1XMOC

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 40
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xmoC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1xmoC02
3AF6A 1L2FA 2VQEC 5LMNC 1VLAA 4LF7C 2F4VC 2VQFC 4KHPC 2EGTA 5FLXD 1JOSA 2PT7G 2ZM6C 4DV6C 4JI1C 4X64C 1HNZC 4DR1C 1IBKC 3R9WA 1WF3A 2UUAC 1WH9A 4B3MC 2HHHC 4LF8C 2PN2A 4LFBC 3EERA 3AF5A 2BJOA 4GKKC 1HNXC 2HJGA 2QL8A 4JI7C 4NXMC 4LF5C 4DV2C 3OTOC 4X65C 4JYAC 4DV7C 4K0KC 4DR4C 2E8FA 4JI6C 2E7GA 3J81D 4YY3C 4MTNA 2ATWA 4AQYC 3LUSA 1IBLC 4JI0C 4DR7C 4LFCC 1XNQC 4LF4C 4NXNC 2UUBC 4GKJC 5BR8C 4X66C 5IT9D 2CXCA 4DUYC 4DV1C 1LQLA 1K0RA 1UKKA 3T1YC 1XMQC 1USPB 1I94C 3CJEA 1N2FA 4MH4A 4NOZA 2E8EA 4JI3C 4BSZA 4DCSA 2E8CA 1HH2P 4DCVA 4DCUA 1PA4A 4DCTA 2UXBC 2KZFA 4DR2C 2DYJA 4DV4C 1ML8A 2ONFA 4X62C 3R9XA 1ZB9A 3IEVA 1XMOC 1KKGA 1USPA 4DV5C 2JMPA 1ZB8A 3I07A 2E5LC 2UUCC 4OX9C 2OPLB 1N36C 1J5EC 4XX2A 1EGAA 4DUZC 3JAMD 4YHHC 2UXDC 2XR1A 2CY1A 5IWAC 1N33C 5A2QD 1MKYA 4JI4C 4DR5C 3J7AD 3IEUA 4B3RC 1QWIA 4B3TC 4DR6C 3GKUA 4JI5C 4DV0C 3J80D 4B3SC 4LF9C 2YCBA 1XNRC 4JV5C 1N34C 1N32C 4JI2C 2ASBA 4LF6C 2OPLA 1HR0C 1IBMC 5LMUC 4DV3C 4DR3C 1NYEA 2UU9C 4JI8C 3T1HC 4LFAC 2UXCC 1HNWC 2D7VA 1FJGC
chains in the Genus database with same CATH superfamily
2VQEC 4LF7C 2VQFC 2KZ0A 1RY2A 4U5YD 3RG2A 5FLXD 4JI1C 4X64C 4DR1C 1IBKC 4D4IA 4R0MA 2UUAC 1O93A 3N2QA 2HHHC 4LF8C 1MD9A 2PN2A 2MM9A 3AF5A 4OXIA 1V26A 1YJ7A 3CW8X 3A9UA 4BC7A 4LF5C 4ZJZA 2YWCA 4JYAC 4K0KC 3FCEA 2P2BA 5AE3A 2ATWA 3UOWA 3B7WA 2VSQA 4JI0C 1XNQC 5BURA 4LF4C 2P20A 3UZ0A 4GKJC 2P2JA 4IZ6A 3C5EA 4JM1A 4DUYC 4DV1C 1PU1A 1XRAA 1K0RA 1I94C 4JI3C 1M6XA 3FCCA 2E8CA 4GS5A 3DHVA 4DCTA 1PA4A 1GPMA 4DR2C 4HPVA 3PROC 2P2FA 3CQ2A 5LCIA 4DG9A 3VNSA 2D1RA 1KKGA 2NCLA 1USPA 2UUCC 2OPLB 3E7WA 5DV9A 2Y4NA 2CY1A 3NYRA 1UWDA 1XHJA 1P7LA 3PBKA 3J80D 4LF9C 4FUQA 3N54B 3TUFA 2P2QA 3I08A 2BH1X 3NI2A 3DAYA 4DV3C 4LFAC 1PG3A 4JI8C 1L2FA 2F4VC 3IPLA 1VLAA 4EATA 4KHPC 2EGTA 4DV6C 3LNVA 2CU6A 1PG4A 1HNZC 3IMLA 4D57A 3R9WA 4PUGA 4B3MC 1YGTA 3TDEA 4LFBC 2V7BA 3EERA 2Z51A 2BJOA 4GKKC 2OO4A 5BSUA 4JI7C 4NXMC 5CZXA 5KYTA 3OTOC 1P4EC 2WD9A 4X65C 1IB8A 2E7GA 5A1IA 4YY3C 2D1QA 5KYVA 4AQYC 1QM4A 1IBLC 4DR7C 4LFCC 3ETOA 3L95X 2P2MA 4NXNC 2UUBC 2CXCA 4I9GA 4GXQA 1LQLA 4IR7A 1UKKA 3T1YC 5H9UA 3NYQA 2E8EA 4RMNA 4BSZA 4DCSA 4FTFA 4DCUA 4DCVA 1P4EA 4RVOA 3A4IA 4WV3A 1XRBA 1O9TA 1V60A 4ODJA 3A9VA 1XMOC 4G37A 3GR1A 4DV5C 2Y4OA 3O2EA 2E5LC 4XX2A 1EGAA 2XR1A 1MDFA 2P02A 5A2QD 4D4GA 3IEUA 3UX3A 2ZZNA 4B3SC 2ZZMA 1N34C 2ASBA 3UEBA 2OPLA 4PUHA 1IBMC 2QVXX 5K8FA 2UXCC 4RLFA 2VZEA 2YX1A 5LMNC 2DHMA 2PG1E 1JOSA 5BSRA 5IFIA 3A26A 1WH9A 5BSWA 2Y27A 4DG8A 3CQ1A 3VNQA 1TH5A 5AE1A 3CW9A 4KTTA 2QW0X 1FLOA 2JNVA 3A25A 4JI6C 3LGXA 3LUSA 4WS9A 4G36A 3KXWA 5BUQA 5BR8C 1FUGA 4X66C 5E7QA 5IT9D 4RM2A 2D27A 1MDBA 3H2TA 4ISBA 1XMQC 4MH4A 4NOZA 2D1TA 3TR3A 2QVZX 5BUSA 3FM7A 1LCIA 2UXBC 3ETCA 5T8TA 2DYJA 4L7IA 2AYAA 4FUTA 1ML8A 2ONFA 4X62C 3R9XA 3CQ3A 2YWBA 3E7XA 3K6RA 3PESA 4D56A 2MMAB 3SO4A 4OYCA 4OX9C 1N36C 1T5DX 3R44A 3JAMD 1MXBA 4K0BA 4YHHC 5BSTA 2UXDC 3L8CA 5AE2A 5T8SA 5ADZA 4JI4C 2PROA 4DR5C 4B3TC 4ZLPA 3GKUA 4DR6C 4JI5C 3LNOA 1XNRC 3G7SA 4JV5C 3AY0A 1NY8A 4JI2C 4PUIA 2DPLA 4KTVA 5CZVA 3EQ6A 1M6XC 4R1LA 1NYEA 1HNWC 1FJGC 3AF6A 4R1MA 4L2ZA 2OBVA 4NDNA 2PT7G 2ZM6C 4BC9A 2E0GA 1T5HX 1XDXA 1WF3A 5GTDA 4PHTA 1HNXC 2HJGA 2QL8A 1XS3A 3GR0A 3DLPX 4DV2C 3UX2A 3GPCA 4DV7C 4DR4C 2E8FA 3J81D 4MTNA 3VNRA 2D1SA 1O90A 1XRCA 1RG9A 1VEHA 2MCQA 5KEIA 3TQIA 4BCAA 4L4QA 1USPB 5K85A 3CJEA 2D28C 1N2FA 5A19A 3RV2A 4LE5A 1HH2P 5BSVA 2KZFA 3LAXA 1ULTA 4RVNA 4BBYA 2KDNA 3NPDA 4GXRA 4DV4C 4RLQA 1ZB9A 2WP0C 5JRHA 3IEVA 2JMPA 1ZB8A 3I07A 4G1IA 1WCJA 1J5EC 2ZTBA 4DUZC 5BSMA 1V25A 5IWAC 1N33C 2M5HA 1MKYA 3J7AD 4RM3A 4B3RC 1QWIA 1O92A 4DV0C 4PZPA 4TPSB 3S82A 2YCBA 5A1GA 2QVYX 1N32C 2M5OA 1AMUA 4LF6C 1BA3A 1MXAA 1HR0C 4PROC 5LMUC 4DR3C 2UU9C 3T1HC 4I9FA 1MXCA 2D7VA
chains in the Genus database with same CATH topology
2VQEC 4LF7C 2VQFC 1RY2A 4U5YD 3RG2A 5FLXD 4JI1C 4X64C 4DR1C 1IBKC 4D4IA 4R0MA 2UUAC 1O93A 3N2QA 2HHHC 4LF8C 1MD9A 2PN2A 3AF5A 4OXIA 1V26A 1YJ7A 3CW8X 3A9UA 4BC7A 4LF5C 4ZJZA 2YWCA 4JYAC 4K0KC 3FCEA 2P2BA 5AE3A 2ATWA 3UOWA 3B7WA 2VSQA 4JI0C 1XNQC 5BURA 4LF4C 2P20A 3UZ0A 4GKJC 2P2JA 4IZ6A 3C5EA 4JM1A 4DUYC 4DV1C 1XRAA 1K0RA 1I94C 4JI3C 3FCCA 2E8CA 4GS5A 3DHVA 4DCTA 1PA4A 1GPMA 4DR2C 4HPVA 3PROC 2P2FA 4DG9A 3VNSA 2D1RA 1KKGA 1USPA 2UUCC 2OPLB 3E7WA 5DV9A 2Y4NA 2CY1A 3NYRA 1P7LA 3PBKA 3J80D 4LF9C 4FUQA 3N54B 3TUFA 2P2QA 3I08A 2BH1X 3NI2A 3DAYA 4DV3C 4LFAC 1PG3A 4JI8C 1L2FA 2F4VC 3IPLA 1VLAA 4EATA 4KHPC 2EGTA 4DV6C 3LNVA 1PG4A 1HNZC 3IMLA 4D57A 3R9WA 4B3MC 3TDEA 4LFBC 2V7BA 3EERA 2BJOA 4GKKC 2OO4A 5BSUA 4JI7C 4NXMC 5CZXA 5KYTA 3OTOC 2WD9A 4X65C 2E7GA 5A1IA 4YY3C 2D1QA 5KYVA 4AQYC 1QM4A 1IBLC 4DR7C 4LFCC 3ETOA 3L95X 2P2MA 4NXNC 2UUBC 2CXCA 4I9GA 4GXQA 1LQLA 4IR7A 1UKKA 3T1YC 5H9UA 3NYQA 2E8EA 4RMNA 4BSZA 4DCSA 4FTFA 4DCUA 4DCVA 4RVOA 3A4IA 4WV3A 1XRBA 1O9TA 4ODJA 3A9VA 1XMOC 4G37A 3GR1A 4DV5C 2Y4OA 2E5LC 4XX2A 1EGAA 2XR1A 1MDFA 2P02A 5A2QD 4D4GA 3IEUA 4B3SC 1N34C 2ASBA 2OPLA 1IBMC 2QVXX 5K8FA 2UXCC 4RLFA 2VZEA 5LMNC 1JOSA 5BSRA 5IFIA 1WH9A 5BSWA 2Y27A 4DG8A 3VNQA 5AE1A 3CW9A 4KTTA 2QW0X 4JI6C 3LGXA 3LUSA 4WS9A 4G36A 3KXWA 5BUQA 5BR8C 1FUGA 4X66C 5E7QA 5IT9D 4RM2A 2D27A 1MDBA 3H2TA 4ISBA 1XMQC 4MH4A 4NOZA 2D1TA 2QVZX 5BUSA 1LCIA 2UXBC 3ETCA 5T8TA 2DYJA 4L7IA 2AYAA 4FUTA 1ML8A 2ONFA 4X62C 3R9XA 2YWBA 3E7XA 3PESA 4D56A 3SO4A 4OYCA 4OX9C 1N36C 1T5DX 3R44A 3JAMD 1MXBA 4K0BA 4YHHC 5BSTA 2UXDC 3L8CA 5AE2A 5T8SA 5ADZA 4JI4C 2PROA 4DR5C 4B3TC 4ZLPA 3GKUA 4DR6C 4JI5C 1XNRC 3G7SA 4JV5C 4JI2C 2DPLA 4KTVA 5CZVA 3EQ6A 4R1LA 1NYEA 1HNWC 1FJGC 3AF6A 4R1MA 4L2ZA 2OBVA 4NDNA 2PT7G 2ZM6C 4BC9A 2E0GA 1T5HX 1WF3A 5GTDA 4PHTA 1HNXC 2HJGA 2QL8A 3GR0A 3DLPX 4DV2C 3GPCA 4DV7C 4DR4C 2E8FA 3J81D 4MTNA 3VNRA 2D1SA 1O90A 1XRCA 1RG9A 5KEIA 3TQIA 4BCAA 4L4QA 1USPB 5K85A 3CJEA 2D28C 1N2FA 5A19A 3RV2A 4LE5A 1HH2P 5BSVA 2KZFA 3LAXA 1ULTA 4RVNA 4BBYA 3NPDA 4GXRA 4DV4C 4RLQA 1ZB9A 2WP0C 5JRHA 3IEVA 2JMPA 1ZB8A 3I07A 4G1IA 1J5EC 4DUZC 5BSMA 1V25A 5IWAC 1N33C 1MKYA 3J7AD 4RM3A 4B3RC 1QWIA 1O92A 4DV0C 4PZPA 4TPSB 3S82A 2YCBA 5A1GA 2QVYX 1N32C 1AMUA 4LF6C 1BA3A 1MXAA 1HR0C 4PROC 5LMUC 4DR3C 2UU9C 3T1HC 4I9FA 1MXCA 2D7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AF6 A;  1L2F A;  2VQE C;  5LMN C;  1VLA A;  4LF7 C;  2F4V C;  2VQF C;  4KHP C;  2EGT A;  5FLX D;  1JOS A;  2PT7 G;  2ZM6 C;  4DV6 C;  4JI1 C;  4X64 C;  1HNZ C;  4DR1 C;  1IBK C;  3R9W A;  1WF3 A;  2UUA C;  1WH9 A;  4B3M C;  2HHH C;  4LF8 C;  2PN2 A;  4LFB C;  3EER A;  3AF5 A;  2BJO A;  4GKK C;  1HNX C;  2HJG A;  2QL8 A;  4JI7 C;  4NXM C;  4LF5 C;  4DV2 C;  3OTO C;  4X65 C;  4JYA C;  4DV7 C;  4K0K C;  4DR4 C;  2E8F A;  4JI6 C;  2E7G A;  3J81 D;  4YY3 C;  4MTN A;  2ATW A;  4AQY C;  3LUS A;  1IBL C;  4JI0 C;  4DR7 C;  4LFC C;  1XNQ C;  4LF4 C;  4NXN C;  2UUB C;  4GKJ C;  5BR8 C;  4X66 C;  5IT9 D;  2CXC A;  4DUY C;  4DV1 C;  1LQL A;  1K0R A;  1UKK A;  3T1Y C;  1XMQ C;  1USP B;  1I94 C;  3CJE A;  1N2F A;  4MH4 A;  4NOZ A;  2E8E A;  4JI3 C;  4BSZ A;  4DCS A;  2E8C A;  1HH2 P;  4DCV A;  4DCU A;  1PA4 A;  4DCT A;  2UXB C;  2KZF A;  4DR2 C;  2DYJ A;  4DV4 C;  1ML8 A;  2ONF A;  4X62 C;  3R9X A;  1ZB9 A;  3IEV A;  1XMO C;  1KKG A;  1USP A;  4DV5 C;  2JMP A;  1ZB8 A;  3I07 A;  2E5L C;  2UUC C;  4OX9 C;  2OPL B;  1N36 C;  1J5E C;  4XX2 A;  1EGA A;  4DUZ C;  3JAM D;  4YHH C;  2UXD C;  2XR1 A;  2CY1 A;  5IWA C;  1N33 C;  5A2Q D;  1MKY A;  4JI4 C;  4DR5 C;  3J7A D;  3IEU A;  4B3R C;  1QWI A;  4B3T C;  4DR6 C;  3GKU A;  4JI5 C;  4DV0 C;  3J80 D;  4B3S C;  4LF9 C;  2YCB A;  1XNR C;  4JV5 C;  1N34 C;  1N32 C;  4JI2 C;  2ASB A;  4LF6 C;  2OPL A;  1HR0 C;  1IBM C;  5LMU C;  4DV3 C;  4DR3 C;  1NYE A;  2UU9 C;  4JI8 C;  3T1H C;  4LFA C;  2UXC C;  1HNW C;  2D7V A;  1FJG C; 
#chains in the Genus database with same CATH topology
 2VQE C;  4LF7 C;  2VQF C;  2KZ0 A;  1RY2 A;  4U5Y D;  3RG2 A;  5FLX D;  4JI1 C;  4X64 C;  4DR1 C;  1IBK C;  4D4I A;  4R0M A;  2UUA C;  1O93 A;  3N2Q A;  2HHH C;  4LF8 C;  1MD9 A;  2PN2 A;  2MM9 A;  3AF5 A;  4OXI A;  1V26 A;  1YJ7 A;  3CW8 X;  3A9U A;  4BC7 A;  4LF5 C;  4ZJZ A;  2YWC A;  4JYA C;  4K0K C;  3FCE A;  2P2B A;  5AE3 A;  2ATW A;  3UOW A;  3B7W A;  2VSQ A;  4JI0 C;  1XNQ C;  5BUR A;  4LF4 C;  2P20 A;  3UZ0 A;  4GKJ C;  2P2J A;  4IZ6 A;  3C5E A;  4JM1 A;  4DUY C;  4DV1 C;  1PU1 A;  1XRA A;  1K0R A;  1I94 C;  4JI3 C;  1M6X A;  3FCC A;  2E8C A;  4GS5 A;  3DHV A;  4DCT A;  1PA4 A;  1GPM A;  4DR2 C;  4HPV A;  3PRO C;  2P2F A;  3CQ2 A;  5LCI A;  4DG9 A;  3VNS A;  2D1R A;  1KKG A;  2NCL A;  1USP A;  2UUC C;  2OPL B;  3E7W A;  5DV9 A;  2Y4N A;  2CY1 A;  3NYR A;  1UWD A;  1XHJ A;  1P7L A;  3PBK A;  3J80 D;  4LF9 C;  4FUQ A;  3N54 B;  3TUF A;  2P2Q A;  3I08 A;  2BH1 X;  3NI2 A;  3DAY A;  4DV3 C;  4LFA C;  1PG3 A;  4JI8 C;  1L2F A;  2F4V C;  3IPL A;  1VLA A;  4EAT A;  4KHP C;  2EGT A;  4DV6 C;  3LNV A;  2CU6 A;  1PG4 A;  1HNZ C;  3IML A;  4D57 A;  3R9W A;  4PUG A;  4B3M C;  1YGT A;  3TDE A;  4LFB C;  2V7B A;  3EER A;  2Z51 A;  2BJO A;  4GKK C;  2OO4 A;  5BSU A;  4JI7 C;  4NXM C;  5CZX A;  5KYT A;  3OTO C;  1P4E C;  2WD9 A;  4X65 C;  1IB8 A;  2E7G A;  5A1I A;  4YY3 C;  2D1Q A;  5KYV A;  4AQY C;  1QM4 A;  1IBL C;  4DR7 C;  4LFC C;  3ETO A;  3L95 X;  2P2M A;  4NXN C;  2UUB C;  2CXC A;  4I9G A;  4GXQ A;  1LQL A;  4IR7 A;  1UKK A;  3T1Y C;  5H9U A;  3NYQ A;  2E8E A;  4RMN A;  4BSZ A;  4DCS A;  4FTF A;  4DCU A;  4DCV A;  1P4E A;  4RVO A;  3A4I A;  4WV3 A;  1XRB A;  1O9T A;  1V60 A;  4ODJ A;  3A9V A;  1XMO C;  4G37 A;  3GR1 A;  4DV5 C;  2Y4O A;  3O2E A;  2E5L C;  4XX2 A;  1EGA A;  2XR1 A;  1MDF A;  2P02 A;  5A2Q D;  4D4G A;  3IEU A;  3UX3 A;  2ZZN A;  4B3S C;  2ZZM A;  1N34 C;  2ASB A;  3UEB A;  2OPL A;  4PUH A;  1IBM C;  2QVX X;  5K8F A;  2UXC C;  4RLF A;  2VZE A;  2YX1 A;  5LMN C;  2DHM A;  2PG1 E;  1JOS A;  5BSR A;  5IFI A;  3A26 A;  1WH9 A;  5BSW A;  2Y27 A;  4DG8 A;  3CQ1 A;  3VNQ A;  1TH5 A;  5AE1 A;  3CW9 A;  4KTT A;  2QW0 X;  1FLO A;  2JNV A;  3A25 A;  4JI6 C;  3LGX A;  3LUS A;  4WS9 A;  4G36 A;  3KXW A;  5BUQ A;  5BR8 C;  1FUG A;  4X66 C;  5E7Q A;  5IT9 D;  4RM2 A;  2D27 A;  1MDB A;  3H2T A;  4ISB A;  1XMQ C;  4MH4 A;  4NOZ A;  2D1T A;  3TR3 A;  2QVZ X;  5BUS A;  3FM7 A;  1LCI A;  2UXB C;  3ETC A;  5T8T A;  2DYJ A;  4L7I A;  2AYA A;  4FUT A;  1ML8 A;  2ONF A;  4X62 C;  3R9X A;  3CQ3 A;  2YWB A;  3E7X A;  3K6R A;  3PES A;  4D56 A;  2MMA B;  3SO4 A;  4OYC A;  4OX9 C;  1N36 C;  1T5D X;  3R44 A;  3JAM D;  1MXB A;  4K0B A;  4YHH C;  5BST A;  2UXD C;  3L8C A;  5AE2 A;  5T8S A;  5ADZ A;  4JI4 C;  2PRO A;  4DR5 C;  4B3T C;  4ZLP A;  3GKU A;  4DR6 C;  4JI5 C;  3LNO A;  1XNR C;  3G7S A;  4JV5 C;  3AY0 A;  1NY8 A;  4JI2 C;  4PUI A;  2DPL A;  4KTV A;  5CZV A;  3EQ6 A;  1M6X C;  4R1L A;  1NYE A;  1HNW C;  1FJG C;  3AF6 A;  4R1M A;  4L2Z A;  2OBV A;  4NDN A;  2PT7 G;  2ZM6 C;  4BC9 A;  2E0G A;  1T5H X;  1XDX A;  1WF3 A;  5GTD A;  4PHT A;  1HNX C;  2HJG A;  2QL8 A;  1XS3 A;  3GR0 A;  3DLP X;  4DV2 C;  3UX2 A;  3GPC A;  4DV7 C;  4DR4 C;  2E8F A;  3J81 D;  4MTN A;  3VNR A;  2D1S A;  1O90 A;  1XRC A;  1RG9 A;  1VEH A;  2MCQ A;  5KEI A;  3TQI A;  4BCA A;  4L4Q A;  1USP B;  5K85 A;  3CJE A;  2D28 C;  1N2F A;  5A19 A;  3RV2 A;  4LE5 A;  1HH2 P;  5BSV A;  2KZF A;  3LAX A;  1ULT A;  4RVN A;  4BBY A;  2KDN A;  3NPD A;  4GXR A;  4DV4 C;  4RLQ A;  1ZB9 A;  2WP0 C;  5JRH A;  3IEV A;  2JMP A;  1ZB8 A;  3I07 A;  4G1I A;  1WCJ A;  1J5E C;  2ZTB A;  4DUZ C;  5BSM A;  1V25 A;  5IWA C;  1N33 C;  2M5H A;  1MKY A;  3J7A D;  4RM3 A;  4B3R C;  1QWI A;  1O92 A;  4DV0 C;  4PZP A;  4TPS B;  3S82 A;  2YCB A;  5A1G A;  2QVY X;  1N32 C;  2M5O A;  1AMU A;  4LF6 C;  1BA3 A;  1MXA A;  1HR0 C;  4PRO C;  5LMU C;  4DR3 C;  2UU9 C;  3T1H C;  4I9F A;  1MXC A;  2D7V A; 
#chains in the Genus database with same CATH homology
 2VQE C;  4LF7 C;  2VQF C;  1RY2 A;  4U5Y D;  3RG2 A;  5FLX D;  4JI1 C;  4X64 C;  4DR1 C;  1IBK C;  4D4I A;  4R0M A;  2UUA C;  1O93 A;  3N2Q A;  2HHH C;  4LF8 C;  1MD9 A;  2PN2 A;  3AF5 A;  4OXI A;  1V26 A;  1YJ7 A;  3CW8 X;  3A9U A;  4BC7 A;  4LF5 C;  4ZJZ A;  2YWC A;  4JYA C;  4K0K C;  3FCE A;  2P2B A;  5AE3 A;  2ATW A;  3UOW A;  3B7W A;  2VSQ A;  4JI0 C;  1XNQ C;  5BUR A;  4LF4 C;  2P20 A;  3UZ0 A;  4GKJ C;  2P2J A;  4IZ6 A;  3C5E A;  4JM1 A;  4DUY C;  4DV1 C;  1XRA A;  1K0R A;  1I94 C;  4JI3 C;  3FCC A;  2E8C A;  4GS5 A;  3DHV A;  4DCT A;  1PA4 A;  1GPM A;  4DR2 C;  4HPV A;  3PRO C;  2P2F A;  4DG9 A;  3VNS A;  2D1R A;  1KKG A;  1USP A;  2UUC C;  2OPL B;  3E7W A;  5DV9 A;  2Y4N A;  2CY1 A;  3NYR A;  1P7L A;  3PBK A;  3J80 D;  4LF9 C;  4FUQ A;  3N54 B;  3TUF A;  2P2Q A;  3I08 A;  2BH1 X;  3NI2 A;  3DAY A;  4DV3 C;  4LFA C;  1PG3 A;  4JI8 C;  1L2F A;  2F4V C;  3IPL A;  1VLA A;  4EAT A;  4KHP C;  2EGT A;  4DV6 C;  3LNV A;  1PG4 A;  1HNZ C;  3IML A;  4D57 A;  3R9W A;  4B3M C;  3TDE A;  4LFB C;  2V7B A;  3EER A;  2BJO A;  4GKK C;  2OO4 A;  5BSU A;  4JI7 C;  4NXM C;  5CZX A;  5KYT A;  3OTO C;  2WD9 A;  4X65 C;  2E7G A;  5A1I A;  4YY3 C;  2D1Q A;  5KYV A;  4AQY C;  1QM4 A;  1IBL C;  4DR7 C;  4LFC C;  3ETO A;  3L95 X;  2P2M A;  4NXN C;  2UUB C;  2CXC A;  4I9G A;  4GXQ A;  1LQL A;  4IR7 A;  1UKK A;  3T1Y C;  5H9U A;  3NYQ A;  2E8E A;  4RMN A;  4BSZ A;  4DCS A;  4FTF A;  4DCU A;  4DCV A;  4RVO A;  3A4I A;  4WV3 A;  1XRB A;  1O9T A;  4ODJ A;  3A9V A;  1XMO C;  4G37 A;  3GR1 A;  4DV5 C;  2Y4O A;  2E5L C;  4XX2 A;  1EGA A;  2XR1 A;  1MDF A;  2P02 A;  5A2Q D;  4D4G A;  3IEU A;  4B3S C;  1N34 C;  2ASB A;  2OPL A;  1IBM C;  2QVX X;  5K8F A;  2UXC C;  4RLF A;  2VZE A;  5LMN C;  1JOS A;  5BSR A;  5IFI A;  1WH9 A;  5BSW A;  2Y27 A;  4DG8 A;  3VNQ A;  5AE1 A;  3CW9 A;  4KTT A;  2QW0 X;  4JI6 C;  3LGX A;  3LUS A;  4WS9 A;  4G36 A;  3KXW A;  5BUQ A;  5BR8 C;  1FUG A;  4X66 C;  5E7Q A;  5IT9 D;  4RM2 A;  2D27 A;  1MDB A;  3H2T A;  4ISB A;  1XMQ C;  4MH4 A;  4NOZ A;  2D1T A;  2QVZ X;  5BUS A;  1LCI A;  2UXB C;  3ETC A;  5T8T A;  2DYJ A;  4L7I A;  2AYA A;  4FUT A;  1ML8 A;  2ONF A;  4X62 C;  3R9X A;  2YWB A;  3E7X A;  3PES A;  4D56 A;  3SO4 A;  4OYC A;  4OX9 C;  1N36 C;  1T5D X;  3R44 A;  3JAM D;  1MXB A;  4K0B A;  4YHH C;  5BST A;  2UXD C;  3L8C A;  5AE2 A;  5T8S A;  5ADZ A;  4JI4 C;  2PRO A;  4DR5 C;  4B3T C;  4ZLP A;  3GKU A;  4DR6 C;  4JI5 C;  1XNR C;  3G7S A;  4JV5 C;  4JI2 C;  2DPL A;  4KTV A;  5CZV A;  3EQ6 A;  4R1L A;  1NYE A;  1HNW C;  1FJG C;  3AF6 A;  4R1M A;  4L2Z A;  2OBV A;  4NDN A;  2PT7 G;  2ZM6 C;  4BC9 A;  2E0G A;  1T5H X;  1WF3 A;  5GTD A;  4PHT A;  1HNX C;  2HJG A;  2QL8 A;  3GR0 A;  3DLP X;  4DV2 C;  3GPC A;  4DV7 C;  4DR4 C;  2E8F A;  3J81 D;  4MTN A;  3VNR A;  2D1S A;  1O90 A;  1XRC A;  1RG9 A;  5KEI A;  3TQI A;  4BCA A;  4L4Q A;  1USP B;  5K85 A;  3CJE A;  2D28 C;  1N2F A;  5A19 A;  3RV2 A;  4LE5 A;  1HH2 P;  5BSV A;  2KZF A;  3LAX A;  1ULT A;  4RVN A;  4BBY A;  3NPD A;  4GXR A;  4DV4 C;  4RLQ A;  1ZB9 A;  2WP0 C;  5JRH A;  3IEV A;  2JMP A;  1ZB8 A;  3I07 A;  4G1I A;  1J5E C;  4DUZ C;  5BSM A;  1V25 A;  5IWA C;  1N33 C;  1MKY A;  3J7A D;  4RM3 A;  4B3R C;  1QWI A;  1O92 A;  4DV0 C;  4PZP A;  4TPS B;  3S82 A;  2YCB A;  5A1G A;  2QVY X;  1N32 C;  1AMU A;  4LF6 C;  1BA3 A;  1MXA A;  1HR0 C;  4PRO C;  5LMU C;  4DR3 C;  2UU9 C;  3T1H C;  4I9F A;  1MXC A;  2D7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...