1XMOC

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
total genus 40
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xmoC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1xmoC02
1ML8A 1ZB9A 5LMNC 4GKJC 4JI4C 4GKKC 4DR7C 2ATWA 5FLXD 4X66C 4DV0C 4DV4C 2UXDC 4DV5C 4B3RC 4LFCC 4LFBC 1XNRC 4YHHC 3J7AD 4B3MC 4JI7C 4LF6C 1KKGA 3OTOC 2HHHC 3T1YC 4DR3C 4X64C 4XX2A 1EGAA 4DV3C 1ZB8A 1HNXC 2CY1A 3CJEA 1FJGC 3LUSA 3EERA 2EGTA 3R9WA 5LMUC 4NXMC 1LQLA 4DCSA 4DCUA 1HNZC 1USPB 4BSZA 4DV7C 1IBLC 5BR8C 1QWIA 4AQYC 1N2FA 1N32C 4YY3C 3GKUA 2CXCA 5IT9D 2UU9C 3AF5A 1USPA 2JMPA 4X62C 4JI0C 4DCVA 4DV2C 4JI5C 2ASBA 3IEUA 2PN2A 2XR1A 2UUCC 4LF8C 4JYAC 1HNWC 1XMQC 1XMOC 1PA4A 1HR0C 4JI6C 1XNQC 2UXBC 2KZFA 4DV6C 1IBMC 1MKYA 1WF3A 1J5EC 2OPLB 3I07A 4DCTA 1N34C 4JI1C 4LF4C 2UUBC 1L2FA 2E8FA 2BJOA 2QL8A 2E7GA 2E8EA 4LF7C 4JI8C 2E5LC 3IEVA 4DR4C 2UXCC 4MH4A 4DR1C 2VQFC 4JV5C 3AF6A 4DR5C 3T1HC 3JAMD 5IWAC 2UUAC 1HH2P 1IBKC 4OX9C 4X65C 1I94C 5A2QD 3R9XA 1K0RA 1NYEA 1N33C 2YCBA 1VLAA 4MTNA 3J81D 2VQEC 4DR2C 2HJGA 4LF5C 2E8CA 4NOZA 4DUZC 1N36C 4LFAC 2OPLA 4K0KC 2ONFA 4NXNC 4DR6C 3J80D 4LF9C 4B3TC 2PT7G 1UKKA 4B3SC 4KHPC 2DYJA 2F4VC 4DUYC 1WH9A 4JI3C 2D7VA 1JOSA 4DV1C 2ZM6C 4JI2C
chains in the Genus database with same CATH superfamily
5BSMA 5LMNC 3L95X 3L8CA 3FCEA 2ATWA 4DV0C 2OBVA 3IMLA 4DV4C 4GXRA 4RLQA 5BSTA 4DG9A 4B3RC 1GPMA 4LFBC 1O93A 4B3MC 2P2MA 4K0BA 3OTOC 3T1YC 2JNVA 1EGAA 2P2QA 1IB8A 2CY1A 3CJEA 1RG9A 3PROC 2CU6A 5LMUC 4D4GA 2WD9A 2D28C 4DCUA 4DCSA 4BSZA 4G1IA 1O90A 3AY0A 2E0GA 4YY3C 3GKUA 3PBKA 2CXCA 5IT9D 2UU9C 2JMPA 4X62C 3R44A 4JI0C 4IZ6A 4DV2C 3ETCA 3IEUA 4TPSB 3VNSA 3E7XA 1AMUA 4G37A 1O92A 4JYAC 3C5EA 1M6XA 3E7WA 2KZFA 5T8SA 1IBMC 1MKYA 5AE1A 4OXIA 5KEIA 1WF3A 2OPLB 3I07A 4L2ZA 3A25A 4JI1C 1O9TA 2E8FA 5H9UA 2QVZX 1MDBA 2E7GA 4LF7C 2P20A 2E5LC 2UXCC 5GTDA 4DR5C 5A19A 5BSVA 5AE3A 1IBKC 2Y4NA 2MCQA 1I94C 5BUQA 5A2QD 3TDEA 3R9XA 2ZZMA 1K0RA 3PESA 2MMAB 2QVXX 1FUGA 3LNVA 3J81D 1PG4A 4BC7A 2HJGA 4LF5C 4DUZC 2OPLA 4K0KC 2M5OA 4D57A 3NYRA 4I9FA 5AE2A 4LF9C 2VZEA 1UKKA 4JM1A 2P2JA 3DHVA 2YWCA 2ZM6C 1YGTA 3GPCA 1P7LA 5BSUA 5BURA 4DR7C 5K85A 3ETOA 4DV5C 1XNRC 4YHHC 2Y4OA 4JI7C 4ZJZA 4WS9A 5JRHA 4XX2A 1HNXC 3S82A 1FJGC 3LUSA 4PUIA 3EERA 4PZPA 5K8FA 2DHMA 4NXMC 4DV7C 3CQ1A 3EQ6A 1N32C 3VNQA 3AF5A 1USPA 1FLOA 5KYVA 1V26A 4BCAA 1MDFA 2BH1X 1XMQC 1XMOC 1HR0C 2D1RA 5KYTA 5IFIA 3DLPX 4DCTA 1N34C 2UUBC 2BJOA 1BA3A 1M6XC 4MH4A 4JV5C 4KTVA 3LGXA 2D1SA 4PUGA 3N2QA 2OO4A 4LE5A 4WV3A 5IWAC 1XDXA 4BC9A 3A4IA 4OX9C 4X65C 2D27A 5LCIA 4GXQA 1VLAA 4DR2C 3CQ3A 4I9GA 2E8CA 3NYQA 2ONFA 4NXNC 4DR6C 2PT7G 3UX2A 1P4EC 1LCIA 4KHPC 1ULTA 4RMNA 4JI3C 2D7VA 5ADZA 4JI2C 2KZ0A 4JI4C 4GKKC 5CZVA 3TUFA 4X66C 3A9VA 5CZXA 2AYAA 2UXDC 1T5HX 4L7IA 4LFCC 3J7AD 3KXWA 3K6RA 4LF6C 5BSRA 2HHHC 3DAYA 3FM7A 4DR3C 1ZB8A 2EGTA 4FUQA 1MXCA 3CW9A 1HNZC 1USPB 4AQYC 1N2FA 2NCLA 1WCJA 1NY8A 4RLFA 4DCVA 2PN2A 2XR1A 3UEBA 2UUCC 4PROC 4LF8C 1HNWC 1PA4A 4JI6C 1XNQC 3H2TA 2ZTBA 4DV6C 1YJ7A 1J5EC 4PHTA 2DPLA 4HPVA 4D56A 4LF4C 2P02A 1L2FA 2QL8A 3RV2A 2PG1E 3UZ0A 1XHJA 3IEVA 2YWBA 4RVNA 4R1MA 4RVOA 4RM2A 1PU1A 3AF6A 5DV9A 3T1HC 1RY2A 1MXBA 3RG2A 3UX3A 2YCBA 3LAXA 1V60A 3CQ2A 1UWDA 4PUHA 4NOZA 4LFAC 3NI2A 1QM4A 3J80D 4B3TC 2P2FA 4BBYA 2YX1A 5T8TA 2F4VC 1WH9A 1JOSA 2QVYX 1XRAA 1ML8A 3CW8X 5BUSA 1ZB9A 4D4IA 4DG8A 1XRBA 4GKJC 3VNRA 3I08A 5FLXD 4OYCA 3GR1A 4RM3A 3NPDA 4IR7A 2D1TA 2Y27A 4R0MA 5A1IA 2D1QA 1KKGA 4X64C 1T5DX 2KDNA 2WP0C 4DV3C 3R9WA 3B7WA 1LQLA 2Z51A 2PROA 1IBLC 5BR8C 1QWIA 2QW0X 3SO4A 1XS3A 4JI5C 2ASBA 4ODJA 1MD9A 5A1GA 4L4QA 2UXBC 4G36A 3UOWA 1P4EA 3G7SA 4ISBA 3A9UA 2E8EA 4JI8C 4DR4C 4DR1C 2VQFC 3GR0A 4EATA 5BSWA 2V7BA 4NDNA 1XRCA 3JAMD 3O2EA 2UUAC 1HH2P 2M5HA 1V25A 3LNOA 2P2BA 4R1LA 1NYEA 1VEHA 2VSQA 3N54B 1N33C 4MTNA 2VQEC 4GS5A 4ZLPA 1PG3A 2MM9A 5E7QA 4KTTA 3TR3A 1MXAA 1N36C 3TQIA 4U5YD 4FUTA 3IPLA 4B3SC 4FTFA 2DYJA 4DUYC 3A26A 3FCCA 4DV1C 2ZZNA 1TH5A
chains in the Genus database with same CATH topology
5BSMA 5LMNC 3L95X 3L8CA 3FCEA 2ATWA 4DV0C 2OBVA 3IMLA 4DV4C 4GXRA 4RLQA 5BSTA 4DG9A 4B3RC 1GPMA 4LFBC 1O93A 4B3MC 2P2MA 4K0BA 3OTOC 3T1YC 1EGAA 2P2QA 2CY1A 3CJEA 1RG9A 3PROC 5LMUC 4D4GA 2WD9A 2D28C 4DCUA 4DCSA 4BSZA 4G1IA 1O90A 2E0GA 4YY3C 3GKUA 3PBKA 2CXCA 5IT9D 2UU9C 2JMPA 4X62C 3R44A 4JI0C 4IZ6A 4DV2C 3ETCA 3IEUA 4TPSB 3VNSA 3E7XA 1AMUA 4G37A 1O92A 4JYAC 3C5EA 3E7WA 2KZFA 5T8SA 1IBMC 1MKYA 5AE1A 4OXIA 5KEIA 1WF3A 2OPLB 3I07A 4L2ZA 4JI1C 1O9TA 2E8FA 5H9UA 2QVZX 1MDBA 2E7GA 4LF7C 2P20A 2E5LC 2UXCC 5GTDA 4DR5C 5A19A 5BSVA 5AE3A 1IBKC 2Y4NA 1I94C 5BUQA 5A2QD 3TDEA 3R9XA 1K0RA 3PESA 2QVXX 1FUGA 3LNVA 3J81D 1PG4A 4BC7A 2HJGA 4LF5C 4DUZC 2OPLA 4K0KC 4D57A 3NYRA 4I9FA 5AE2A 4LF9C 2VZEA 1UKKA 4JM1A 2P2JA 3DHVA 2YWCA 2ZM6C 3GPCA 1P7LA 5BSUA 5BURA 4DR7C 5K85A 3ETOA 4DV5C 1XNRC 4YHHC 2Y4OA 4JI7C 4ZJZA 4WS9A 5JRHA 4XX2A 1HNXC 3S82A 1FJGC 3LUSA 3EERA 4PZPA 5K8FA 4NXMC 4DV7C 3EQ6A 1N32C 3VNQA 3AF5A 1USPA 5KYVA 1V26A 4BCAA 1MDFA 2BH1X 1XMQC 1XMOC 1HR0C 2D1RA 5KYTA 5IFIA 3DLPX 4DCTA 1N34C 2UUBC 2BJOA 1BA3A 4MH4A 4JV5C 4KTVA 3LGXA 2D1SA 3N2QA 2OO4A 4LE5A 4WV3A 5IWAC 4BC9A 3A4IA 4OX9C 4X65C 2D27A 4GXQA 1VLAA 4DR2C 4I9GA 2E8CA 3NYQA 2ONFA 4NXNC 4DR6C 2PT7G 1LCIA 4KHPC 1ULTA 4RMNA 4JI3C 2D7VA 5ADZA 4JI2C 4JI4C 4GKKC 5CZVA 3TUFA 4X66C 3A9VA 5CZXA 2AYAA 2UXDC 1T5HX 4L7IA 4LFCC 3J7AD 3KXWA 4LF6C 5BSRA 2HHHC 3DAYA 4DR3C 1ZB8A 2EGTA 4FUQA 1MXCA 3CW9A 1HNZC 1USPB 4AQYC 1N2FA 4RLFA 4DCVA 2PN2A 2XR1A 2UUCC 4PROC 4LF8C 1HNWC 1PA4A 4JI6C 1XNQC 3H2TA 4DV6C 1YJ7A 1J5EC 4PHTA 2DPLA 4HPVA 4D56A 4LF4C 2P02A 1L2FA 2QL8A 3RV2A 3UZ0A 3IEVA 2YWBA 4RVNA 4R1MA 4RVOA 4RM2A 3AF6A 5DV9A 3T1HC 1RY2A 1MXBA 3RG2A 2YCBA 3LAXA 4NOZA 4LFAC 3NI2A 1QM4A 3J80D 4B3TC 2P2FA 4BBYA 5T8TA 2F4VC 1WH9A 1JOSA 2QVYX 1XRAA 1ML8A 3CW8X 5BUSA 1ZB9A 4D4IA 4DG8A 1XRBA 4GKJC 3VNRA 3I08A 5FLXD 4OYCA 3GR1A 4RM3A 3NPDA 4IR7A 2D1TA 2Y27A 4R0MA 5A1IA 2D1QA 1KKGA 4X64C 1T5DX 2WP0C 4DV3C 3R9WA 3B7WA 1LQLA 2PROA 1IBLC 5BR8C 1QWIA 2QW0X 3SO4A 4JI5C 2ASBA 4ODJA 1MD9A 5A1GA 4L4QA 2UXBC 4G36A 3UOWA 3G7SA 4ISBA 3A9UA 2E8EA 4JI8C 4DR4C 4DR1C 2VQFC 3GR0A 4EATA 5BSWA 2V7BA 4NDNA 1XRCA 3JAMD 2UUAC 1HH2P 1V25A 2P2BA 4R1LA 1NYEA 2VSQA 3N54B 1N33C 4MTNA 2VQEC 4GS5A 4ZLPA 1PG3A 5E7QA 4KTTA 1MXAA 1N36C 3TQIA 4U5YD 4FUTA 3IPLA 4B3SC 4FTFA 2DYJA 4DUYC 3FCCA 4DV1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML8 A;  1ZB9 A;  5LMN C;  4GKJ C;  4JI4 C;  4GKK C;  4DR7 C;  2ATW A;  5FLX D;  4X66 C;  4DV0 C;  4DV4 C;  2UXD C;  4DV5 C;  4B3R C;  4LFC C;  4LFB C;  1XNR C;  4YHH C;  3J7A D;  4B3M C;  4JI7 C;  4LF6 C;  1KKG A;  3OTO C;  2HHH C;  3T1Y C;  4DR3 C;  4X64 C;  4XX2 A;  1EGA A;  4DV3 C;  1ZB8 A;  1HNX C;  2CY1 A;  3CJE A;  1FJG C;  3LUS A;  3EER A;  2EGT A;  3R9W A;  5LMU C;  4NXM C;  1LQL A;  4DCS A;  4DCU A;  1HNZ C;  1USP B;  4BSZ A;  4DV7 C;  1IBL C;  5BR8 C;  1QWI A;  4AQY C;  1N2F A;  1N32 C;  4YY3 C;  3GKU A;  2CXC A;  5IT9 D;  2UU9 C;  3AF5 A;  1USP A;  2JMP A;  4X62 C;  4JI0 C;  4DCV A;  4DV2 C;  4JI5 C;  2ASB A;  3IEU A;  2PN2 A;  2XR1 A;  2UUC C;  4LF8 C;  4JYA C;  1HNW C;  1XMQ C;  1XMO C;  1PA4 A;  1HR0 C;  4JI6 C;  1XNQ C;  2UXB C;  2KZF A;  4DV6 C;  1IBM C;  1MKY A;  1WF3 A;  1J5E C;  2OPL B;  3I07 A;  4DCT A;  1N34 C;  4JI1 C;  4LF4 C;  2UUB C;  1L2F A;  2E8F A;  2BJO A;  2QL8 A;  2E7G A;  2E8E A;  4LF7 C;  4JI8 C;  2E5L C;  3IEV A;  4DR4 C;  2UXC C;  4MH4 A;  4DR1 C;  2VQF C;  4JV5 C;  3AF6 A;  4DR5 C;  3T1H C;  3JAM D;  5IWA C;  2UUA C;  1HH2 P;  1IBK C;  4OX9 C;  4X65 C;  1I94 C;  5A2Q D;  3R9X A;  1K0R A;  1NYE A;  1N33 C;  2YCB A;  1VLA A;  4MTN A;  3J81 D;  2VQE C;  4DR2 C;  2HJG A;  4LF5 C;  2E8C A;  4NOZ A;  4DUZ C;  1N36 C;  4LFA C;  2OPL A;  4K0K C;  2ONF A;  4NXN C;  4DR6 C;  3J80 D;  4LF9 C;  4B3T C;  2PT7 G;  1UKK A;  4B3S C;  4KHP C;  2DYJ A;  2F4V C;  4DUY C;  1WH9 A;  4JI3 C;  2D7V A;  1JOS A;  4DV1 C;  2ZM6 C;  4JI2 C; 
#chains in the Genus database with same CATH topology
 5BSM A;  5LMN C;  3L95 X;  3L8C A;  3FCE A;  2ATW A;  4DV0 C;  2OBV A;  3IML A;  4DV4 C;  4GXR A;  4RLQ A;  5BST A;  4DG9 A;  4B3R C;  1GPM A;  4LFB C;  1O93 A;  4B3M C;  2P2M A;  4K0B A;  3OTO C;  3T1Y C;  2JNV A;  1EGA A;  2P2Q A;  1IB8 A;  2CY1 A;  3CJE A;  1RG9 A;  3PRO C;  2CU6 A;  5LMU C;  4D4G A;  2WD9 A;  2D28 C;  4DCU A;  4DCS A;  4BSZ A;  4G1I A;  1O90 A;  3AY0 A;  2E0G A;  4YY3 C;  3GKU A;  3PBK A;  2CXC A;  5IT9 D;  2UU9 C;  2JMP A;  4X62 C;  3R44 A;  4JI0 C;  4IZ6 A;  4DV2 C;  3ETC A;  3IEU A;  4TPS B;  3VNS A;  3E7X A;  1AMU A;  4G37 A;  1O92 A;  4JYA C;  3C5E A;  1M6X A;  3E7W A;  2KZF A;  5T8S A;  1IBM C;  1MKY A;  5AE1 A;  4OXI A;  5KEI A;  1WF3 A;  2OPL B;  3I07 A;  4L2Z A;  3A25 A;  4JI1 C;  1O9T A;  2E8F A;  5H9U A;  2QVZ X;  1MDB A;  2E7G A;  4LF7 C;  2P20 A;  2E5L C;  2UXC C;  5GTD A;  4DR5 C;  5A19 A;  5BSV A;  5AE3 A;  1IBK C;  2Y4N A;  2MCQ A;  1I94 C;  5BUQ A;  5A2Q D;  3TDE A;  3R9X A;  2ZZM A;  1K0R A;  3PES A;  2MMA B;  2QVX X;  1FUG A;  3LNV A;  3J81 D;  1PG4 A;  4BC7 A;  2HJG A;  4LF5 C;  4DUZ C;  2OPL A;  4K0K C;  2M5O A;  4D57 A;  3NYR A;  4I9F A;  5AE2 A;  4LF9 C;  2VZE A;  1UKK A;  4JM1 A;  2P2J A;  3DHV A;  2YWC A;  2ZM6 C;  1YGT A;  3GPC A;  1P7L A;  5BSU A;  5BUR A;  4DR7 C;  5K85 A;  3ETO A;  4DV5 C;  1XNR C;  4YHH C;  2Y4O A;  4JI7 C;  4ZJZ A;  4WS9 A;  5JRH A;  4XX2 A;  1HNX C;  3S82 A;  1FJG C;  3LUS A;  4PUI A;  3EER A;  4PZP A;  5K8F A;  2DHM A;  4NXM C;  4DV7 C;  3CQ1 A;  3EQ6 A;  1N32 C;  3VNQ A;  3AF5 A;  1USP A;  1FLO A;  5KYV A;  1V26 A;  4BCA A;  1MDF A;  2BH1 X;  1XMQ C;  1XMO C;  1HR0 C;  2D1R A;  5KYT A;  5IFI A;  3DLP X;  4DCT A;  1N34 C;  2UUB C;  2BJO A;  1BA3 A;  1M6X C;  4MH4 A;  4JV5 C;  4KTV A;  3LGX A;  2D1S A;  4PUG A;  3N2Q A;  2OO4 A;  4LE5 A;  4WV3 A;  5IWA C;  1XDX A;  4BC9 A;  3A4I A;  4OX9 C;  4X65 C;  2D27 A;  5LCI A;  4GXQ A;  1VLA A;  4DR2 C;  3CQ3 A;  4I9G A;  2E8C A;  3NYQ A;  2ONF A;  4NXN C;  4DR6 C;  2PT7 G;  3UX2 A;  1P4E C;  1LCI A;  4KHP C;  1ULT A;  4RMN A;  4JI3 C;  2D7V A;  5ADZ A;  4JI2 C;  2KZ0 A;  4JI4 C;  4GKK C;  5CZV A;  3TUF A;  4X66 C;  3A9V A;  5CZX A;  2AYA A;  2UXD C;  1T5H X;  4L7I A;  4LFC C;  3J7A D;  3KXW A;  3K6R A;  4LF6 C;  5BSR A;  2HHH C;  3DAY A;  3FM7 A;  4DR3 C;  1ZB8 A;  2EGT A;  4FUQ A;  1MXC A;  3CW9 A;  1HNZ C;  1USP B;  4AQY C;  1N2F A;  2NCL A;  1WCJ A;  1NY8 A;  4RLF A;  4DCV A;  2PN2 A;  2XR1 A;  3UEB A;  2UUC C;  4PRO C;  4LF8 C;  1HNW C;  1PA4 A;  4JI6 C;  1XNQ C;  3H2T A;  2ZTB A;  4DV6 C;  1YJ7 A;  1J5E C;  4PHT A;  2DPL A;  4HPV A;  4D56 A;  4LF4 C;  2P02 A;  1L2F A;  2QL8 A;  3RV2 A;  2PG1 E;  3UZ0 A;  1XHJ A;  3IEV A;  2YWB A;  4RVN A;  4R1M A;  4RVO A;  4RM2 A;  1PU1 A;  3AF6 A;  5DV9 A;  3T1H C;  1RY2 A;  1MXB A;  3RG2 A;  3UX3 A;  2YCB A;  3LAX A;  1V60 A;  3CQ2 A;  1UWD A;  4PUH A;  4NOZ A;  4LFA C;  3NI2 A;  1QM4 A;  3J80 D;  4B3T C;  2P2F A;  4BBY A;  2YX1 A;  5T8T A;  2F4V C;  1WH9 A;  1JOS A;  2QVY X;  1XRA A;  1ML8 A;  3CW8 X;  5BUS A;  1ZB9 A;  4D4I A;  4DG8 A;  1XRB A;  4GKJ C;  3VNR A;  3I08 A;  5FLX D;  4OYC A;  3GR1 A;  4RM3 A;  3NPD A;  4IR7 A;  2D1T A;  2Y27 A;  4R0M A;  5A1I A;  2D1Q A;  1KKG A;  4X64 C;  1T5D X;  2KDN A;  2WP0 C;  4DV3 C;  3R9W A;  3B7W A;  1LQL A;  2Z51 A;  2PRO A;  1IBL C;  5BR8 C;  1QWI A;  2QW0 X;  3SO4 A;  1XS3 A;  4JI5 C;  2ASB A;  4ODJ A;  1MD9 A;  5A1G A;  4L4Q A;  2UXB C;  4G36 A;  3UOW A;  1P4E A;  3G7S A;  4ISB A;  3A9U A;  2E8E A;  4JI8 C;  4DR4 C;  4DR1 C;  2VQF C;  3GR0 A;  4EAT A;  5BSW A;  2V7B A;  4NDN A;  1XRC A;  3JAM D;  3O2E A;  2UUA C;  1HH2 P;  2M5H A;  1V25 A;  3LNO A;  2P2B A;  4R1L A;  1NYE A;  1VEH A;  2VSQ A;  3N54 B;  1N33 C;  4MTN A;  2VQE C;  4GS5 A;  4ZLP A;  1PG3 A;  2MM9 A;  5E7Q A;  4KTT A;  3TR3 A;  1MXA A;  1N36 C;  3TQI A;  4U5Y D;  4FUT A;  3IPL A;  4B3S C;  4FTF A;  2DYJ A;  4DUY C;  3A26 A;  3FCC A;  4DV1 C;  2ZZN A;  1TH5 A; 
#chains in the Genus database with same CATH homology
 5BSM A;  5LMN C;  3L95 X;  3L8C A;  3FCE A;  2ATW A;  4DV0 C;  2OBV A;  3IML A;  4DV4 C;  4GXR A;  4RLQ A;  5BST A;  4DG9 A;  4B3R C;  1GPM A;  4LFB C;  1O93 A;  4B3M C;  2P2M A;  4K0B A;  3OTO C;  3T1Y C;  1EGA A;  2P2Q A;  2CY1 A;  3CJE A;  1RG9 A;  3PRO C;  5LMU C;  4D4G A;  2WD9 A;  2D28 C;  4DCU A;  4DCS A;  4BSZ A;  4G1I A;  1O90 A;  2E0G A;  4YY3 C;  3GKU A;  3PBK A;  2CXC A;  5IT9 D;  2UU9 C;  2JMP A;  4X62 C;  3R44 A;  4JI0 C;  4IZ6 A;  4DV2 C;  3ETC A;  3IEU A;  4TPS B;  3VNS A;  3E7X A;  1AMU A;  4G37 A;  1O92 A;  4JYA C;  3C5E A;  3E7W A;  2KZF A;  5T8S A;  1IBM C;  1MKY A;  5AE1 A;  4OXI A;  5KEI A;  1WF3 A;  2OPL B;  3I07 A;  4L2Z A;  4JI1 C;  1O9T A;  2E8F A;  5H9U A;  2QVZ X;  1MDB A;  2E7G A;  4LF7 C;  2P20 A;  2E5L C;  2UXC C;  5GTD A;  4DR5 C;  5A19 A;  5BSV A;  5AE3 A;  1IBK C;  2Y4N A;  1I94 C;  5BUQ A;  5A2Q D;  3TDE A;  3R9X A;  1K0R A;  3PES A;  2QVX X;  1FUG A;  3LNV A;  3J81 D;  1PG4 A;  4BC7 A;  2HJG A;  4LF5 C;  4DUZ C;  2OPL A;  4K0K C;  4D57 A;  3NYR A;  4I9F A;  5AE2 A;  4LF9 C;  2VZE A;  1UKK A;  4JM1 A;  2P2J A;  3DHV A;  2YWC A;  2ZM6 C;  3GPC A;  1P7L A;  5BSU A;  5BUR A;  4DR7 C;  5K85 A;  3ETO A;  4DV5 C;  1XNR C;  4YHH C;  2Y4O A;  4JI7 C;  4ZJZ A;  4WS9 A;  5JRH A;  4XX2 A;  1HNX C;  3S82 A;  1FJG C;  3LUS A;  3EER A;  4PZP A;  5K8F A;  4NXM C;  4DV7 C;  3EQ6 A;  1N32 C;  3VNQ A;  3AF5 A;  1USP A;  5KYV A;  1V26 A;  4BCA A;  1MDF A;  2BH1 X;  1XMQ C;  1XMO C;  1HR0 C;  2D1R A;  5KYT A;  5IFI A;  3DLP X;  4DCT A;  1N34 C;  2UUB C;  2BJO A;  1BA3 A;  4MH4 A;  4JV5 C;  4KTV A;  3LGX A;  2D1S A;  3N2Q A;  2OO4 A;  4LE5 A;  4WV3 A;  5IWA C;  4BC9 A;  3A4I A;  4OX9 C;  4X65 C;  2D27 A;  4GXQ A;  1VLA A;  4DR2 C;  4I9G A;  2E8C A;  3NYQ A;  2ONF A;  4NXN C;  4DR6 C;  2PT7 G;  1LCI A;  4KHP C;  1ULT A;  4RMN A;  4JI3 C;  2D7V A;  5ADZ A;  4JI2 C;  4JI4 C;  4GKK C;  5CZV A;  3TUF A;  4X66 C;  3A9V A;  5CZX A;  2AYA A;  2UXD C;  1T5H X;  4L7I A;  4LFC C;  3J7A D;  3KXW A;  4LF6 C;  5BSR A;  2HHH C;  3DAY A;  4DR3 C;  1ZB8 A;  2EGT A;  4FUQ A;  1MXC A;  3CW9 A;  1HNZ C;  1USP B;  4AQY C;  1N2F A;  4RLF A;  4DCV A;  2PN2 A;  2XR1 A;  2UUC C;  4PRO C;  4LF8 C;  1HNW C;  1PA4 A;  4JI6 C;  1XNQ C;  3H2T A;  4DV6 C;  1YJ7 A;  1J5E C;  4PHT A;  2DPL A;  4HPV A;  4D56 A;  4LF4 C;  2P02 A;  1L2F A;  2QL8 A;  3RV2 A;  3UZ0 A;  3IEV A;  2YWB A;  4RVN A;  4R1M A;  4RVO A;  4RM2 A;  3AF6 A;  5DV9 A;  3T1H C;  1RY2 A;  1MXB A;  3RG2 A;  2YCB A;  3LAX A;  4NOZ A;  4LFA C;  3NI2 A;  1QM4 A;  3J80 D;  4B3T C;  2P2F A;  4BBY A;  5T8T A;  2F4V C;  1WH9 A;  1JOS A;  2QVY X;  1XRA A;  1ML8 A;  3CW8 X;  5BUS A;  1ZB9 A;  4D4I A;  4DG8 A;  1XRB A;  4GKJ C;  3VNR A;  3I08 A;  5FLX D;  4OYC A;  3GR1 A;  4RM3 A;  3NPD A;  4IR7 A;  2D1T A;  2Y27 A;  4R0M A;  5A1I A;  2D1Q A;  1KKG A;  4X64 C;  1T5D X;  2WP0 C;  4DV3 C;  3R9W A;  3B7W A;  1LQL A;  2PRO A;  1IBL C;  5BR8 C;  1QWI A;  2QW0 X;  3SO4 A;  4JI5 C;  2ASB A;  4ODJ A;  1MD9 A;  5A1G A;  4L4Q A;  2UXB C;  4G36 A;  3UOW A;  3G7S A;  4ISB A;  3A9U A;  2E8E A;  4JI8 C;  4DR4 C;  4DR1 C;  2VQF C;  3GR0 A;  4EAT A;  5BSW A;  2V7B A;  4NDN A;  1XRC A;  3JAM D;  2UUA C;  1HH2 P;  1V25 A;  2P2B A;  4R1L A;  1NYE A;  2VSQ A;  3N54 B;  1N33 C;  4MTN A;  2VQE C;  4GS5 A;  4ZLP A;  1PG3 A;  5E7Q A;  4KTT A;  1MXA A;  1N36 C;  3TQI A;  4U5Y D;  4FUT A;  3IPL A;  4B3S C;  4FTF A;  2DYJ A;  4DUY C;  3FCC A;  4DV1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...