1XMOC

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 40
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xmoC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1xmoC02
2CY1A 4X62C 2ATWA 4DCVA 4NOZA 1XNRC 4LF6C 1KKGA 3AF5A 4LFAC 4LFBC 2VQFC 4NXNC 3JAMD 1XMQC 1LQLA 4DV5C 4XX2A 1J5EC 4JYAC 1WH9A 2HJGA 2E8FA 4DV4C 4LF8C 4K0KC 4B3MC 2KZFA 2OPLA 4DCTA 3EERA 4NXMC 1PA4A 4DV1C 1USPB 1HH2P 1XNQC 1USPA 3OTOC 5IWAC 2UXCC 1UKKA 3IEUA 5FLXD 2E5LC 2UXBC 5BR8C 4JI5C 1JOSA 3LUSA 5LMNC 1FJGC 4JI2C 1HNXC 4GKJC 4DV0C 4DUYC 1I94C 3I07A 2D7VA 4LFCC 1HNWC 1L2FA 4JI7C 1IBLC 4YY3C 4DCUA 1N2FA 1VLAA 4DV6C 4DV2C 3T1YC 4JV5C 4YHHC 4X65C 1IBMC 3R9XA 4JI0C 4DV7C 1ML8A 4MH4A 5A2QD 2ONFA 1EGAA 4DV3C 1IBKC 4DR7C 1ZB8A 2XR1A 2EGTA 1N32C 1QWIA 2YCBA 4OX9C 4DR6C 4B3SC 4JI1C 1N36C 4DR1C 2HHHC 3AF6A 2DYJA 3R9WA 4X64C 2UUAC 4LF9C 2ASBA 2ZM6C 1HR0C 4B3RC 1XMOC 4X66C 3J7AD 4JI3C 4DR3C 2VQEC 2QL8A 4JI6C 3J80D 1N34C 2JMPA 1K0RA 2PT7G 4JI4C 1WF3A 2PN2A 3GKUA 2UUCC 5IT9D 3CJEA 4KHPC 3IEVA 2UU9C 2OPLB 2F4VC 2UUBC 4BSZA 4AQYC 1NYEA 4DUZC 1MKYA 2E8CA 4MTNA 5LMUC 4B3TC 1N33C 4LF5C 4DR5C 4GKKC 3J81D 2BJOA 2CXCA 4JI8C 4LF4C 2E7GA 2UXDC 1ZB9A 4DR2C 2E8EA 4LF7C 3T1HC 1HNZC 4DR4C 4DCSA
chains in the Genus database with same CATH superfamily
2D27A 4L2ZA 4KTTA 2ATWA 2BH1X 1ULTA 3L8CA 3RV2A 2Y4OA 3AF5A 4LFBC 1AMUA 3H2TA 1V25A 4XX2A 2OO4A 2E8FA 4FUTA 2D1TA 4K0KC 4NDNA 3VNRA 4NXMC 3E7XA 1PA4A 5BSVA 5IWAC 2UXCC 4K0BA 2QVZX 1FJGC 4JI2C 2PG1E 1XS3A 4IZ6A 3I07A 4ZJZA 4HPVA 1O92A 4BBYA 5BSRA 4DV6C 4JI0C 4DV7C 4MH4A 1EGAA 4DV3C 5GTDA 2XR1A 4RLQA 4D57A 2P2JA 2YCBA 4PUGA 4DG9A 1N36C 4DG8A 4L4QA 3AF6A 4G37A 3GPCA 4ODJA 2UUAC 1VEHA 2ZM6C 5CZXA 4G1IA 3NI2A 3NPDA 4DR3C 2MCQA 4JI6C 1MDFA 1WF3A 2PN2A 2P2MA 3DHVA 2UUCC 3N2QA 3IEVA 2P20A 3ETOA 4BCAA 4AQYC 1NYEA 3A25A 3PROC 1PG4A 1PG3A 2D28C 4B3TC 2DPLA 1O93A 3ETCA 4DR2C 2P2FA 3FCEA 4LF7C 4DCSA 1P4EC 2CY1A 2D1QA 3RG2A 4RLFA 3TR3A 4NOZA 5A19A 2P2BA 5T8SA 1XMQC 4GXRA 2ZZNA 5BUSA 4DV4C 4LF8C 2E0GA 1V60A 4RVOA 4B3MC 4DCTA 1YJ7A 5BURA 1RY2A 3CW9A 1USPB 2YWBA 1UKKA 5BSTA 1JOSA 3N54B 5LMNC 1HNXC 4DV0C 4DUYC 1I94C 4BC7A 2KDNA 1L2FA 1RG9A 1QM4A 5JRHA 4DCUA 1N2FA 3T1YC 4JV5C 4YHHC 4WS9A 2MMAB 3CQ3A 4ISBA 4X65C 2D1SA 3K6RA 1ML8A 3EQ6A 5A2QD 1XDXA 1XHJA 1N32C 3LAXA 4OX9C 2V7BA 1FLOA 4B3SC 4DR6C 2P2QA 2HHHC 2DYJA 3R9WA 3R44A 3NYRA 1XRCA 4R1LA 1MXCA 4X66C 4RVNA 4RM3A 3J80D 2JMPA 1K0RA 1O9TA 4TPSB 1UWDA 4JI4C 3GKUA 4DR4C 2Y4NA 5BSUA 3B7WA 5CZVA 1IB8A 2UUBC 1XRAA 4IR7A 5AE3A 4G36A 2WD9A 3A26A 3LGXA 4MTNA 2YX1A 5LCIA 5E7QA 3VNQA 4GKKC 2BJOA 2CXCA 3IPLA 2E7GA 1ZB9A 4GXQA 2AYAA 2E8EA 2ZZMA 5ADZA 4EATA 5A1IA 1WCJA 2PROA 5H9UA 1XNRC 1KKGA 3C5EA 3IMLA 3JAMD 1LQLA 4PUIA 3FM7A 3TQIA 4JM1A 2OPLA 3A4IA 3EERA 4DV1C 1USPA 3OTOC 2WP0C 1O90A 5FLXD 1P7LA 5BR8C 2VZEA 4GKJC 4PZPA 4FUQA 4LFCC 1HNWC 2OBVA 1IBLC 4YY3C 2QVYX 4DV2C 4RM2A 4BC9A 1PU1A 1IBMC 3R9XA 4D4IA 4DR7C 5BSWA 1QWIA 3S82A 4JI1C 3E7WA 2CU6A 5IFIA 3CW8X 4R1MA 5A1GA 2MM9A 4LE5A 4FTFA 2JNVA 4I9GA 1XRBA 3PESA 1HR0C 2M5HA 4PHTA 3UX2A 2PT7G 3O2EA 5K8FA 4KHPC 2F4VC 1T5HX 3LNOA 4BSZA 1MD9A 5DV9A 3FCCA 4I9FA 1MKYA 5LMUC 2QW0X 1MDBA 5KEIA 4DR5C 4R0MA 1TH5A 1LCIA 1V26A 2UXDC 3TUFA 3GR0A 3SO4A 1M6XC 3T1HC 1HNZC 4RMNA 4X62C 1M6XA 1MXBA 2Y27A 4PROC 3TDEA 4DCVA 2Z51A 5BSMA 4LF6C 4LFAC 1FUGA 2VQFC 3CQ2A 5KYTA 4D56A 4NXNC 4OYCA 4DV5C 2ZTBA 3UOWA 1J5EC 4JYAC 1WH9A 2HJGA 3I08A 4WV3A 2KZFA 4D4GA 2M5OA 3CQ1A 3A9UA 3UX3A 1HH2P 1XNQC 2D1RA 3DLPX 3IEUA 2E5LC 2UXBC 4JI5C 1GPMA 3LUSA 2QVXX 2D7VA 4OXIA 4JI7C 2VSQA 4U5YD 1VLAA 5KYVA 3PBKA 2ONFA 3NYQA 1IBKC 1ZB8A 2EGTA 3KXWA 1MXAA 3GR1A 3UEBA 4DR1C 1YGTA 2KZ0A 4X64C 2NCLA 4GS5A 4LF9C 1T5DX 2ASBA 4B3RC 1XMOC 5K85A 3J7AD 4ZLPA 4JI3C 2VQEC 3VNSA 2QL8A 1N34C 4KTVA 5AE2A 5T8TA 3L95X 3LNVA 1NY8A 4L7IA 3A9VA 5IT9D 3CJEA 2UU9C 2OPLB 2P02A 1BA3A 3DAYA 2DHMA 4DUZC 2E8CA 1P4EA 1N33C 4LF5C 3J81D 4LF4C 5BUQA 2YWCA 5AE1A 3AY0A 3UZ0A 4JI8C 3G7SA 4PUHA
chains in the Genus database with same CATH topology
2D27A 4L2ZA 4KTTA 2ATWA 2BH1X 1ULTA 3L8CA 3RV2A 2Y4OA 3AF5A 4LFBC 1AMUA 3H2TA 1V25A 4XX2A 2OO4A 2E8FA 4FUTA 2D1TA 4K0KC 4NDNA 3VNRA 4NXMC 3E7XA 1PA4A 5BSVA 5IWAC 2UXCC 4K0BA 2QVZX 1FJGC 4JI2C 4IZ6A 3I07A 4ZJZA 4HPVA 1O92A 4BBYA 5BSRA 4DV6C 4JI0C 4DV7C 4MH4A 1EGAA 4DV3C 5GTDA 2XR1A 4RLQA 4D57A 2P2JA 2YCBA 4DG9A 1N36C 4DG8A 4L4QA 3AF6A 4G37A 3GPCA 4ODJA 2UUAC 2ZM6C 5CZXA 4G1IA 3NI2A 3NPDA 4DR3C 4JI6C 1MDFA 1WF3A 2PN2A 2P2MA 3DHVA 2UUCC 3N2QA 3IEVA 2P20A 3ETOA 4BCAA 4AQYC 1NYEA 3PROC 1PG4A 1PG3A 2D28C 4B3TC 2DPLA 1O93A 3ETCA 4DR2C 2P2FA 3FCEA 4LF7C 4DCSA 2CY1A 2D1QA 3RG2A 4RLFA 4NOZA 5A19A 2P2BA 5T8SA 1XMQC 4GXRA 5BUSA 4DV4C 4LF8C 2E0GA 4RVOA 4B3MC 4DCTA 1YJ7A 5BURA 1RY2A 3CW9A 1USPB 2YWBA 1UKKA 5BSTA 1JOSA 3N54B 5LMNC 1HNXC 4DV0C 4DUYC 1I94C 4BC7A 1L2FA 1RG9A 1QM4A 5JRHA 4DCUA 1N2FA 3T1YC 4JV5C 4YHHC 4WS9A 4ISBA 4X65C 2D1SA 1ML8A 3EQ6A 5A2QD 1N32C 3LAXA 4OX9C 2V7BA 4B3SC 4DR6C 2P2QA 2HHHC 2DYJA 3R9WA 3R44A 3NYRA 1XRCA 4R1LA 1MXCA 4X66C 4RVNA 4RM3A 3J80D 2JMPA 1K0RA 1O9TA 4TPSB 4JI4C 3GKUA 2Y4NA 5BSUA 3B7WA 5CZVA 2UUBC 1XRAA 4IR7A 5AE3A 4G36A 2WD9A 3LGXA 4MTNA 5E7QA 3VNQA 4GKKC 2BJOA 2CXCA 3IPLA 2E7GA 1ZB9A 4GXQA 2AYAA 2E8EA 5ADZA 4EATA 5A1IA 2PROA 5H9UA 1XNRC 1KKGA 3C5EA 3IMLA 3JAMD 1LQLA 3TQIA 4JM1A 2OPLA 3A4IA 3EERA 4DV1C 1USPA 3OTOC 2WP0C 1O90A 5FLXD 1P7LA 5BR8C 2VZEA 4GKJC 4PZPA 4FUQA 4LFCC 1HNWC 2OBVA 1IBLC 4YY3C 2QVYX 4DV2C 4RM2A 4BC9A 1IBMC 3R9XA 4D4IA 4DR7C 5BSWA 1QWIA 3S82A 4JI1C 3E7WA 5IFIA 3CW8X 4R1MA 5A1GA 4LE5A 4FTFA 4I9GA 1XRBA 3PESA 1HR0C 4PHTA 2PT7G 5K8FA 4KHPC 2F4VC 1T5HX 4BSZA 1MD9A 5DV9A 3FCCA 4I9FA 1MKYA 5LMUC 2QW0X 1MDBA 5KEIA 4DR5C 4R0MA 1LCIA 1V26A 2UXDC 3TUFA 3GR0A 3SO4A 3T1HC 1HNZC 4RMNA 4X62C 1MXBA 2Y27A 4PROC 3TDEA 4DCVA 5BSMA 4LF6C 4LFAC 1FUGA 2VQFC 5KYTA 4D56A 4NXNC 4OYCA 4DV5C 3UOWA 1J5EC 4JYAC 1WH9A 2HJGA 3I08A 4WV3A 2KZFA 4D4GA 3A9UA 1HH2P 1XNQC 2D1RA 3DLPX 3IEUA 2E5LC 2UXBC 4JI5C 1GPMA 3LUSA 2QVXX 2D7VA 4OXIA 4JI7C 2VSQA 4U5YD 1VLAA 5KYVA 3PBKA 2ONFA 3NYQA 1IBKC 1ZB8A 2EGTA 3KXWA 1MXAA 3GR1A 4DR1C 4X64C 4GS5A 4LF9C 1T5DX 2ASBA 4B3RC 1XMOC 5K85A 3J7AD 4ZLPA 4JI3C 2VQEC 3VNSA 2QL8A 1N34C 4KTVA 5AE2A 5T8TA 3L95X 3LNVA 4L7IA 3A9VA 5IT9D 3CJEA 2UU9C 2OPLB 2P02A 1BA3A 3DAYA 4DUZC 2E8CA 1N33C 4LF5C 3J81D 4LF4C 5BUQA 2YWCA 5AE1A 3UZ0A 4JI8C 3G7SA 4DR4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CY1 A;  4X62 C;  2ATW A;  4DCV A;  4NOZ A;  1XNR C;  4LF6 C;  1KKG A;  3AF5 A;  4LFA C;  4LFB C;  2VQF C;  4NXN C;  3JAM D;  1XMQ C;  1LQL A;  4DV5 C;  4XX2 A;  1J5E C;  4JYA C;  1WH9 A;  2HJG A;  2E8F A;  4DV4 C;  4LF8 C;  4K0K C;  4B3M C;  2KZF A;  2OPL A;  4DCT A;  3EER A;  4NXM C;  1PA4 A;  4DV1 C;  1USP B;  1HH2 P;  1XNQ C;  1USP A;  3OTO C;  5IWA C;  2UXC C;  1UKK A;  3IEU A;  5FLX D;  2E5L C;  2UXB C;  5BR8 C;  4JI5 C;  1JOS A;  3LUS A;  5LMN C;  1FJG C;  4JI2 C;  1HNX C;  4GKJ C;  4DV0 C;  4DUY C;  1I94 C;  3I07 A;  2D7V A;  4LFC C;  1HNW C;  1L2F A;  4JI7 C;  1IBL C;  4YY3 C;  4DCU A;  1N2F A;  1VLA A;  4DV6 C;  4DV2 C;  3T1Y C;  4JV5 C;  4YHH C;  4X65 C;  1IBM C;  3R9X A;  4JI0 C;  4DV7 C;  1ML8 A;  4MH4 A;  5A2Q D;  2ONF A;  1EGA A;  4DV3 C;  1IBK C;  4DR7 C;  1ZB8 A;  2XR1 A;  2EGT A;  1N32 C;  1QWI A;  2YCB A;  4OX9 C;  4DR6 C;  4B3S C;  4JI1 C;  1N36 C;  4DR1 C;  2HHH C;  3AF6 A;  2DYJ A;  3R9W A;  4X64 C;  2UUA C;  4LF9 C;  2ASB A;  2ZM6 C;  1HR0 C;  4B3R C;  1XMO C;  4X66 C;  3J7A D;  4JI3 C;  4DR3 C;  2VQE C;  2QL8 A;  4JI6 C;  3J80 D;  1N34 C;  2JMP A;  1K0R A;  2PT7 G;  4JI4 C;  1WF3 A;  2PN2 A;  3GKU A;  2UUC C;  5IT9 D;  3CJE A;  4KHP C;  3IEV A;  2UU9 C;  2OPL B;  2F4V C;  2UUB C;  4BSZ A;  4AQY C;  1NYE A;  4DUZ C;  1MKY A;  2E8C A;  4MTN A;  5LMU C;  4B3T C;  1N33 C;  4LF5 C;  4DR5 C;  4GKK C;  3J81 D;  2BJO A;  2CXC A;  4JI8 C;  4LF4 C;  2E7G A;  2UXD C;  1ZB9 A;  4DR2 C;  2E8E A;  4LF7 C;  3T1H C;  1HNZ C;  4DR4 C;  4DCS A; 
#chains in the Genus database with same CATH topology
 2D27 A;  4L2Z A;  4KTT A;  2ATW A;  2BH1 X;  1ULT A;  3L8C A;  3RV2 A;  2Y4O A;  3AF5 A;  4LFB C;  1AMU A;  3H2T A;  1V25 A;  4XX2 A;  2OO4 A;  2E8F A;  4FUT A;  2D1T A;  4K0K C;  4NDN A;  3VNR A;  4NXM C;  3E7X A;  1PA4 A;  5BSV A;  5IWA C;  2UXC C;  4K0B A;  2QVZ X;  1FJG C;  4JI2 C;  2PG1 E;  1XS3 A;  4IZ6 A;  3I07 A;  4ZJZ A;  4HPV A;  1O92 A;  4BBY A;  5BSR A;  4DV6 C;  4JI0 C;  4DV7 C;  4MH4 A;  1EGA A;  4DV3 C;  5GTD A;  2XR1 A;  4RLQ A;  4D57 A;  2P2J A;  2YCB A;  4PUG A;  4DG9 A;  1N36 C;  4DG8 A;  4L4Q A;  3AF6 A;  4G37 A;  3GPC A;  4ODJ A;  2UUA C;  1VEH A;  2ZM6 C;  5CZX A;  4G1I A;  3NI2 A;  3NPD A;  4DR3 C;  2MCQ A;  4JI6 C;  1MDF A;  1WF3 A;  2PN2 A;  2P2M A;  3DHV A;  2UUC C;  3N2Q A;  3IEV A;  2P20 A;  3ETO A;  4BCA A;  4AQY C;  1NYE A;  3A25 A;  3PRO C;  1PG4 A;  1PG3 A;  2D28 C;  4B3T C;  2DPL A;  1O93 A;  3ETC A;  4DR2 C;  2P2F A;  3FCE A;  4LF7 C;  4DCS A;  1P4E C;  2CY1 A;  2D1Q A;  3RG2 A;  4RLF A;  3TR3 A;  4NOZ A;  5A19 A;  2P2B A;  5T8S A;  1XMQ C;  4GXR A;  2ZZN A;  5BUS A;  4DV4 C;  4LF8 C;  2E0G A;  1V60 A;  4RVO A;  4B3M C;  4DCT A;  1YJ7 A;  5BUR A;  1RY2 A;  3CW9 A;  1USP B;  2YWB A;  1UKK A;  5BST A;  1JOS A;  3N54 B;  5LMN C;  1HNX C;  4DV0 C;  4DUY C;  1I94 C;  4BC7 A;  2KDN A;  1L2F A;  1RG9 A;  1QM4 A;  5JRH A;  4DCU A;  1N2F A;  3T1Y C;  4JV5 C;  4YHH C;  4WS9 A;  2MMA B;  3CQ3 A;  4ISB A;  4X65 C;  2D1S A;  3K6R A;  1ML8 A;  3EQ6 A;  5A2Q D;  1XDX A;  1XHJ A;  1N32 C;  3LAX A;  4OX9 C;  2V7B A;  1FLO A;  4B3S C;  4DR6 C;  2P2Q A;  2HHH C;  2DYJ A;  3R9W A;  3R44 A;  3NYR A;  1XRC A;  4R1L A;  1MXC A;  4X66 C;  4RVN A;  4RM3 A;  3J80 D;  2JMP A;  1K0R A;  1O9T A;  4TPS B;  1UWD A;  4JI4 C;  3GKU A;  4DR4 C;  2Y4N A;  5BSU A;  3B7W A;  5CZV A;  1IB8 A;  2UUB C;  1XRA A;  4IR7 A;  5AE3 A;  4G36 A;  2WD9 A;  3A26 A;  3LGX A;  4MTN A;  2YX1 A;  5LCI A;  5E7Q A;  3VNQ A;  4GKK C;  2BJO A;  2CXC A;  3IPL A;  2E7G A;  1ZB9 A;  4GXQ A;  2AYA A;  2E8E A;  2ZZM A;  5ADZ A;  4EAT A;  5A1I A;  1WCJ A;  2PRO A;  5H9U A;  1XNR C;  1KKG A;  3C5E A;  3IML A;  3JAM D;  1LQL A;  4PUI A;  3FM7 A;  3TQI A;  4JM1 A;  2OPL A;  3A4I A;  3EER A;  4DV1 C;  1USP A;  3OTO C;  2WP0 C;  1O90 A;  5FLX D;  1P7L A;  5BR8 C;  2VZE A;  4GKJ C;  4PZP A;  4FUQ A;  4LFC C;  1HNW C;  2OBV A;  1IBL C;  4YY3 C;  2QVY X;  4DV2 C;  4RM2 A;  4BC9 A;  1PU1 A;  1IBM C;  3R9X A;  4D4I A;  4DR7 C;  5BSW A;  1QWI A;  3S82 A;  4JI1 C;  3E7W A;  2CU6 A;  5IFI A;  3CW8 X;  4R1M A;  5A1G A;  2MM9 A;  4LE5 A;  4FTF A;  2JNV A;  4I9G A;  1XRB A;  3PES A;  1HR0 C;  2M5H A;  4PHT A;  3UX2 A;  2PT7 G;  3O2E A;  5K8F A;  4KHP C;  2F4V C;  1T5H X;  3LNO A;  4BSZ A;  1MD9 A;  5DV9 A;  3FCC A;  4I9F A;  1MKY A;  5LMU C;  2QW0 X;  1MDB A;  5KEI A;  4DR5 C;  4R0M A;  1TH5 A;  1LCI A;  1V26 A;  2UXD C;  3TUF A;  3GR0 A;  3SO4 A;  1M6X C;  3T1H C;  1HNZ C;  4RMN A;  4X62 C;  1M6X A;  1MXB A;  2Y27 A;  4PRO C;  3TDE A;  4DCV A;  2Z51 A;  5BSM A;  4LF6 C;  4LFA C;  1FUG A;  2VQF C;  3CQ2 A;  5KYT A;  4D56 A;  4NXN C;  4OYC A;  4DV5 C;  2ZTB A;  3UOW A;  1J5E C;  4JYA C;  1WH9 A;  2HJG A;  3I08 A;  4WV3 A;  2KZF A;  4D4G A;  2M5O A;  3CQ1 A;  3A9U A;  3UX3 A;  1HH2 P;  1XNQ C;  2D1R A;  3DLP X;  3IEU A;  2E5L C;  2UXB C;  4JI5 C;  1GPM A;  3LUS A;  2QVX X;  2D7V A;  4OXI A;  4JI7 C;  2VSQ A;  4U5Y D;  1VLA A;  5KYV A;  3PBK A;  2ONF A;  3NYQ A;  1IBK C;  1ZB8 A;  2EGT A;  3KXW A;  1MXA A;  3GR1 A;  3UEB A;  4DR1 C;  1YGT A;  2KZ0 A;  4X64 C;  2NCL A;  4GS5 A;  4LF9 C;  1T5D X;  2ASB A;  4B3R C;  1XMO C;  5K85 A;  3J7A D;  4ZLP A;  4JI3 C;  2VQE C;  3VNS A;  2QL8 A;  1N34 C;  4KTV A;  5AE2 A;  5T8T A;  3L95 X;  3LNV A;  1NY8 A;  4L7I A;  3A9V A;  5IT9 D;  3CJE A;  2UU9 C;  2OPL B;  2P02 A;  1BA3 A;  3DAY A;  2DHM A;  4DUZ C;  2E8C A;  1P4E A;  1N33 C;  4LF5 C;  3J81 D;  4LF4 C;  5BUQ A;  2YWC A;  5AE1 A;  3AY0 A;  3UZ0 A;  4JI8 C;  3G7S A;  4PUH A; 
#chains in the Genus database with same CATH homology
 2D27 A;  4L2Z A;  4KTT A;  2ATW A;  2BH1 X;  1ULT A;  3L8C A;  3RV2 A;  2Y4O A;  3AF5 A;  4LFB C;  1AMU A;  3H2T A;  1V25 A;  4XX2 A;  2OO4 A;  2E8F A;  4FUT A;  2D1T A;  4K0K C;  4NDN A;  3VNR A;  4NXM C;  3E7X A;  1PA4 A;  5BSV A;  5IWA C;  2UXC C;  4K0B A;  2QVZ X;  1FJG C;  4JI2 C;  4IZ6 A;  3I07 A;  4ZJZ A;  4HPV A;  1O92 A;  4BBY A;  5BSR A;  4DV6 C;  4JI0 C;  4DV7 C;  4MH4 A;  1EGA A;  4DV3 C;  5GTD A;  2XR1 A;  4RLQ A;  4D57 A;  2P2J A;  2YCB A;  4DG9 A;  1N36 C;  4DG8 A;  4L4Q A;  3AF6 A;  4G37 A;  3GPC A;  4ODJ A;  2UUA C;  2ZM6 C;  5CZX A;  4G1I A;  3NI2 A;  3NPD A;  4DR3 C;  4JI6 C;  1MDF A;  1WF3 A;  2PN2 A;  2P2M A;  3DHV A;  2UUC C;  3N2Q A;  3IEV A;  2P20 A;  3ETO A;  4BCA A;  4AQY C;  1NYE A;  3PRO C;  1PG4 A;  1PG3 A;  2D28 C;  4B3T C;  2DPL A;  1O93 A;  3ETC A;  4DR2 C;  2P2F A;  3FCE A;  4LF7 C;  4DCS A;  2CY1 A;  2D1Q A;  3RG2 A;  4RLF A;  4NOZ A;  5A19 A;  2P2B A;  5T8S A;  1XMQ C;  4GXR A;  5BUS A;  4DV4 C;  4LF8 C;  2E0G A;  4RVO A;  4B3M C;  4DCT A;  1YJ7 A;  5BUR A;  1RY2 A;  3CW9 A;  1USP B;  2YWB A;  1UKK A;  5BST A;  1JOS A;  3N54 B;  5LMN C;  1HNX C;  4DV0 C;  4DUY C;  1I94 C;  4BC7 A;  1L2F A;  1RG9 A;  1QM4 A;  5JRH A;  4DCU A;  1N2F A;  3T1Y C;  4JV5 C;  4YHH C;  4WS9 A;  4ISB A;  4X65 C;  2D1S A;  1ML8 A;  3EQ6 A;  5A2Q D;  1N32 C;  3LAX A;  4OX9 C;  2V7B A;  4B3S C;  4DR6 C;  2P2Q A;  2HHH C;  2DYJ A;  3R9W A;  3R44 A;  3NYR A;  1XRC A;  4R1L A;  1MXC A;  4X66 C;  4RVN A;  4RM3 A;  3J80 D;  2JMP A;  1K0R A;  1O9T A;  4TPS B;  4JI4 C;  3GKU A;  2Y4N A;  5BSU A;  3B7W A;  5CZV A;  2UUB C;  1XRA A;  4IR7 A;  5AE3 A;  4G36 A;  2WD9 A;  3LGX A;  4MTN A;  5E7Q A;  3VNQ A;  4GKK C;  2BJO A;  2CXC A;  3IPL A;  2E7G A;  1ZB9 A;  4GXQ A;  2AYA A;  2E8E A;  5ADZ A;  4EAT A;  5A1I A;  2PRO A;  5H9U A;  1XNR C;  1KKG A;  3C5E A;  3IML A;  3JAM D;  1LQL A;  3TQI A;  4JM1 A;  2OPL A;  3A4I A;  3EER A;  4DV1 C;  1USP A;  3OTO C;  2WP0 C;  1O90 A;  5FLX D;  1P7L A;  5BR8 C;  2VZE A;  4GKJ C;  4PZP A;  4FUQ A;  4LFC C;  1HNW C;  2OBV A;  1IBL C;  4YY3 C;  2QVY X;  4DV2 C;  4RM2 A;  4BC9 A;  1IBM C;  3R9X A;  4D4I A;  4DR7 C;  5BSW A;  1QWI A;  3S82 A;  4JI1 C;  3E7W A;  5IFI A;  3CW8 X;  4R1M A;  5A1G A;  4LE5 A;  4FTF A;  4I9G A;  1XRB A;  3PES A;  1HR0 C;  4PHT A;  2PT7 G;  5K8F A;  4KHP C;  2F4V C;  1T5H X;  4BSZ A;  1MD9 A;  5DV9 A;  3FCC A;  4I9F A;  1MKY A;  5LMU C;  2QW0 X;  1MDB A;  5KEI A;  4DR5 C;  4R0M A;  1LCI A;  1V26 A;  2UXD C;  3TUF A;  3GR0 A;  3SO4 A;  3T1H C;  1HNZ C;  4RMN A;  4X62 C;  1MXB A;  2Y27 A;  4PRO C;  3TDE A;  4DCV A;  5BSM A;  4LF6 C;  4LFA C;  1FUG A;  2VQF C;  5KYT A;  4D56 A;  4NXN C;  4OYC A;  4DV5 C;  3UOW A;  1J5E C;  4JYA C;  1WH9 A;  2HJG A;  3I08 A;  4WV3 A;  2KZF A;  4D4G A;  3A9U A;  1HH2 P;  1XNQ C;  2D1R A;  3DLP X;  3IEU A;  2E5L C;  2UXB C;  4JI5 C;  1GPM A;  3LUS A;  2QVX X;  2D7V A;  4OXI A;  4JI7 C;  2VSQ A;  4U5Y D;  1VLA A;  5KYV A;  3PBK A;  2ONF A;  3NYQ A;  1IBK C;  1ZB8 A;  2EGT A;  3KXW A;  1MXA A;  3GR1 A;  4DR1 C;  4X64 C;  4GS5 A;  4LF9 C;  1T5D X;  2ASB A;  4B3R C;  1XMO C;  5K85 A;  3J7A D;  4ZLP A;  4JI3 C;  2VQE C;  3VNS A;  2QL8 A;  1N34 C;  4KTV A;  5AE2 A;  5T8T A;  3L95 X;  3LNV A;  4L7I A;  3A9V A;  5IT9 D;  3CJE A;  2UU9 C;  2OPL B;  2P02 A;  1BA3 A;  3DAY A;  4DUZ C;  2E8C A;  1N33 C;  4LF5 C;  3J81 D;  4LF4 C;  5BUQ A;  2YWC A;  5AE1 A;  3UZ0 A;  4JI8 C;  3G7S A;  4DR4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...