4DV2C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv2C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv2C02
4LF4C 4DV2C 2ASBA 4DV1C 2ONFA 1ZB9A 4NXNC 3T1YC 4JI5C 1L2FA 4LF5C 4DV3C 1WF3A 1WH9A 3OTOC 1J5EC 2HHHC 4JI1C 2UUCC 1ML8A 2VQEC 2F4VC 1XNRC 4LFAC 2QL8A 4JV5C 2E8EA 3IEUA 4NOZA 1NYEA 5LMUC 4DUYC 3J7AD 4DV0C 5A2QD 1HNZC 4LFCC 4MTNA 4JI8C 1HR0C 2E5LC 4DCUA 3AF6A 5IT9D 2XR1A 1USPA 4JYAC 2VQFC 4DCTA 1XMQC 2CY1A 4DCSA 3IEVA 1KKGA 1IBKC 4B3RC 1XNQC 4LF7C 2OPLA 4JI7C 5BR8C 3JAMD 3EERA 4B3TC 4YY3C 2ZM6C 4X62C 4DR1C 3J81D 4X66C 3LUSA 1VLAA 4DUZC 1EGAA 2E8CA 4DR7C 2DYJA 3R9XA 4MH4A 4DR6C 2UXBC 3T1HC 1N33C 1N2FA 4K0KC 2PT7G 4GKKC 4JI0C 2JMPA 4BSZA 2PN2A 4B3MC 4YHHC 3J80D 1N32C 4DR5C 1N36C 2D7VA 4LF6C 5LMNC 2YCBA 2E7GA 4AQYC 1XMOC 4OX9C 4LFBC 1PA4A 2BJOA 1I94C 1UKKA 1QWIA 2KZFA 4X64C 1HNXC 2UUBC 2UXDC 1IBMC 4LF8C 1K0RA 1MKYA 2E8FA 3I07A 4JI4C 5FLXD 2UXCC 1IBLC 5IWAC 2UUAC 4DR3C 3R9WA 1HNWC 4B3SC 3AF5A 4JI2C 4DR2C 4KHPC 4DV4C 2EGTA 1USPB 3GKUA 4DR4C 4GKJC 4DV7C 2HJGA 4JI6C 1JOSA 4XX2A 1N34C 3CJEA 2OPLB 4JI3C 1HH2P 2ATWA 4LF9C 2UU9C 4X65C 1FJGC 4DV5C 4NXMC 1LQLA 4DV6C 4DCVA 1ZB8A 2CXCA
chains in the Genus database with same CATH superfamily
5BUQA 4PHTA 4G37A 2VSQA 2ONFA 5BSVA 3C5EA 2D1TA 4RLQA 2D1QA 2VZEA 2HHHC 4JI1C 1UWDA 2UUCC 2F4VC 3K6RA 2QL8A 2E8EA 3N2QA 1XRAA 1NYEA 3N54B 4L7IA 3TR3A 3ETCA 5LMUC 3J7AD 2MCQA 3FM7A 4JI8C 2E5LC 4G36A 3AY0A 2DPLA 4B3RC 1XNQC 3NYQA 2OPLA 2ZZNA 4JI7C 3TDEA 2D1RA 4L4QA 3NYRA 4YY3C 3J81D 4GXRA 1ULTA 3A26A 3R9XA 3E7XA 2UXBC 3E7WA 1MXCA 1N33C 1N2FA 4GKKC 1LCIA 3J80D 4DG8A 5LMNC 4PZPA 1MD9A 1QWIA 1RG9A 4ODJA 4L2ZA 4BCAA 1T5HX 2UUBC 1IBMC 1T5DX 2E8FA 5FLXD 4D4GA 5IWAC 4D56A 5KYVA 2UUAC 3A9VA 1PG4A 3FCCA 2YWBA 1O90A 2EGTA 1O92A 2P20A 4RVOA 4DV7C 1YJ7A 3R44A 3UX2A 2P02A 4XX2A 4BBYA 2OPLB 4GXQA 5H9UA 3PROC 2MM9A 3RG2A 4OXIA 3IPLA 4DV5C 4NXMC 4R0MA 3GPCA 1MXBA 1LQLA 4DV2C 2BH1X 1ZB9A 1BA3A 3T1YC 5A1IA 4FUTA 4JI5C 3A4IA 4DV3C 5T8SA 2D1SA 1ML8A 2VQEC 3FCEA 3LAXA 1XNRC 1PG3A 1P7LA 1MDBA 2YX1A 5CZXA 5DV9A 3CW8X 5IT9D 2XR1A 1USPA 4JYAC 1XMQC 2CY1A 5BURA 5IFIA 5AE3A 4LF7C 1VEHA 3JAMD 2ZM6C 4TPSB 2P2FA 1PU1A 1O9TA 4X66C 3LUSA 5KYTA 4DUZC 4DR7C 2DYJA 4RMNA 5AE2A 5K8FA 1MXAA 4K0KC 2JMPA 5CZVA 4B3MC 5GTDA 1NY8A 2QVZX 1RY2A 4HPVA 1XMOC 4ZJZA 4OX9C 5LCIA 1I94C 1V25A 2Y27A 1HNXC 5BSWA 2UXDC 2Z51A 3EQ6A 1K0RA 1MKYA 2YWCA 2KZ0A 1HNWC 3AF5A 5A1GA 4DR2C 1USPB 4DR4C 2DHMA 3PESA 1JOSA 1N34C 4BC9A 2P2QA 3CJEA 1YGTA 5AE1A 2JNVA 1M6XA 4WV3A 2UU9C 4X65C 2WP0C 3L8CA 2NCLA 5BSTA 5BSUA 1V60A 1P4EA 4LF4C 4DV1C 5BUSA 4NDNA 5BSMA 4NXNC 3H2TA 1V26A 4LF5C 1FLOA 3OTOC 1J5EC 3CQ2A 4D4IA 4ISBA 4I9GA 4BC7A 3UZ0A 4R1LA 4DG9A 4JV5C 3IEUA 4NOZA 5E7QA 2QVYX 3I08A 4DV0C 1HNZC 3TUFA 4LFCC 5KEIA 4MTNA 3O2EA 2MMAB 4RVNA 3VNSA 4DCUA 3NI2A 5BSRA 2VQFC 4DCTA 4LE5A 3IEVA 1AMUA 1MDFA 4FTFA 2WD9A 2QVXX 3EERA 4B3TC 2P2MA 1VLAA 2CU6A 2E8CA 4PUIA 2ZZMA 2V7BA 1M6XC 4EATA 4JI0C 1XHJA 4BSZA 4YHHC 1N32C 4DR5C 3G7SA 2D7VA 2YCBA 3LNOA 3IMLA 4LFBC 1PA4A 2BJOA 1P4EC 1UKKA 4KTTA 4X64C 3RV2A 4PROC 3VNQA 4LF8C 3I07A 3TQIA 4PUHA 4JI4C 4JM1A 2P2BA 1IBLC 2UXCC 1XDXA 5A19A 4IR7A 4B3SC 3S82A 3GKUA 3DLPX 3VNRA 4GKJC 1IB8A 2E0GA 2AYAA 2D28C 2HJGA 4JI6C 3UX3A 4JI3C 2ATWA 3A25A 4KTVA 4LF9C 3GR0A 1GPMA 4RM2A 2D27A 4DV6C 4DCVA 4GS5A 1ZB8A 2CXCA 3CQ1A 2ASBA 4WS9A 5T8TA 1L2FA 1TH5A 1WF3A 1WH9A 3B7WA 5JRHA 2Y4NA 4LFAC 2P2JA 3LGXA 3L95X 4PUGA 4DUYC 5A2QD 2QW0X 2PROA 4ZLPA 1FUGA 4OYCA 2KDNA 3A9UA 1HR0C 3CQ3A 2M5OA 3AF6A 3UOWA 4DCSA 1XRCA 1KKGA 1WCJA 4RM3A 1IBKC 5BR8C 3KXWA 4X62C 4DR1C 3LNVA 1EGAA 3CW9A 3DAYA 1O93A 4MH4A 4DR6C 4U5YD 3T1HC 2PT7G 2ZTBA 2Y4OA 2PN2A 2PG1E 1N36C 4LF6C 4AQYC 2E7GA 4D57A 1QM4A 4K0BA 2KZFA 3UEBA 3DHVA 4G1IA 1XS3A 2OO4A 2OBVA 4R1MA 4DR3C 3R9WA 1XRBA 4JI2C 4KHPC 4IZ6A 3NPDA 4DV4C 3SO4A 3ETOA 3PBKA 4RLFA 1HH2P 5K85A 1FJGC 3GR1A 2M5HA 5ADZA 4FUQA 4I9FA
chains in the Genus database with same CATH topology
5BUQA 4PHTA 4G37A 2VSQA 2ONFA 5BSVA 3C5EA 2D1TA 4RLQA 2D1QA 2VZEA 2HHHC 4JI1C 2UUCC 2F4VC 2QL8A 2E8EA 3N2QA 1XRAA 1NYEA 3N54B 4L7IA 3ETCA 5LMUC 3J7AD 4JI8C 2E5LC 4G36A 2DPLA 4B3RC 1XNQC 3NYQA 2OPLA 4JI7C 3TDEA 2D1RA 4L4QA 3NYRA 4YY3C 3J81D 4GXRA 1ULTA 3R9XA 3E7XA 2UXBC 3E7WA 1MXCA 1N33C 1N2FA 4GKKC 1LCIA 3J80D 4DG8A 5LMNC 4PZPA 1MD9A 1QWIA 1RG9A 4ODJA 4L2ZA 4BCAA 1T5HX 2UUBC 1IBMC 1T5DX 2E8FA 5FLXD 4D4GA 5IWAC 4D56A 5KYVA 2UUAC 3A9VA 1PG4A 3FCCA 2YWBA 1O90A 2EGTA 1O92A 2P20A 4RVOA 4DV7C 1YJ7A 3R44A 2P02A 4XX2A 4BBYA 2OPLB 4GXQA 5H9UA 3PROC 3RG2A 4OXIA 3IPLA 4DV5C 4NXMC 4R0MA 3GPCA 1MXBA 1LQLA 4DV2C 2BH1X 1ZB9A 1BA3A 3T1YC 5A1IA 4FUTA 4JI5C 3A4IA 4DV3C 5T8SA 2D1SA 1ML8A 2VQEC 3FCEA 3LAXA 1XNRC 1PG3A 1P7LA 1MDBA 5CZXA 5DV9A 3CW8X 5IT9D 2XR1A 1USPA 4JYAC 1XMQC 2CY1A 5BURA 5IFIA 5AE3A 4LF7C 3JAMD 2ZM6C 4TPSB 2P2FA 5KYTA 1O9TA 4X66C 3LUSA 4DUZC 4DR7C 2DYJA 4RMNA 5AE2A 5K8FA 1MXAA 4K0KC 2JMPA 5CZVA 4B3MC 5GTDA 2QVZX 1RY2A 4HPVA 1XMOC 4ZJZA 4OX9C 1I94C 1V25A 2Y27A 1HNXC 5BSWA 2UXDC 3EQ6A 1K0RA 1MKYA 2YWCA 1HNWC 3AF5A 5A1GA 4DR2C 1USPB 4DR4C 3PESA 1JOSA 1N34C 4BC9A 2P2QA 3CJEA 5AE1A 4WV3A 2UU9C 4X65C 2WP0C 3L8CA 5BSTA 5BSUA 4LF4C 4DV1C 5BUSA 4NDNA 5BSMA 4NXNC 3H2TA 1V26A 4LF5C 3OTOC 1J5EC 4D4IA 4ISBA 4I9GA 4BC7A 3UZ0A 4R1LA 4DG9A 4JV5C 3IEUA 4NOZA 5E7QA 2QVYX 3I08A 4DV0C 1HNZC 3TUFA 4LFCC 5KEIA 4MTNA 4RVNA 3VNSA 4DCUA 3NI2A 5BSRA 2VQFC 4DCTA 4LE5A 3IEVA 1AMUA 1MDFA 4FTFA 2WD9A 2QVXX 3EERA 4B3TC 2P2MA 1VLAA 2E8CA 2V7BA 4EATA 4JI0C 4BSZA 4YHHC 1N32C 4DR5C 3G7SA 2D7VA 2YCBA 3IMLA 4LFBC 1PA4A 2BJOA 1UKKA 4KTTA 4X64C 3RV2A 4PROC 3VNQA 4LF8C 3I07A 3TQIA 4JI4C 4JM1A 2P2BA 1IBLC 2UXCC 5A19A 4IR7A 4B3SC 3S82A 3GKUA 3DLPX 3VNRA 4GKJC 2E0GA 2AYAA 2D28C 2HJGA 4JI6C 4JI3C 2ATWA 4KTVA 4LF9C 3GR0A 1GPMA 4RM2A 2D27A 4DV6C 4DCVA 4GS5A 1ZB8A 2CXCA 2ASBA 4WS9A 5T8TA 1L2FA 1WF3A 1WH9A 3B7WA 5JRHA 2Y4NA 4LFAC 2P2JA 3LGXA 3L95X 4DUYC 5A2QD 2QW0X 2PROA 4ZLPA 1FUGA 4OYCA 3A9UA 1HR0C 3AF6A 3UOWA 4DCSA 1XRCA 1KKGA 4RM3A 1IBKC 5BR8C 3KXWA 4X62C 4DR1C 3LNVA 1EGAA 3CW9A 3DAYA 1O93A 4MH4A 4DR6C 4U5YD 3T1HC 2PT7G 2Y4OA 2PN2A 1N36C 4LF6C 4AQYC 2E7GA 4D57A 1QM4A 4K0BA 2KZFA 3DHVA 4G1IA 2OO4A 2OBVA 4R1MA 4DR3C 3R9WA 1XRBA 4JI2C 4KHPC 4IZ6A 3NPDA 4DV4C 3SO4A 3ETOA 3PBKA 4RLFA 1HH2P 5K85A 1FJGC 3GR1A 5ADZA 4FUQA 4I9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 C;  4DV2 C;  2ASB A;  4DV1 C;  2ONF A;  1ZB9 A;  4NXN C;  3T1Y C;  4JI5 C;  1L2F A;  4LF5 C;  4DV3 C;  1WF3 A;  1WH9 A;  3OTO C;  1J5E C;  2HHH C;  4JI1 C;  2UUC C;  1ML8 A;  2VQE C;  2F4V C;  1XNR C;  4LFA C;  2QL8 A;  4JV5 C;  2E8E A;  3IEU A;  4NOZ A;  1NYE A;  5LMU C;  4DUY C;  3J7A D;  4DV0 C;  5A2Q D;  1HNZ C;  4LFC C;  4MTN A;  4JI8 C;  1HR0 C;  2E5L C;  4DCU A;  3AF6 A;  5IT9 D;  2XR1 A;  1USP A;  4JYA C;  2VQF C;  4DCT A;  1XMQ C;  2CY1 A;  4DCS A;  3IEV A;  1KKG A;  1IBK C;  4B3R C;  1XNQ C;  4LF7 C;  2OPL A;  4JI7 C;  5BR8 C;  3JAM D;  3EER A;  4B3T C;  4YY3 C;  2ZM6 C;  4X62 C;  4DR1 C;  3J81 D;  4X66 C;  3LUS A;  1VLA A;  4DUZ C;  1EGA A;  2E8C A;  4DR7 C;  2DYJ A;  3R9X A;  4MH4 A;  4DR6 C;  2UXB C;  3T1H C;  1N33 C;  1N2F A;  4K0K C;  2PT7 G;  4GKK C;  4JI0 C;  2JMP A;  4BSZ A;  2PN2 A;  4B3M C;  4YHH C;  3J80 D;  1N32 C;  4DR5 C;  1N36 C;  2D7V A;  4LF6 C;  5LMN C;  2YCB A;  2E7G A;  4AQY C;  1XMO C;  4OX9 C;  4LFB C;  1PA4 A;  2BJO A;  1I94 C;  1UKK A;  1QWI A;  2KZF A;  4X64 C;  1HNX C;  2UUB C;  2UXD C;  1IBM C;  4LF8 C;  1K0R A;  1MKY A;  2E8F A;  3I07 A;  4JI4 C;  5FLX D;  2UXC C;  1IBL C;  5IWA C;  2UUA C;  4DR3 C;  3R9W A;  1HNW C;  4B3S C;  3AF5 A;  4JI2 C;  4DR2 C;  4KHP C;  4DV4 C;  2EGT A;  1USP B;  3GKU A;  4DR4 C;  4GKJ C;  4DV7 C;  2HJG A;  4JI6 C;  1JOS A;  4XX2 A;  1N34 C;  3CJE A;  2OPL B;  4JI3 C;  1HH2 P;  2ATW A;  4LF9 C;  2UU9 C;  4X65 C;  1FJG C;  4DV5 C;  4NXM C;  1LQL A;  4DV6 C;  4DCV A;  1ZB8 A;  2CXC A; 
#chains in the Genus database with same CATH topology
 5BUQ A;  4PHT A;  4G37 A;  2VSQ A;  2ONF A;  5BSV A;  3C5E A;  2D1T A;  4RLQ A;  2D1Q A;  2VZE A;  2HHH C;  4JI1 C;  1UWD A;  2UUC C;  2F4V C;  3K6R A;  2QL8 A;  2E8E A;  3N2Q A;  1XRA A;  1NYE A;  3N54 B;  4L7I A;  3TR3 A;  3ETC A;  5LMU C;  3J7A D;  2MCQ A;  3FM7 A;  4JI8 C;  2E5L C;  4G36 A;  3AY0 A;  2DPL A;  4B3R C;  1XNQ C;  3NYQ A;  2OPL A;  2ZZN A;  4JI7 C;  3TDE A;  2D1R A;  4L4Q A;  3NYR A;  4YY3 C;  3J81 D;  4GXR A;  1ULT A;  3A26 A;  3R9X A;  3E7X A;  2UXB C;  3E7W A;  1MXC A;  1N33 C;  1N2F A;  4GKK C;  1LCI A;  3J80 D;  4DG8 A;  5LMN C;  4PZP A;  1MD9 A;  1QWI A;  1RG9 A;  4ODJ A;  4L2Z A;  4BCA A;  1T5H X;  2UUB C;  1IBM C;  1T5D X;  2E8F A;  5FLX D;  4D4G A;  5IWA C;  4D56 A;  5KYV A;  2UUA C;  3A9V A;  1PG4 A;  3FCC A;  2YWB A;  1O90 A;  2EGT A;  1O92 A;  2P20 A;  4RVO A;  4DV7 C;  1YJ7 A;  3R44 A;  3UX2 A;  2P02 A;  4XX2 A;  4BBY A;  2OPL B;  4GXQ A;  5H9U A;  3PRO C;  2MM9 A;  3RG2 A;  4OXI A;  3IPL A;  4DV5 C;  4NXM C;  4R0M A;  3GPC A;  1MXB A;  1LQL A;  4DV2 C;  2BH1 X;  1ZB9 A;  1BA3 A;  3T1Y C;  5A1I A;  4FUT A;  4JI5 C;  3A4I A;  4DV3 C;  5T8S A;  2D1S A;  1ML8 A;  2VQE C;  3FCE A;  3LAX A;  1XNR C;  1PG3 A;  1P7L A;  1MDB A;  2YX1 A;  5CZX A;  5DV9 A;  3CW8 X;  5IT9 D;  2XR1 A;  1USP A;  4JYA C;  1XMQ C;  2CY1 A;  5BUR A;  5IFI A;  5AE3 A;  4LF7 C;  1VEH A;  3JAM D;  2ZM6 C;  4TPS B;  2P2F A;  1PU1 A;  1O9T A;  4X66 C;  3LUS A;  5KYT A;  4DUZ C;  4DR7 C;  2DYJ A;  4RMN A;  5AE2 A;  5K8F A;  1MXA A;  4K0K C;  2JMP A;  5CZV A;  4B3M C;  5GTD A;  1NY8 A;  2QVZ X;  1RY2 A;  4HPV A;  1XMO C;  4ZJZ A;  4OX9 C;  5LCI A;  1I94 C;  1V25 A;  2Y27 A;  1HNX C;  5BSW A;  2UXD C;  2Z51 A;  3EQ6 A;  1K0R A;  1MKY A;  2YWC A;  2KZ0 A;  1HNW C;  3AF5 A;  5A1G A;  4DR2 C;  1USP B;  4DR4 C;  2DHM A;  3PES A;  1JOS A;  1N34 C;  4BC9 A;  2P2Q A;  3CJE A;  1YGT A;  5AE1 A;  2JNV A;  1M6X A;  4WV3 A;  2UU9 C;  4X65 C;  2WP0 C;  3L8C A;  2NCL A;  5BST A;  5BSU A;  1V60 A;  1P4E A;  4LF4 C;  4DV1 C;  5BUS A;  4NDN A;  5BSM A;  4NXN C;  3H2T A;  1V26 A;  4LF5 C;  1FLO A;  3OTO C;  1J5E C;  3CQ2 A;  4D4I A;  4ISB A;  4I9G A;  4BC7 A;  3UZ0 A;  4R1L A;  4DG9 A;  4JV5 C;  3IEU A;  4NOZ A;  5E7Q A;  2QVY X;  3I08 A;  4DV0 C;  1HNZ C;  3TUF A;  4LFC C;  5KEI A;  4MTN A;  3O2E A;  2MMA B;  4RVN A;  3VNS A;  4DCU A;  3NI2 A;  5BSR A;  2VQF C;  4DCT A;  4LE5 A;  3IEV A;  1AMU A;  1MDF A;  4FTF A;  2WD9 A;  2QVX X;  3EER A;  4B3T C;  2P2M A;  1VLA A;  2CU6 A;  2E8C A;  4PUI A;  2ZZM A;  2V7B A;  1M6X C;  4EAT A;  4JI0 C;  1XHJ A;  4BSZ A;  4YHH C;  1N32 C;  4DR5 C;  3G7S A;  2D7V A;  2YCB A;  3LNO A;  3IML A;  4LFB C;  1PA4 A;  2BJO A;  1P4E C;  1UKK A;  4KTT A;  4X64 C;  3RV2 A;  4PRO C;  3VNQ A;  4LF8 C;  3I07 A;  3TQI A;  4PUH A;  4JI4 C;  4JM1 A;  2P2B A;  1IBL C;  2UXC C;  1XDX A;  5A19 A;  4IR7 A;  4B3S C;  3S82 A;  3GKU A;  3DLP X;  3VNR A;  4GKJ C;  1IB8 A;  2E0G A;  2AYA A;  2D28 C;  2HJG A;  4JI6 C;  3UX3 A;  4JI3 C;  2ATW A;  3A25 A;  4KTV A;  4LF9 C;  3GR0 A;  1GPM A;  4RM2 A;  2D27 A;  4DV6 C;  4DCV A;  4GS5 A;  1ZB8 A;  2CXC A;  3CQ1 A;  2ASB A;  4WS9 A;  5T8T A;  1L2F A;  1TH5 A;  1WF3 A;  1WH9 A;  3B7W A;  5JRH A;  2Y4N A;  4LFA C;  2P2J A;  3LGX A;  3L95 X;  4PUG A;  4DUY C;  5A2Q D;  2QW0 X;  2PRO A;  4ZLP A;  1FUG A;  4OYC A;  2KDN A;  3A9U A;  1HR0 C;  3CQ3 A;  2M5O A;  3AF6 A;  3UOW A;  4DCS A;  1XRC A;  1KKG A;  1WCJ A;  4RM3 A;  1IBK C;  5BR8 C;  3KXW A;  4X62 C;  4DR1 C;  3LNV A;  1EGA A;  3CW9 A;  3DAY A;  1O93 A;  4MH4 A;  4DR6 C;  4U5Y D;  3T1H C;  2PT7 G;  2ZTB A;  2Y4O A;  2PN2 A;  2PG1 E;  1N36 C;  4LF6 C;  4AQY C;  2E7G A;  4D57 A;  1QM4 A;  4K0B A;  2KZF A;  3UEB A;  3DHV A;  4G1I A;  1XS3 A;  2OO4 A;  2OBV A;  4R1M A;  4DR3 C;  3R9W A;  1XRB A;  4JI2 C;  4KHP C;  4IZ6 A;  3NPD A;  4DV4 C;  3SO4 A;  3ETO A;  3PBK A;  4RLF A;  1HH2 P;  5K85 A;  1FJG C;  3GR1 A;  2M5H A;  5ADZ A;  4FUQ A;  4I9F A; 
#chains in the Genus database with same CATH homology
 5BUQ A;  4PHT A;  4G37 A;  2VSQ A;  2ONF A;  5BSV A;  3C5E A;  2D1T A;  4RLQ A;  2D1Q A;  2VZE A;  2HHH C;  4JI1 C;  2UUC C;  2F4V C;  2QL8 A;  2E8E A;  3N2Q A;  1XRA A;  1NYE A;  3N54 B;  4L7I A;  3ETC A;  5LMU C;  3J7A D;  4JI8 C;  2E5L C;  4G36 A;  2DPL A;  4B3R C;  1XNQ C;  3NYQ A;  2OPL A;  4JI7 C;  3TDE A;  2D1R A;  4L4Q A;  3NYR A;  4YY3 C;  3J81 D;  4GXR A;  1ULT A;  3R9X A;  3E7X A;  2UXB C;  3E7W A;  1MXC A;  1N33 C;  1N2F A;  4GKK C;  1LCI A;  3J80 D;  4DG8 A;  5LMN C;  4PZP A;  1MD9 A;  1QWI A;  1RG9 A;  4ODJ A;  4L2Z A;  4BCA A;  1T5H X;  2UUB C;  1IBM C;  1T5D X;  2E8F A;  5FLX D;  4D4G A;  5IWA C;  4D56 A;  5KYV A;  2UUA C;  3A9V A;  1PG4 A;  3FCC A;  2YWB A;  1O90 A;  2EGT A;  1O92 A;  2P20 A;  4RVO A;  4DV7 C;  1YJ7 A;  3R44 A;  2P02 A;  4XX2 A;  4BBY A;  2OPL B;  4GXQ A;  5H9U A;  3PRO C;  3RG2 A;  4OXI A;  3IPL A;  4DV5 C;  4NXM C;  4R0M A;  3GPC A;  1MXB A;  1LQL A;  4DV2 C;  2BH1 X;  1ZB9 A;  1BA3 A;  3T1Y C;  5A1I A;  4FUT A;  4JI5 C;  3A4I A;  4DV3 C;  5T8S A;  2D1S A;  1ML8 A;  2VQE C;  3FCE A;  3LAX A;  1XNR C;  1PG3 A;  1P7L A;  1MDB A;  5CZX A;  5DV9 A;  3CW8 X;  5IT9 D;  2XR1 A;  1USP A;  4JYA C;  1XMQ C;  2CY1 A;  5BUR A;  5IFI A;  5AE3 A;  4LF7 C;  3JAM D;  2ZM6 C;  4TPS B;  2P2F A;  5KYT A;  1O9T A;  4X66 C;  3LUS A;  4DUZ C;  4DR7 C;  2DYJ A;  4RMN A;  5AE2 A;  5K8F A;  1MXA A;  4K0K C;  2JMP A;  5CZV A;  4B3M C;  5GTD A;  2QVZ X;  1RY2 A;  4HPV A;  1XMO C;  4ZJZ A;  4OX9 C;  1I94 C;  1V25 A;  2Y27 A;  1HNX C;  5BSW A;  2UXD C;  3EQ6 A;  1K0R A;  1MKY A;  2YWC A;  1HNW C;  3AF5 A;  5A1G A;  4DR2 C;  1USP B;  4DR4 C;  3PES A;  1JOS A;  1N34 C;  4BC9 A;  2P2Q A;  3CJE A;  5AE1 A;  4WV3 A;  2UU9 C;  4X65 C;  2WP0 C;  3L8C A;  5BST A;  5BSU A;  4LF4 C;  4DV1 C;  5BUS A;  4NDN A;  5BSM A;  4NXN C;  3H2T A;  1V26 A;  4LF5 C;  3OTO C;  1J5E C;  4D4I A;  4ISB A;  4I9G A;  4BC7 A;  3UZ0 A;  4R1L A;  4DG9 A;  4JV5 C;  3IEU A;  4NOZ A;  5E7Q A;  2QVY X;  3I08 A;  4DV0 C;  1HNZ C;  3TUF A;  4LFC C;  5KEI A;  4MTN A;  4RVN A;  3VNS A;  4DCU A;  3NI2 A;  5BSR A;  2VQF C;  4DCT A;  4LE5 A;  3IEV A;  1AMU A;  1MDF A;  4FTF A;  2WD9 A;  2QVX X;  3EER A;  4B3T C;  2P2M A;  1VLA A;  2E8C A;  2V7B A;  4EAT A;  4JI0 C;  4BSZ A;  4YHH C;  1N32 C;  4DR5 C;  3G7S A;  2D7V A;  2YCB A;  3IML A;  4LFB C;  1PA4 A;  2BJO A;  1UKK A;  4KTT A;  4X64 C;  3RV2 A;  4PRO C;  3VNQ A;  4LF8 C;  3I07 A;  3TQI A;  4JI4 C;  4JM1 A;  2P2B A;  1IBL C;  2UXC C;  5A19 A;  4IR7 A;  4B3S C;  3S82 A;  3GKU A;  3DLP X;  3VNR A;  4GKJ C;  2E0G A;  2AYA A;  2D28 C;  2HJG A;  4JI6 C;  4JI3 C;  2ATW A;  4KTV A;  4LF9 C;  3GR0 A;  1GPM A;  4RM2 A;  2D27 A;  4DV6 C;  4DCV A;  4GS5 A;  1ZB8 A;  2CXC A;  2ASB A;  4WS9 A;  5T8T A;  1L2F A;  1WF3 A;  1WH9 A;  3B7W A;  5JRH A;  2Y4N A;  4LFA C;  2P2J A;  3LGX A;  3L95 X;  4DUY C;  5A2Q D;  2QW0 X;  2PRO A;  4ZLP A;  1FUG A;  4OYC A;  3A9U A;  1HR0 C;  3AF6 A;  3UOW A;  4DCS A;  1XRC A;  1KKG A;  4RM3 A;  1IBK C;  5BR8 C;  3KXW A;  4X62 C;  4DR1 C;  3LNV A;  1EGA A;  3CW9 A;  3DAY A;  1O93 A;  4MH4 A;  4DR6 C;  4U5Y D;  3T1H C;  2PT7 G;  2Y4O A;  2PN2 A;  1N36 C;  4LF6 C;  4AQY C;  2E7G A;  4D57 A;  1QM4 A;  4K0B A;  2KZF A;  3DHV A;  4G1I A;  2OO4 A;  2OBV A;  4R1M A;  4DR3 C;  3R9W A;  1XRB A;  4JI2 C;  4KHP C;  4IZ6 A;  3NPD A;  4DV4 C;  3SO4 A;  3ETO A;  3PBK A;  4RLF A;  1HH2 P;  5K85 A;  1FJG C;  3GR1 A;  5ADZ A;  4FUQ A;  4I9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...