4DV2C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv2C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv2C02
3OTOC 4YY3C 4X64C 3T1YC 5IT9D 1USPA 1IBLC 4MH4A 4X62C 4JI0C 4X65C 5LMNC 4NOZA 2QL8A 4LF9C 3LUSA 2E8CA 1ZB9A 4OX9C 2ZM6C 2CXCA 4DR7C 1ML8A 2HJGA 4LF7C 4DCVA 4JI3C 4K0KC 1N36C 1FJGC 4DV6C 2E8EA 4DV1C 4JV5C 3IEUA 4DCTA 5FLXD 2E5LC 1LQLA 4DR5C 4DUZC 1HNXC 4B3TC 3J81D 2ONFA 4B3RC 1WH9A 4DR1C 4AQYC 1I94C 4YHHC 2ASBA 3R9XA 4JI6C 4DV0C 1N34C 3J7AD 1XMOC 1N33C 1N32C 1K0RA 2D7VA 2UUAC 4LF8C 2UU9C 5BR8C 4JI8C 2JMPA 4DR2C 1XNRC 5LMUC 1J5EC 4LF5C 3T1HC 4DUYC 1L2FA 4LFCC 3IEVA 1ZB8A 1HR0C 2YCBA 4B3MC 2DYJA 1XMQC 4BSZA 4DV5C 3I07A 1QWIA 3GKUA 4DR6C 2EGTA 1N2FA 2OPLB 5A2QD 1KKGA 2UXBC 4DV2C 1EGAA 4XX2A 2E8FA 2OPLA 3R9WA 2VQFC 1IBKC 4GKJC 1VLAA 2PN2A 2VQEC 1JOSA 2UUBC 4NXNC 4LF4C 4LFAC 3JAMD 3AF6A 4B3SC 2KZFA 1HNZC 2UUCC 2CY1A 4LFBC 1UKKA 2ATWA 4DR3C 1WF3A 3AF5A 4MTNA 4JI4C 4DV7C 3J80D 4DCSA 4DR4C 1PA4A 1XNQC 4KHPC 4JYAC 4DCUA 4GKKC 4JI5C 2F4VC 4JI7C 2UXDC 1HH2P 1HNWC 2UXCC 3EERA 2XR1A 3CJEA 5IWAC 2HHHC 2E7GA 1MKYA 2PT7G 4NXMC 2BJOA 4JI1C 4X66C 1IBMC 4LF6C 1NYEA 4DV4C 4DV3C 4JI2C 1USPB
chains in the Genus database with same CATH superfamily
4U5YD 3NYRA 4BBYA 4PROC 4MH4A 3TUFA 2MCQA 4X62C 4I9FA 5LMNC 3E7XA 4NOZA 2QW0X 4PZPA 2E0GA 2D1TA 1V26A 2CXCA 2MM9A 3PESA 4JM1A 1ML8A 2HJGA 4RLQA 4KTTA 4FTFA 1FJGC 4RVNA 5FLXD 1LQLA 4DR5C 1V60A 4B3RC 4DR1C 4AQYC 3CW8X 1I94C 3UX2A 1MXAA 4DV0C 1XMOC 5BSUA 3N54B 1N32C 1K0RA 3ETOA 3LGXA 2UUAC 3S82A 3RG2A 3TQIA 4DUYC 1L2FA 3A25A 1T5DX 2MMAB 2P02A 1XRAA 3IEVA 1XS3A 2BH1X 5A2QD 4XX2A 3E7WA 4I9GA 3R9WA 1IBKC 4GKJC 5BSTA 4RM2A 3H2TA 2VQEC 1YGTA 1O9TA 5KYVA 1PG3A 1RY2A 2M5OA 4IZ6A 3CW9A 3L95X 2WP0C 4R1MA 1HNZC 2UUCC 3N2QA 2CY1A 1UKKA 2ATWA 4DR4C 3AF5A 4JI4C 4RVOA 2OBVA 4DG8A 3IPLA 3I08A 4GXQA 4GKKC 2UXDC 3LNOA 3R44A 3GPCA 2P2BA 4ZJZA 1FUGA 4NDNA 4JI2C 2JNVA 3PBKA 5BUSA 2P2MA 3VNRA 3NPDA 5IT9D 5A1IA 3A4IA 1IBLC 4JI0C 3A9VA 4X65C 2KDNA 5AE1A 1O92A 3LUSA 2E8CA 1NY8A 5BSVA 3UEBA 3L8CA 5JRHA 4ISBA 1UWDA 4DCVA 5AE3A 4JI3C 4RLFA 1AMUA 4DCTA 2E5LC 1HNXC 5AE2A 4YHHC 3RV2A 1V25A 1N33C 5A19A 1QM4A 5H9UA 1XNRC 1P7LA 3LAXA 5A1GA 3T1HC 1LCIA 3NYQA 2ZTBA 3EQ6A 2YCBA 1GPMA 3CQ2A 4DR6C 2EGTA 1N2FA 1MXBA 4OYCA 5LCIA 1VLAA 4RMNA 1M6XA 3NI2A 3DAYA 5E7QA 5T8SA 1JOSA 1MDBA 2AYAA 4TPSB 3SO4A 3A26A 4L2ZA 2KZFA 2D1QA 4LFBC 1WF3A 4DV7C 2VZEA 1PA4A 1XNQC 2ZZMA 4L4QA 1T5HX 4DCUA 4JI7C 2KZ0A 3EERA 2HHHC 4NXMC 3UX3A 5CZVA 2D28C 4JI1C 4X66C 5GTDA 4FUTA 4BC9A 4DV3C 4PUGA 3AY0A 3OTOC 2D1RA 4G37A 4X64C 4WS9A 3FCEA 4R0MA 4K0BA 2NCLA 1MXCA 4PUHA 4PHTA 1ZB9A 1PG4A 4OX9C 3CQ3A 4DG9A 4D57A 3C5EA 4K0KC 2E8EA 2P2JA 3IEUA 3VNQA 2YX1A 3FM7A 4B3TC 3J81D 1WH9A 3R9XA 2ASBA 4D56A 4JI6C 1N34C 1M6XC 4KTVA 3CQ1A 4JI8C 5BSMA 5LMUC 5KEIA 2CU6A 1BA3A 3A9UA 4LFCC 1XRCA 3K6RA 1XMQC 4BSZA 4DV5C 3I07A 4OXIA 3GKUA 2DHMA 1KKGA 2P20A 4FUQA 4DV2C 2Z51A 2E8FA 5K85A 3LNVA 3KXWA 2UUBC 3IMLA 4LFAC 4BC7A 2QVYX 1MDFA 4MTNA 5T8TA 3J80D 4KHPC 4GS5A 5K8FA 2F4VC 1HH2P 3CJEA 4IR7A 2D27A 4HPVA 5IWAC 4PUIA 3UZ0A 1MKYA 2PT7G 1XDXA 3UOWA 2BJOA 2M5HA 5ADZA 3DHVA 1IBMC 4DV4C 4L7IA 4WV3A 2PROA 1USPB 3PROC 4YY3C 3T1YC 3TDEA 4LE5A 1USPA 1WCJA 4ZLPA 2QL8A 4LF9C 5BURA 2P2QA 2QVXX 2ZM6C 4ODJA 4DR7C 1XHJA 5KYTA 4LF7C 1P4EA 2Y4NA 3FCCA 1N36C 4DV6C 4DV1C 4JV5C 3GR0A 4DUZC 2ONFA 2Y4OA 1PU1A 1XRBA 4R1LA 2Y27A 3TR3A 3J7AD 5BSRA 2D7VA 3DLPX 2OO4A 4LF8C 2UU9C 2V7BA 5BR8C 2JMPA 4DR2C 1ULTA 3GR1A 5CZXA 2PG1E 1J5EC 4LF5C 1VEHA 1RG9A 4BCAA 5IFIA 1ZB8A 1HR0C 4B3MC 2DYJA 3O2EA 4G1IA 2D1SA 1FLOA 1QWIA 1YJ7A 5BUQA 2OPLB 2UXBC 2YWBA 1EGAA 4D4GA 5DV9A 1TH5A 1MD9A 1O93A 2OPLA 2ZZNA 2VQFC 2PN2A 2P2FA 2DPLA 2VSQA 4RM3A 4NXNC 1IB8A 3VNSA 4LF4C 3JAMD 3AF6A 4B3SC 5BSWA 4G36A 4DR3C 4DCSA 4GXRA 4JYAC 2WD9A 4JI5C 2QVZX 3ETCA 3B7WA 1HNWC 2UXCC 1P4EC 2XR1A 4D4IA 2E7GA 1O90A 2YWCA 4LF6C 1NYEA 4EATA 3G7SA
chains in the Genus database with same CATH topology
4U5YD 3NYRA 4BBYA 4PROC 4MH4A 3TUFA 4X62C 4I9FA 5LMNC 3E7XA 4NOZA 2QW0X 4PZPA 2E0GA 2D1TA 1V26A 2CXCA 3PESA 4JM1A 2HJGA 1ML8A 4RLQA 4KTTA 4FTFA 1FJGC 4RVNA 5FLXD 1LQLA 4DR5C 4B3RC 4DR1C 4AQYC 3CW8X 1I94C 1MXAA 4DV0C 1XMOC 5BSUA 3N54B 1N32C 1K0RA 3ETOA 3LGXA 2UUAC 3S82A 3RG2A 3TQIA 4DUYC 1L2FA 1T5DX 2P02A 1XRAA 3IEVA 2BH1X 5A2QD 4XX2A 3E7WA 4I9GA 3R9WA 1IBKC 4GKJC 5BSTA 4RM2A 3H2TA 2VQEC 1O9TA 5KYVA 1PG3A 1RY2A 4IZ6A 3CW9A 3L95X 2WP0C 4R1MA 1HNZC 2UUCC 3N2QA 2CY1A 1UKKA 2ATWA 4DR4C 3AF5A 4JI4C 4RVOA 2OBVA 4DG8A 3IPLA 3I08A 4GXQA 4GKKC 2UXDC 3R44A 3GPCA 2P2BA 4ZJZA 1FUGA 4NDNA 4JI2C 3PBKA 5BUSA 2P2MA 3VNRA 3NPDA 5IT9D 5A1IA 3A4IA 1IBLC 4JI0C 3A9VA 4X65C 5AE1A 1O92A 3LUSA 2E8CA 5BSVA 3L8CA 5JRHA 4ISBA 4DCVA 5AE3A 4JI3C 4RLFA 1AMUA 4DCTA 2E5LC 1HNXC 5AE2A 4YHHC 3RV2A 1V25A 1N33C 5A19A 1QM4A 5H9UA 1XNRC 1P7LA 3LAXA 5A1GA 3T1HC 1LCIA 3NYQA 3EQ6A 2YCBA 1GPMA 4DR6C 2EGTA 1N2FA 1MXBA 4OYCA 1VLAA 4RMNA 3NI2A 3DAYA 5E7QA 5T8SA 1JOSA 1MDBA 2AYAA 4TPSB 3SO4A 4L2ZA 2KZFA 2D1QA 4LFBC 1WF3A 4DV7C 2VZEA 1PA4A 1XNQC 4L4QA 1T5HX 4DCUA 4JI7C 3EERA 2HHHC 4NXMC 5CZVA 2D28C 4JI1C 4X66C 5GTDA 4FUTA 4BC9A 4DV3C 3OTOC 2D1RA 4G37A 4X64C 4WS9A 3FCEA 4R0MA 4K0BA 1MXCA 4PHTA 1ZB9A 1PG4A 4OX9C 4DG9A 4D57A 3C5EA 4K0KC 2E8EA 2P2JA 3IEUA 3VNQA 4B3TC 3J81D 1WH9A 3R9XA 2ASBA 4D56A 4JI6C 1N34C 4KTVA 4JI8C 5BSMA 5LMUC 5KEIA 1BA3A 3A9UA 4LFCC 1XRCA 1XMQC 4BSZA 4DV5C 3I07A 4OXIA 3GKUA 1KKGA 2P20A 4FUQA 4DV2C 2E8FA 5K85A 3LNVA 3KXWA 2UUBC 3IMLA 4LFAC 4BC7A 2QVYX 1MDFA 4MTNA 5T8TA 3J80D 4KHPC 4GS5A 5K8FA 2F4VC 1HH2P 3CJEA 4IR7A 2D27A 4HPVA 5IWAC 3UZ0A 1MKYA 2PT7G 3UOWA 2BJOA 5ADZA 3DHVA 1IBMC 4DV4C 4L7IA 4WV3A 2PROA 1USPB 3PROC 4YY3C 3T1YC 3TDEA 4LE5A 1USPA 4ZLPA 2QL8A 4LF9C 5BURA 2P2QA 2QVXX 2ZM6C 4ODJA 4DR7C 5KYTA 4LF7C 2Y4NA 3FCCA 1N36C 4DV6C 4DV1C 4JV5C 3GR0A 4DUZC 2ONFA 2Y4OA 1XRBA 4R1LA 2Y27A 3J7AD 5BSRA 2D7VA 3DLPX 2OO4A 4LF8C 2UU9C 2V7BA 5BR8C 2JMPA 4DR2C 1ULTA 3GR1A 5CZXA 1J5EC 4LF5C 1RG9A 4BCAA 5IFIA 1ZB8A 1HR0C 4B3MC 2DYJA 4G1IA 2D1SA 1QWIA 1YJ7A 5BUQA 2OPLB 2UXBC 2YWBA 1EGAA 4D4GA 5DV9A 1MD9A 1O93A 2OPLA 2VQFC 2PN2A 2P2FA 2DPLA 2VSQA 4RM3A 4NXNC 3VNSA 4LF4C 3JAMD 3AF6A 4B3SC 5BSWA 4G36A 4DR3C 4DCSA 4GXRA 4JYAC 2WD9A 4JI5C 2QVZX 3ETCA 3B7WA 1HNWC 2UXCC 2XR1A 4D4IA 2E7GA 1O90A 2YWCA 4LF6C 1NYEA 4EATA 3G7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO C;  4YY3 C;  4X64 C;  3T1Y C;  5IT9 D;  1USP A;  1IBL C;  4MH4 A;  4X62 C;  4JI0 C;  4X65 C;  5LMN C;  4NOZ A;  2QL8 A;  4LF9 C;  3LUS A;  2E8C A;  1ZB9 A;  4OX9 C;  2ZM6 C;  2CXC A;  4DR7 C;  1ML8 A;  2HJG A;  4LF7 C;  4DCV A;  4JI3 C;  4K0K C;  1N36 C;  1FJG C;  4DV6 C;  2E8E A;  4DV1 C;  4JV5 C;  3IEU A;  4DCT A;  5FLX D;  2E5L C;  1LQL A;  4DR5 C;  4DUZ C;  1HNX C;  4B3T C;  3J81 D;  2ONF A;  4B3R C;  1WH9 A;  4DR1 C;  4AQY C;  1I94 C;  4YHH C;  2ASB A;  3R9X A;  4JI6 C;  4DV0 C;  1N34 C;  3J7A D;  1XMO C;  1N33 C;  1N32 C;  1K0R A;  2D7V A;  2UUA C;  4LF8 C;  2UU9 C;  5BR8 C;  4JI8 C;  2JMP A;  4DR2 C;  1XNR C;  5LMU C;  1J5E C;  4LF5 C;  3T1H C;  4DUY C;  1L2F A;  4LFC C;  3IEV A;  1ZB8 A;  1HR0 C;  2YCB A;  4B3M C;  2DYJ A;  1XMQ C;  4BSZ A;  4DV5 C;  3I07 A;  1QWI A;  3GKU A;  4DR6 C;  2EGT A;  1N2F A;  2OPL B;  5A2Q D;  1KKG A;  2UXB C;  4DV2 C;  1EGA A;  4XX2 A;  2E8F A;  2OPL A;  3R9W A;  2VQF C;  1IBK C;  4GKJ C;  1VLA A;  2PN2 A;  2VQE C;  1JOS A;  2UUB C;  4NXN C;  4LF4 C;  4LFA C;  3JAM D;  3AF6 A;  4B3S C;  2KZF A;  1HNZ C;  2UUC C;  2CY1 A;  4LFB C;  1UKK A;  2ATW A;  4DR3 C;  1WF3 A;  3AF5 A;  4MTN A;  4JI4 C;  4DV7 C;  3J80 D;  4DCS A;  4DR4 C;  1PA4 A;  1XNQ C;  4KHP C;  4JYA C;  4DCU A;  4GKK C;  4JI5 C;  2F4V C;  4JI7 C;  2UXD C;  1HH2 P;  1HNW C;  2UXC C;  3EER A;  2XR1 A;  3CJE A;  5IWA C;  2HHH C;  2E7G A;  1MKY A;  2PT7 G;  4NXM C;  2BJO A;  4JI1 C;  4X66 C;  1IBM C;  4LF6 C;  1NYE A;  4DV4 C;  4DV3 C;  4JI2 C;  1USP B; 
#chains in the Genus database with same CATH topology
 4U5Y D;  3NYR A;  4BBY A;  4PRO C;  4MH4 A;  3TUF A;  2MCQ A;  4X62 C;  4I9F A;  5LMN C;  3E7X A;  4NOZ A;  2QW0 X;  4PZP A;  2E0G A;  2D1T A;  1V26 A;  2CXC A;  2MM9 A;  3PES A;  4JM1 A;  1ML8 A;  2HJG A;  4RLQ A;  4KTT A;  4FTF A;  1FJG C;  4RVN A;  5FLX D;  1LQL A;  4DR5 C;  1V60 A;  4B3R C;  4DR1 C;  4AQY C;  3CW8 X;  1I94 C;  3UX2 A;  1MXA A;  4DV0 C;  1XMO C;  5BSU A;  3N54 B;  1N32 C;  1K0R A;  3ETO A;  3LGX A;  2UUA C;  3S82 A;  3RG2 A;  3TQI A;  4DUY C;  1L2F A;  3A25 A;  1T5D X;  2MMA B;  2P02 A;  1XRA A;  3IEV A;  1XS3 A;  2BH1 X;  5A2Q D;  4XX2 A;  3E7W A;  4I9G A;  3R9W A;  1IBK C;  4GKJ C;  5BST A;  4RM2 A;  3H2T A;  2VQE C;  1YGT A;  1O9T A;  5KYV A;  1PG3 A;  1RY2 A;  2M5O A;  4IZ6 A;  3CW9 A;  3L95 X;  2WP0 C;  4R1M A;  1HNZ C;  2UUC C;  3N2Q A;  2CY1 A;  1UKK A;  2ATW A;  4DR4 C;  3AF5 A;  4JI4 C;  4RVO A;  2OBV A;  4DG8 A;  3IPL A;  3I08 A;  4GXQ A;  4GKK C;  2UXD C;  3LNO A;  3R44 A;  3GPC A;  2P2B A;  4ZJZ A;  1FUG A;  4NDN A;  4JI2 C;  2JNV A;  3PBK A;  5BUS A;  2P2M A;  3VNR A;  3NPD A;  5IT9 D;  5A1I A;  3A4I A;  1IBL C;  4JI0 C;  3A9V A;  4X65 C;  2KDN A;  5AE1 A;  1O92 A;  3LUS A;  2E8C A;  1NY8 A;  5BSV A;  3UEB A;  3L8C A;  5JRH A;  4ISB A;  1UWD A;  4DCV A;  5AE3 A;  4JI3 C;  4RLF A;  1AMU A;  4DCT A;  2E5L C;  1HNX C;  5AE2 A;  4YHH C;  3RV2 A;  1V25 A;  1N33 C;  5A19 A;  1QM4 A;  5H9U A;  1XNR C;  1P7L A;  3LAX A;  5A1G A;  3T1H C;  1LCI A;  3NYQ A;  2ZTB A;  3EQ6 A;  2YCB A;  1GPM A;  3CQ2 A;  4DR6 C;  2EGT A;  1N2F A;  1MXB A;  4OYC A;  5LCI A;  1VLA A;  4RMN A;  1M6X A;  3NI2 A;  3DAY A;  5E7Q A;  5T8S A;  1JOS A;  1MDB A;  2AYA A;  4TPS B;  3SO4 A;  3A26 A;  4L2Z A;  2KZF A;  2D1Q A;  4LFB C;  1WF3 A;  4DV7 C;  2VZE A;  1PA4 A;  1XNQ C;  2ZZM A;  4L4Q A;  1T5H X;  4DCU A;  4JI7 C;  2KZ0 A;  3EER A;  2HHH C;  4NXM C;  3UX3 A;  5CZV A;  2D28 C;  4JI1 C;  4X66 C;  5GTD A;  4FUT A;  4BC9 A;  4DV3 C;  4PUG A;  3AY0 A;  3OTO C;  2D1R A;  4G37 A;  4X64 C;  4WS9 A;  3FCE A;  4R0M A;  4K0B A;  2NCL A;  1MXC A;  4PUH A;  4PHT A;  1ZB9 A;  1PG4 A;  4OX9 C;  3CQ3 A;  4DG9 A;  4D57 A;  3C5E A;  4K0K C;  2E8E A;  2P2J A;  3IEU A;  3VNQ A;  2YX1 A;  3FM7 A;  4B3T C;  3J81 D;  1WH9 A;  3R9X A;  2ASB A;  4D56 A;  4JI6 C;  1N34 C;  1M6X C;  4KTV A;  3CQ1 A;  4JI8 C;  5BSM A;  5LMU C;  5KEI A;  2CU6 A;  1BA3 A;  3A9U A;  4LFC C;  1XRC A;  3K6R A;  1XMQ C;  4BSZ A;  4DV5 C;  3I07 A;  4OXI A;  3GKU A;  2DHM A;  1KKG A;  2P20 A;  4FUQ A;  4DV2 C;  2Z51 A;  2E8F A;  5K85 A;  3LNV A;  3KXW A;  2UUB C;  3IML A;  4LFA C;  4BC7 A;  2QVY X;  1MDF A;  4MTN A;  5T8T A;  3J80 D;  4KHP C;  4GS5 A;  5K8F A;  2F4V C;  1HH2 P;  3CJE A;  4IR7 A;  2D27 A;  4HPV A;  5IWA C;  4PUI A;  3UZ0 A;  1MKY A;  2PT7 G;  1XDX A;  3UOW A;  2BJO A;  2M5H A;  5ADZ A;  3DHV A;  1IBM C;  4DV4 C;  4L7I A;  4WV3 A;  2PRO A;  1USP B;  3PRO C;  4YY3 C;  3T1Y C;  3TDE A;  4LE5 A;  1USP A;  1WCJ A;  4ZLP A;  2QL8 A;  4LF9 C;  5BUR A;  2P2Q A;  2QVX X;  2ZM6 C;  4ODJ A;  4DR7 C;  1XHJ A;  5KYT A;  4LF7 C;  1P4E A;  2Y4N A;  3FCC A;  1N36 C;  4DV6 C;  4DV1 C;  4JV5 C;  3GR0 A;  4DUZ C;  2ONF A;  2Y4O A;  1PU1 A;  1XRB A;  4R1L A;  2Y27 A;  3TR3 A;  3J7A D;  5BSR A;  2D7V A;  3DLP X;  2OO4 A;  4LF8 C;  2UU9 C;  2V7B A;  5BR8 C;  2JMP A;  4DR2 C;  1ULT A;  3GR1 A;  5CZX A;  2PG1 E;  1J5E C;  4LF5 C;  1VEH A;  1RG9 A;  4BCA A;  5IFI A;  1ZB8 A;  1HR0 C;  4B3M C;  2DYJ A;  3O2E A;  4G1I A;  2D1S A;  1FLO A;  1QWI A;  1YJ7 A;  5BUQ A;  2OPL B;  2UXB C;  2YWB A;  1EGA A;  4D4G A;  5DV9 A;  1TH5 A;  1MD9 A;  1O93 A;  2OPL A;  2ZZN A;  2VQF C;  2PN2 A;  2P2F A;  2DPL A;  2VSQ A;  4RM3 A;  4NXN C;  1IB8 A;  3VNS A;  4LF4 C;  3JAM D;  3AF6 A;  4B3S C;  5BSW A;  4G36 A;  4DR3 C;  4DCS A;  4GXR A;  4JYA C;  2WD9 A;  4JI5 C;  2QVZ X;  3ETC A;  3B7W A;  1HNW C;  2UXC C;  1P4E C;  2XR1 A;  4D4I A;  2E7G A;  1O90 A;  2YWC A;  4LF6 C;  1NYE A;  4EAT A;  3G7S A; 
#chains in the Genus database with same CATH homology
 4U5Y D;  3NYR A;  4BBY A;  4PRO C;  4MH4 A;  3TUF A;  4X62 C;  4I9F A;  5LMN C;  3E7X A;  4NOZ A;  2QW0 X;  4PZP A;  2E0G A;  2D1T A;  1V26 A;  2CXC A;  3PES A;  4JM1 A;  2HJG A;  1ML8 A;  4RLQ A;  4KTT A;  4FTF A;  1FJG C;  4RVN A;  5FLX D;  1LQL A;  4DR5 C;  4B3R C;  4DR1 C;  4AQY C;  3CW8 X;  1I94 C;  1MXA A;  4DV0 C;  1XMO C;  5BSU A;  3N54 B;  1N32 C;  1K0R A;  3ETO A;  3LGX A;  2UUA C;  3S82 A;  3RG2 A;  3TQI A;  4DUY C;  1L2F A;  1T5D X;  2P02 A;  1XRA A;  3IEV A;  2BH1 X;  5A2Q D;  4XX2 A;  3E7W A;  4I9G A;  3R9W A;  1IBK C;  4GKJ C;  5BST A;  4RM2 A;  3H2T A;  2VQE C;  1O9T A;  5KYV A;  1PG3 A;  1RY2 A;  4IZ6 A;  3CW9 A;  3L95 X;  2WP0 C;  4R1M A;  1HNZ C;  2UUC C;  3N2Q A;  2CY1 A;  1UKK A;  2ATW A;  4DR4 C;  3AF5 A;  4JI4 C;  4RVO A;  2OBV A;  4DG8 A;  3IPL A;  3I08 A;  4GXQ A;  4GKK C;  2UXD C;  3R44 A;  3GPC A;  2P2B A;  4ZJZ A;  1FUG A;  4NDN A;  4JI2 C;  3PBK A;  5BUS A;  2P2M A;  3VNR A;  3NPD A;  5IT9 D;  5A1I A;  3A4I A;  1IBL C;  4JI0 C;  3A9V A;  4X65 C;  5AE1 A;  1O92 A;  3LUS A;  2E8C A;  5BSV A;  3L8C A;  5JRH A;  4ISB A;  4DCV A;  5AE3 A;  4JI3 C;  4RLF A;  1AMU A;  4DCT A;  2E5L C;  1HNX C;  5AE2 A;  4YHH C;  3RV2 A;  1V25 A;  1N33 C;  5A19 A;  1QM4 A;  5H9U A;  1XNR C;  1P7L A;  3LAX A;  5A1G A;  3T1H C;  1LCI A;  3NYQ A;  3EQ6 A;  2YCB A;  1GPM A;  4DR6 C;  2EGT A;  1N2F A;  1MXB A;  4OYC A;  1VLA A;  4RMN A;  3NI2 A;  3DAY A;  5E7Q A;  5T8S A;  1JOS A;  1MDB A;  2AYA A;  4TPS B;  3SO4 A;  4L2Z A;  2KZF A;  2D1Q A;  4LFB C;  1WF3 A;  4DV7 C;  2VZE A;  1PA4 A;  1XNQ C;  4L4Q A;  1T5H X;  4DCU A;  4JI7 C;  3EER A;  2HHH C;  4NXM C;  5CZV A;  2D28 C;  4JI1 C;  4X66 C;  5GTD A;  4FUT A;  4BC9 A;  4DV3 C;  3OTO C;  2D1R A;  4G37 A;  4X64 C;  4WS9 A;  3FCE A;  4R0M A;  4K0B A;  1MXC A;  4PHT A;  1ZB9 A;  1PG4 A;  4OX9 C;  4DG9 A;  4D57 A;  3C5E A;  4K0K C;  2E8E A;  2P2J A;  3IEU A;  3VNQ A;  4B3T C;  3J81 D;  1WH9 A;  3R9X A;  2ASB A;  4D56 A;  4JI6 C;  1N34 C;  4KTV A;  4JI8 C;  5BSM A;  5LMU C;  5KEI A;  1BA3 A;  3A9U A;  4LFC C;  1XRC A;  1XMQ C;  4BSZ A;  4DV5 C;  3I07 A;  4OXI A;  3GKU A;  1KKG A;  2P20 A;  4FUQ A;  4DV2 C;  2E8F A;  5K85 A;  3LNV A;  3KXW A;  2UUB C;  3IML A;  4LFA C;  4BC7 A;  2QVY X;  1MDF A;  4MTN A;  5T8T A;  3J80 D;  4KHP C;  4GS5 A;  5K8F A;  2F4V C;  1HH2 P;  3CJE A;  4IR7 A;  2D27 A;  4HPV A;  5IWA C;  3UZ0 A;  1MKY A;  2PT7 G;  3UOW A;  2BJO A;  5ADZ A;  3DHV A;  1IBM C;  4DV4 C;  4L7I A;  4WV3 A;  2PRO A;  1USP B;  3PRO C;  4YY3 C;  3T1Y C;  3TDE A;  4LE5 A;  1USP A;  4ZLP A;  2QL8 A;  4LF9 C;  5BUR A;  2P2Q A;  2QVX X;  2ZM6 C;  4ODJ A;  4DR7 C;  5KYT A;  4LF7 C;  2Y4N A;  3FCC A;  1N36 C;  4DV6 C;  4DV1 C;  4JV5 C;  3GR0 A;  4DUZ C;  2ONF A;  2Y4O A;  1XRB A;  4R1L A;  2Y27 A;  3J7A D;  5BSR A;  2D7V A;  3DLP X;  2OO4 A;  4LF8 C;  2UU9 C;  2V7B A;  5BR8 C;  2JMP A;  4DR2 C;  1ULT A;  3GR1 A;  5CZX A;  1J5E C;  4LF5 C;  1RG9 A;  4BCA A;  5IFI A;  1ZB8 A;  1HR0 C;  4B3M C;  2DYJ A;  4G1I A;  2D1S A;  1QWI A;  1YJ7 A;  5BUQ A;  2OPL B;  2UXB C;  2YWB A;  1EGA A;  4D4G A;  5DV9 A;  1MD9 A;  1O93 A;  2OPL A;  2VQF C;  2PN2 A;  2P2F A;  2DPL A;  2VSQ A;  4RM3 A;  4NXN C;  3VNS A;  4LF4 C;  3JAM D;  3AF6 A;  4B3S C;  5BSW A;  4G36 A;  4DR3 C;  4DCS A;  4GXR A;  4JYA C;  2WD9 A;  4JI5 C;  2QVZ X;  3ETC A;  3B7W A;  1HNW C;  2UXC C;  2XR1 A;  4D4I A;  2E7G A;  1O90 A;  2YWC A;  4LF6 C;  1NYE A;  4EAT A;  3G7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...