X65C 2UUCC 4PZPA 4BBYA 5BSTA 2E5LC 4DCUA 4DV5C 3T1YC 5K85A 4NDNA 2PN2A 3SO4A 4ZJZA 1XNRC 3JAMD 1O93A 4RM3A 4BC9A 1N33C 5BUSA 5AE2A 3N2QA 2P02A 3R9WA 3G7SA 5IT9D 3H2TA 5BR8C 1VLAA 4GKJC 1MKYA 2PT7G 2D1SA 5LMUC 5JRHA 1L2FA 1I94C 5DV9A 2P2MA 4NXNC 1UKKA 1V25A 3CW8X 2D1RA 4D56A 1NYEA 3IEVA 1QWIA 4B3RC 4G1IA 2HHHC 4X66C 2OPLA 2OPLB 3N54B 5IFIA 2QVYX 4BCAA 5T8TA 5BSUA 4FTFA 2JMPA 3J80D 2VZEA 3VNSA 2UXBC 4YHHC 1XRCA 1V26A 1HNZC 2D1TA 3A4IA 3GKUA 4DV0C 3UZ0A 4JI4C 4DV7C 4BC7A 4DUZC 4AQYC 1MXCA 4I9FA 4OXIA 4IR7A 2VSQA 2OBVA 4JI7C 2QVXX 4LFCC 4R1MA 3J7AD 2E8EA 3FCEA 2D1QA 5KEIA 4L4QA 1ZB9A 3AF5A 3I07A 2PROA 4LF8C 5BSVA 4KTTA 2D28C 4DCTA 1HNXC 1P7LA 1USPA 1PA4A 1USPB 4DR6C 2P2BA 2E8CA 4IZ6A 1N36C 3CW9A 1RG9A 5BUQA 3LNVA 4JI3C 2CY1A 5E7QA 4LE5A 1MXAA 1O9TA 3AF6A 1RY2A 4L7IA 4D4IA 4GKKC 3GR0A 3UOWA 3R9XA 4XX2A 2YCBA 2ZM6C 1FUGA 3PBKA 2UUAC 4DV2C 4BSZA 3GPCA 4RM2A 4DG8A 5FLXD 4LFBC 4G36A 2KZFA 1T5DX 2ONFA 3KXWA 3VNRA 4JM1A 4DG9A 4X64C 4DR1C 3E7XA 4LF7C 1ULTA 4NOZA 5BSWA 4D57A 4TPSB 4LF9C 4WV3A 1N2FA 2WD9A 3PROC 4GS5A 1JOSA 3ETOA 1QM4A 2YWCA 3B7WA 1HH2P 3S82A 1O92A 3LAXA 3DAYA 2XR1A 4FUQA 4G37A 4LF6C 2P20A 2P2JA 4DR3C 1WH9A 4JI5C 2D7VA 4X62C 5CZXA 4DCSA 4U5YD 1N34C 2Y4NA 4DR2C 1BA3A 5A1IA 3A9UA 1XMQC 4DV3C 3L8CA 4MTNA 3E7WA 5H9UA 4DCVA 2QVZX 3T1HC 4B3MC 4YY3C 2BJOA 3TUFA 3NPDA 4L2ZA 2AYAA 4RMNA 3EQ6A 1XNQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K C;  1IBK C;  2ZM6 C;  1L2F A;  4JI0 C;  1I94 C;  4B3T C;  4OX9 C;  4DUY C;  4LF5 C;  4NXN C;  1UKK A;  4DR5 C;  2UUA C;  4DV2 C;  2VQF C;  4DV6 C;  1IBM C;  4LFA C;  4JV5 C;  4BSZ A;  4DV4 C;  1NYE A;  5IWA C;  3IEV A;  1QWI A;  4B3R C;  1KKG A;  5FLX D;  2HHH C;  4X66 C;  4LFB C;  1WF3 A;  2QL8 A;  4JI6 C;  2OPL A;  2KZF A;  3CJE A;  2OPL B;  3OTO C;  2HJG A;  2ONF A;  2ATW A;  2JMP A;  5LMN C;  4X64 C;  3J80 D;  4DR1 C;  4B3S C;  2UXB C;  1HNW C;  4JI8 C;  4YHH C;  4LF7 C;  1HNZ C;  4NOZ A;  1EGA A;  2UUB C;  3GKU A;  4DV0 C;  4LF9 C;  4JI4 C;  4DV7 C;  1N2F A;  4DUZ C;  4AQY C;  4KHP C;  4DR7 C;  1JOS A;  2UXD C;  1ML8 A;  1ZB8 A;  4JYA C;  1FJG C;  4DR4 C;  1HR0 C;  2E7G A;  3LUS A;  1XMO C;  4JI7 C;  4LFC C;  1HH2 P;  2ASB A;  2F4V C;  3J7A D;  2E8E A;  2XR1 A;  5A2Q D;  1IBL C;  2EGT A;  4LF6 C;  2UU9 C;  4NXM C;  4DR3 C;  2DYJ A;  1ZB9 A;  3AF5 A;  3I07 A;  4X65 C;  1J5E C;  1WH9 A;  2UUC C;  4JI5 C;  4LF8 C;  1LQL A;  2D7V A;  4X62 C;  4DCS A;  2E5L C;  4DCU A;  4DV5 C;  3T1Y C;  4DCT A;  1HNX C;  4JI2 C;  2CXC A;  2PN2 A;  1USP A;  1PA4 A;  1N34 C;  1USP B;  1XNR C;  4DR6 C;  3JAM D;  3J81 D;  1N32 C;  1K0R A;  2E8C A;  1N36 C;  4DR2 C;  1XMQ C;  2VQE C;  4DV1 C;  4DV3 C;  1N33 C;  4JI3 C;  4LF4 C;  4MTN A;  2CY1 A;  4DCV A;  3R9W A;  3T1H C;  3IEU A;  4B3M C;  4JI1 C;  1MKY A;  5IT9 D;  3EER A;  3AF6 A;  2UXC C;  5BR8 C;  4YY3 C;  1VLA A;  2BJO A;  4GKK C;  4MH4 A;  4GKJ C;  3R9X A;  4XX2 A;  2E8F A;  2PT7 G;  1XNQ C;  2YCB A;  5LMU C; 
#chains in the Genus database with same CATH topology
 1MDB A;  3I08 A;  1IBK C;  4JI0 C;  4B3T C;  4OX9 C;  4DUY C;  4KTV A;  1YJ7 A;  3R44 A;  4GXQ A;  4DR5 C;  2VQF C;  4DV6 C;  1IBM C;  4ZLP A;  4JV5 C;  4RVO A;  4DV4 C;  5IWA C;  1KKG A;  1MDF A;  1WF3 A;  4D4G A;  2QL8 A;  4JI6 C;  3CJE A;  2HJG A;  2ATW A;  2QW0 X;  5LMN C;  4B3S C;  3IML A;  1HNW C;  4JI8 C;  1XHJ A;  4OYC A;  5KYV A;  1MXB A;  4R1L A;  2UUB C;  1XRA A;  4RVN A;  2OO4 A;  4RLQ A;  3DLP X;  4DR7 C;  2Y4O A;  2UXD C;  1ML8 A;  1T5H X;  3TDE A;  1FJG C;  1HR0 C;  2YWB A;  2E7G A;  4PHT A;  2DPL A;  4PRO C;  2MCQ A;  2MMA B;  4ISB A;  4ODJ A;  5AE3 A;  2MM9 A;  5K8F A;  5BSR A;  1UWD A;  5A1G A;  1LQL A;  4K0B A;  3NI2 A;  4I9G A;  1AMU A;  4JI2 C;  2CXC A;  1XDX A;  4GXR A;  1M6X C;  1N32 C;  4PUG A;  3VNQ A;  1GPM A;  1K0R A;  1PG3 A;  3UEB A;  2VQE C;  4DV1 C;  3GR1 A;  4FUT A;  3C5E A;  4LF4 C;  1XRB A;  4JI1 C;  3IEU A;  3K6R A;  2BH1 X;  4RLF A;  3EER A;  4WS9 A;  2UXC C;  5T8S A;  5GTD A;  3AY0 A;  1O90 A;  3LNO A;  4MH4 A;  3A9V A;  2P2F A;  3FCC A;  2E8F A;  3J81 D;  2WP0 C;  3CQ2 A;  3NYQ A;  4K0K C;  5A19 A;  2V7B A;  3PES A;  4LF5 C;  5CZV A;  2ZZN A;  5AE1 A;  5BUR A;  4LFA C;  4EAT A;  1PG4 A;  3RV2 A;  1LCI A;  3OTO C;  4HPV A;  3NYR A;  5BSM A;  3UX2 A;  2E0G A;  3DHV A;  3L95 X;  3TQI A;  2ZTB A;  2M5H A;  5KYT A;  2Z51 A;  1EGA A;  5ADZ A;  2D27 A;  2Y27 A;  2DHM A;  2KDN A;  4KHP C;  2NCL A;  3LGX A;  3A25 A;  1ZB8 A;  4JYA C;  4DR4 C;  1XMO C;  3LUS A;  2ASB A;  3ETC A;  4R0M A;  2F4V C;  3IPL A;  1IBL C;  5A2Q D;  1MD9 A;  2EGT A;  2P2Q A;  3RG2 A;  2UU9 C;  4NXM C;  2DYJ A;  1J5E C;  3UX3 A;  4X65 C;  2UUC C;  4PZP A;  4BBY A;  5BST A;  2E5L C;  4DCU A;  4DV5 C;  3T1Y C;  5K85 A;  4NDN A;  2PN2 A;  1VEH A;  3SO4 A;  4ZJZ A;  1XNR C;  3JAM D;  1O93 A;  4PUH A;  4RM3 A;  4BC9 A;  1N33 C;  5BUS A;  5AE2 A;  1PU1 A;  3N2Q A;  2P02 A;  4PUI A;  3R9W A;  3G7S A;  3TR3 A;  1P4E C;  5IT9 D;  3H2T A;  5BR8 C;  1VLA A;  1IB8 A;  3O2E A;  4GKJ C;  1MKY A;  2PT7 G;  2D1S A;  5LMU C;  5JRH A;  1L2F A;  1I94 C;  5DV9 A;  2P2M A;  4NXN C;  1UKK A;  3FM7 A;  1V25 A;  3CW8 X;  2D1R A;  5LCI A;  4D56 A;  1NYE A;  3IEV A;  1QWI A;  4B3R C;  4G1I A;  2HHH C;  4X66 C;  2OPL A;  2OPL B;  3N54 B;  5IFI A;  2QVY X;  4BCA A;  5T8T A;  1M6X A;  5BSU A;  4FTF A;  2JMP A;  3J80 D;  2VZE A;  3VNS A;  2UXB C;  2JNV A;  4YHH C;  1XRC A;  1V26 A;  1HNZ C;  2D1T A;  3A4I A;  3GKU A;  4DV0 C;  3UZ0 A;  4JI4 C;  4DV7 C;  4BC7 A;  4DUZ C;  4AQY C;  1MXC A;  4I9F A;  4OXI A;  4IR7 A;  2VSQ A;  1FLO A;  2OBV A;  2YX1 A;  4JI7 C;  2QVX X;  4LFC C;  4R1M A;  3J7A D;  2E8E A;  3FCE A;  2D1Q A;  5KEI A;  4L4Q A;  1TH5 A;  1ZB9 A;  3AF5 A;  3I07 A;  2PRO A;  4LF8 C;  5BSV A;  4KTT A;  2D28 C;  4DCT A;  1HNX C;  1P7L A;  1USP A;  1PA4 A;  1USP B;  4DR6 C;  2P2B A;  1WCJ A;  2PG1 E;  2E8C A;  4IZ6 A;  1N36 C;  3CW9 A;  1RG9 A;  5BUQ A;  3LNV A;  4JI3 C;  2CY1 A;  5E7Q A;  4LE5 A;  1MXA A;  1O9T A;  3AF6 A;  1RY2 A;  4L7I A;  4D4I A;  4GKK C;  3GR0 A;  3UOW A;  3R9X A;  4XX2 A;  2M5O A;  2YCB A;  2ZM6 C;  1FUG A;  3PBK A;  2UUA C;  4DV2 C;  4BSZ A;  3GPC A;  4RM2 A;  4DG8 A;  5FLX D;  4LFB C;  4G36 A;  2KZF A;  1T5D X;  2ONF A;  3KXW A;  3VNR A;  4JM1 A;  4DG9 A;  4X64 C;  4DR1 C;  2CU6 A;  3E7X A;  4LF7 C;  1ULT A;  4NOZ A;  5BSW A;  4D57 A;  4TPS B;  4LF9 C;  3CQ3 A;  4WV3 A;  1N2F A;  2WD9 A;  1P4E A;  3PRO C;  4GS5 A;  1JOS A;  3ETO A;  1QM4 A;  2YWC A;  3B7W A;  1HH2 P;  3S82 A;  1O92 A;  3LAX A;  3DAY A;  2XR1 A;  3CQ1 A;  4FUQ A;  4G37 A;  4LF6 C;  2P20 A;  1NY8 A;  2P2J A;  4DR3 C;  1WH9 A;  4JI5 C;  2D7V A;  4X62 C;  5CZX A;  4DCS A;  4U5Y D;  1N34 C;  2Y4N A;  4DR2 C;  1BA3 A;  5A1I A;  3A9U A;  1XMQ C;  1YGT A;  4DV3 C;  3L8C A;  4MTN A;  3E7W A;  4DCV A;  5H9U A;  2QVZ X;  3T1H C;  4B3M C;  2KZ0 A;  4YY3 C;  1XS3 A;  1V60 A;  2BJO A;  3TUF A;  3NPD A;  4L2Z A;  2ZZM A;  2AYA A;  3A26 A;  4RMN A;  3EQ6 A;  1XNQ C; 
#chains in the Genus database with same CATH homology
 1MDB A;  3I08 A;  1IBK C;  4JI0 C;  4B3T C;  4OX9 C;  4DUY C;  4KTV A;  1YJ7 A;  3R44 A;  4GXQ A;  4DR5 C;  2VQF C;  4DV6 C;  1IBM C;  4ZLP A;  4JV5 C;  4RVO A;  4DV4 C;  5IWA C;  1KKG A;  1MDF A;  1WF3 A;  4D4G A;  2QL8 A;  4JI6 C;  3CJE A;  2HJG A;  2ATW A;  2QW0 X;  5LMN C;  4B3S C;  3IML A;  1HNW C;  4JI8 C;  4OYC A;  5KYV A;  1MXB A;  4R1L A;  2UUB C;  1XRA A;  4RVN A;  2OO4 A;  4RLQ A;  3DLP X;  4DR7 C;  2Y4O A;  2UXD C;  1ML8 A;  1T5H X;  3TDE A;  1FJG C;  1HR0 C;  2YWB A;  2E7G A;  4PHT A;  2DPL A;  4PRO C;  4ISB A;  4ODJ A;  5AE3 A;  5K8F A;  5BSR A;  5A1G A;  1LQL A;  4K0B A;  3NI2 A;  4I9G A;  1AMU A;  4JI2 C;  2CXC A;  4GXR A;  1N32 C;  3VNQ A;  1GPM A;  1K0R A;  1PG3 A;  2VQE C;  4DV1 C;  3GR1 A;  4FUT A;  3C5E A;  4LF4 C;  1XRB A;  4JI1 C;  3IEU A;  2BH1 X;  4RLF A;  3EER A;  4WS9 A;  2UXC C;  5T8S A;  5GTD A;  1O90 A;  4MH4 A;  3A9V A;  2P2F A;  3FCC A;  3J81 D;  2E8F A;  2WP0 C;  3NYQ A;  4K0K C;  5A19 A;  2V7B A;  3PES A;  4LF5 C;  5CZV A;  5AE1 A;  5BUR A;  4LFA C;  4EAT A;  1PG4 A;  3RV2 A;  1LCI A;  3OTO C;  4HPV A;  3NYR A;  5BSM A;  2E0G A;  3DHV A;  3L95 X;  3TQI A;  5KYT A;  1EGA A;  5ADZ A;  2D27 A;  2Y27 A;  4KHP C;  3LGX A;  1ZB8 A;  4JYA C;  4DR4 C;  1XMO C;  3LUS A;  2ASB A;  3ETC A;  4R0M A;  2F4V C;  3IPL A;  1IBL C;  5A2Q D;  1MD9 A;  2EGT A;  2P2Q A;  3RG2 A;  2UU9 C;  4NXM C;  2DYJ A;  1J5E C;  4X65 C;  2UUC C;  4PZP A;  4BBY A;  5BST A;  2E5L C;  4DCU A;  4DV5 C;  3T1Y C;  5K85 A;  4NDN A;  2PN2 A;  3SO4 A;  4ZJZ A;  1XNR C;  3JAM D;  1O93 A;  4RM3 A;  4BC9 A;  1N33 C;  5BUS A;  5AE2 A;  3N2Q A;  2P02 A;  3R9W A;  3G7S A;  5IT9 D;  3H2T A;  5BR8 C;  1VLA A;  4GKJ C;  1MKY A;  2PT7 G;  2D1S A;  5LMU C;  5JRH A;  1L2F A;  1I94 C;  5DV9 A;  2P2M A;  4NXN C;  1UKK A;  1V25 A;  3CW8 X;  2D1R A;  4D56 A;  1NYE A;  3IEV A;  1QWI A;  4B3R C;  4G1I A;  2HHH C;  4X66 C;  2OPL A;  2OPL B;  3N54 B;  5IFI A;  2QVY X;  4BCA A;  5T8T A;  5BSU A;  4FTF A;  2JMP A;  3J80 D;  2VZE A;  3VNS A;  2UXB C;  4YHH C;  1XRC A;  1V26 A;  1HNZ C;  2D1T A;  3A4I A;  3GKU A;  4DV0 C;  3UZ0 A;  4JI4 C;  4DV7 C;  4BC7 A;  4DUZ C;  4AQY C;  1MXC A;  4I9F A;  4OXI A;  4IR7 A;  2VSQ A;  2OBV A;  4JI7 C;  2QVX X;  4LFC C;  4R1M A;  3J7A D;  2E8E A;  3FCE A;  2D1Q A;  5KEI A;  4L4Q A;  1ZB9 A;  3AF5 A;  3I07 A;  2PRO A;  4LF8 C;  5BSV A;  4KTT A;  2D28 C;  4DCT A;  1HNX C;  1P7L A;  1USP A;  1PA4 A;  1USP B;  4DR6 C;  2P2B A;  2E8C A;  4IZ6 A;  1N36 C;  3CW9 A;  1RG9 A;  5BUQ A;  3LNV A;  4JI3 C;  2CY1 A;  5E7Q A;  4LE5 A;  1MXA A;  1O9T A;  3AF6 A;  1RY2 A;  4L7I A;  4D4I A;  4GKK C;  3GR0 A;  3UOW A;  3R9X A;  4XX2 A;  2YCB A;  2ZM6 C;  1FUG A;  3PBK A;  2UUA C;  4DV2 C;  4BSZ A;  3GPC A;  4RM2 A;  4DG8 A;  5FLX D;  4LFB C;  4G36 A;  2KZF A;  1T5D X;  2ONF A;  3KXW A;  3VNR A;  4JM1 A;  4DG9 A;  4X64 C;  4DR1 C;  3E7X A;  4LF7 C;  1ULT A;  4NOZ A;  5BSW A;  4D57 A;  4TPS B;  4LF9 C;  4WV3 A;  1N2F A;  2WD9 A;  3PRO C;  4GS5 A;  1JOS A;  3ETO A;  1QM4 A;  2YWC A;  3B7W A;  1HH2 P;  3S82 A;  1O92 A;  3LAX A;  3DAY A;  2XR1 A;  4FUQ A;  4G37 A;  4LF6 C;  2P20 A;  2P2J A;  4DR3 C;  1WH9 A;  4JI5 C;  2D7V A;  4X62 C;  5CZX A;  4DCS A;  4U5Y D;  1N34 C;  2Y4N A;  4DR2 C;  1BA3 A;  5A1I A;  3A9U A;  1XMQ C;  4DV3 C;  3L8C A;  4MTN A;  3E7W A;  5H9U A;  4DCV A;  2QVZ X;  3T1H C;  4B3M C;  4YY3 C;  2BJO A;  3TUF A;  3NPD A;  4L2Z A;  2AYA A;  4RMN A;  3EQ6 A;  1XNQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...