2UXCC

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 40
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uxcC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uxcC02
2OPLA 4DR5C 4DCVA 4LF4C 4B3RC 1IBKC 4DCTA 5IWAC 3AF6A 1XMQC 2QL8A 2E5LC 1XNRC 3J81D 4KHPC 4JI5C 2EGTA 2CY1A 4JI2C 5LMNC 5FLXD 3R9WA 1HNWC 2UUCC 4JYAC 4MH4A 4DV3C 1USPA 4K0KC 2D7VA 4DCUA 2E8CA 2VQEC 2E8EA 2XR1A 3T1YC 3CJEA 4X66C 1EGAA 4DUYC 2JMPA 4DCSA 4JI1C 3OTOC 4LF8C 1N2FA 1XNQC 3IEUA 3I07A 5BR8C 2E8FA 1WH9A 2HJGA 4JI4C 3T1HC 1HNZC 2VQFC 1ZB9A 1KKGA 4BSZA 4JV5C 1XMOC 1N34C 2DYJA 4DR1C 1PA4A 4DV4C 2CXCA 1HNXC 2UU9C 1N32C 4X62C 4X65C 4DV2C 4LF9C 2BJOA 2PN2A 5IT9D 2KZFA 4NXMC 2ONFA 2HHHC 4JI0C 2UUAC 5LMUC 4JI7C 4LFCC 4LFAC 1JOSA 4B3TC 4DR2C 4YY3C 4DV7C 1ZB8A 4XX2A 2ATWA 4LFBC 4DV0C 4DV6C 2E7GA 1J5EC 2UUBC 1ML8A 1HR0C 4LF5C 4LF6C 2ZM6C 4OX9C 3IEVA 4GKKC 2UXDC 4NOZA 1IBMC 2UXBC 4NXNC 3J7AD 5A2QD 3AF5A 2F4VC 2OPLB 4LF7C 1WF3A 1UKKA 1FJGC 1I94C 4X64C 4DR7C 3LUSA 1LQLA 1N33C 1L2FA 2UXCC 4DR4C 2ASBA 1IBLC 3GKUA 1USPB 2YCBA 4DUZC 4JI6C 3EERA 1MKYA 4DR6C 4DV1C 4B3SC 1N36C 1HH2P 1NYEA 4AQYC 1QWIA 4B3MC 2PT7G 4YHHC 3J80D 4DV5C 4DR3C 1VLAA 4JI8C 4MTNA 3JAMD 3R9XA 1K0RA 4GKJC 4JI3C
chains in the Genus database with same CATH superfamily
2M5HA 1V25A 4PHTA 4L2ZA 4DR5C 1MDFA 3LNVA 4ZLPA 3EQ6A 4FUTA 1XRBA 1XNRC 1O92A 4JI5C 5CZXA 1WCJA 1YJ7A 3E7WA 3ETOA 5LMNC 4EATA 3PROC 3KXWA 1P4EC 5A19A 1USPA 1BA3A 2E8CA 3IPLA 4OYCA 1T5DX 3CJEA 4X66C 2JMPA 1O93A 5BUSA 2HJGA 3T1HC 2QVYX 3UZ0A 2P2QA 2P02A 1KKGA 1FUGA 4JV5C 3TUFA 3DHVA 1PA4A 5KYTA 4DV4C 3DAYA 1N32C 4X62C 4DV2C 4LF9C 3FCCA 2BJOA 5BSRA 4NXMC 1P7LA 2P2FA 1LCIA 2ONFA 4JI0C 3A4IA 5LMUC 3CW8X 3FCEA 4DR2C 2P20A 1V60A 3CQ1A 2UUBC 3UX2A 4OX9C 3IEVA 2QVZX 3TR3A 4NXNC 3AF5A 2F4VC 1UKKA 3C5EA 4D4GA 2Y27A 2MCQA 3IMLA 1L2FA 5T8SA 3L95X 2MMAB 3GKUA 1YGTA 1MKYA 5AE2A 4DV1C 4G1IA 4B3MC 1HH2P 1NYEA 2PROA 4L4QA 2Z51A 2PT7G 3N2QA 4YHHC 4DR3C 4PROC 4MTNA 4RM2A 3R9XA 2D1RA 4JI3C 5BSUA 4KTVA 5BSMA 4LF4C 4K0BA 1IBKC 2PG1E 3SO4A 3LAXA 4DCTA 2D1SA 5IWAC 3AF6A 4BC7A 1XMQC 4D4IA 2E5LC 4JI2C 2M5OA 1HNWC 4G36A 2ZZNA 4GXRA 4JYAC 2YX1A 2OO4A 1PG3A 1RY2A 4DCUA 2D7VA 4HPVA 2VQEC 3DLPX 2WD9A 4DCSA 5K85A 3O2EA 1N2FA 4R0MA 3IEUA 4JI4C 2VQFC 4RVNA 1ZB9A 2AYAA 3B7WA 2CXCA 1HNXC 2E0GA 4KTTA 5IT9D 5BSTA 1XRAA 2UUAC 4FUQA 4LFCC 4I9FA 4LFAC 1MXCA 3PESA 5DV9A 5H9UA 1XS3A 2ATWA 3G7SA 5CZVA 1O9TA 2E7GA 2D1QA 2YWCA 5T8TA 4GKKC 2UXDC 4NOZA 2UXBC 2QVXX 4RM3A 3GPCA 4D56A 5A2QD 3NYRA 4LF7C 2D28C 1I94C 3ETCA 1PU1A 4GS5A 1NY8A 4L7IA 3FM7A 1LQLA 1MXAA 1N33C 3CQ3A 4IR7A 2UXCC 3A9UA 4R1MA 2BH1X 1USPB 4ISBA 2NCLA 2YCBA 4G37A 4RLFA 1MXBA 1V26A 2VSQA 3VNSA 4GKJC 2OPLA 1TH5A 3L8CA 1MDBA 1XDXA 2QL8A 3J81D 2CY1A 3R9WA 3K6RA 5GTDA 4FTFA 4LE5A 1RG9A 2CU6A 4PUGA 2XR1A 1EGAA 2VZEA 4PZPA 4DUYC 3RV2A 4GXQA 3NI2A 3OTOC 4JI1C 4NDNA 5BR8C 2E8FA 4OXIA 2WP0C 2ZZMA 2DPLA 1N34C 2DYJA 4RLQA 4WS9A 2P2BA 5BURA 2MM9A 2PN2A 3RG2A 4I9GA 1JOSA 1XHJA 4B3TC 4U5YD 1ZB8A 4XX2A 3S82A 1GPMA 4DV0C 1IB8A 4DV6C 3E7XA 1J5EC 1ML8A 4LF5C 1QM4A 2KDNA 1ULTA 4BC9A 4D57A 1O90A 3R44A 1IBMC 3A26A 1WF3A 1MD9A 5ADZA 1FJGC 5K8FA 3LUSA 5IFIA 4DR4C 3LNOA 2ZTBA 4DUZC 4JI6C 4ODJA 3EERA 1M6XA 5LCIA 1PG4A 4B3SC 3NPDA 5AE3A 4AQYC 1N36C 1AMUA 1QWIA 4RVOA 3VNRA 3I08A 1VLAA 1FLOA 3JAMD 5E7QA 4DV3C 3A25A 5JRHA 4B3RC 4DCVA 5AE1A 4KHPC 2EGTA 5FLXD 2JNVA 2DHMA 2UUCC 1XRCA 4ZJZA 4MH4A 4PUHA 4K0KC 4BBYA 2E8EA 3LGXA 3T1YC 2QW0X 4LF8C 1XNQC 1P4EA 3I07A 3TQIA 2D27A 5A1IA 1WH9A 1HNZC 2P2JA 4WV3A 4BSZA 1XMOC 4R1LA 5BSVA 4DR1C 5A1GA 4RMNA 3UEBA 2UU9C 4X65C 4DG8A 1K0RA 4IZ6A 2KZFA 2OBVA 3GR0A 2V7BA 3UOWA 2HHHC 3UX3A 4JI7C 5BUQA 4YY3C 4DV7C 2P2MA 3NYQA 4LFBC 3GR1A 1HR0C 4LF6C 3AY0A 2ZM6C 2Y4OA 3J7AD 2OPLB 3N54B 3VNQA 2D1TA 3CQ2A 4X64C 4DR7C 3A9VA 1VEHA 3CW9A 1M6XC 5KEIA 3H2TA 2ASBA 1IBLC 3PBKA 4DR6C 5BSWA 2Y4NA 4DG9A 5KYVA 3TDEA 1T5HX 4JM1A 3J80D 4DV5C 4JI8C 4BCAA 1UWDA 4TPSB 2YWBA 2KZ0A 4PUIA
chains in the Genus database with same CATH topology
1V25A 4PHTA 4L2ZA 4DR5C 1MDFA 3LNVA 4ZLPA 3EQ6A 4FUTA 1XRBA 1XNRC 1O92A 4JI5C 5CZXA 1YJ7A 3E7WA 3ETOA 5LMNC 4EATA 3PROC 3KXWA 5A19A 1USPA 1BA3A 2E8CA 3IPLA 4OYCA 1T5DX 3CJEA 4X66C 2JMPA 1O93A 5BUSA 2HJGA 3T1HC 2QVYX 3UZ0A 2P2QA 2P02A 1KKGA 1FUGA 4JV5C 3TUFA 3DHVA 1PA4A 5KYTA 4DV4C 3DAYA 1N32C 4X62C 4DV2C 4LF9C 3FCCA 2BJOA 5BSRA 4NXMC 1P7LA 2P2FA 1LCIA 2ONFA 4JI0C 3A4IA 5LMUC 3CW8X 3FCEA 4DR2C 2P20A 2UUBC 4OX9C 3IEVA 2QVZX 4NXNC 3AF5A 2F4VC 1UKKA 3C5EA 4D4GA 2Y27A 3IMLA 1L2FA 5T8SA 3L95X 3GKUA 1MKYA 5AE2A 4DV1C 4G1IA 4B3MC 1HH2P 1NYEA 2PROA 4L4QA 2PT7G 3N2QA 4YHHC 4DR3C 4PROC 4MTNA 4RM2A 3R9XA 2D1RA 4JI3C 5BSUA 4KTVA 5BSMA 4LF4C 4K0BA 1IBKC 3SO4A 3LAXA 4DCTA 2D1SA 5IWAC 3AF6A 4BC7A 1XMQC 4D4IA 2E5LC 4JI2C 1HNWC 4G36A 4GXRA 4JYAC 2OO4A 1PG3A 1RY2A 4DCUA 2D7VA 4HPVA 2VQEC 3DLPX 2WD9A 4DCSA 5K85A 1N2FA 4R0MA 3IEUA 4JI4C 2VQFC 4RVNA 1ZB9A 2AYAA 3B7WA 2CXCA 1HNXC 2E0GA 4KTTA 5IT9D 5BSTA 1XRAA 2UUAC 4FUQA 4LFCC 4I9FA 4LFAC 1MXCA 3PESA 5DV9A 5H9UA 2ATWA 3G7SA 5CZVA 1O9TA 2E7GA 2D1QA 2YWCA 5T8TA 4GKKC 2UXDC 4NOZA 2UXBC 2QVXX 4RM3A 3GPCA 4D56A 5A2QD 3NYRA 4LF7C 2D28C 1I94C 3ETCA 4GS5A 4L7IA 1LQLA 1MXAA 1N33C 4IR7A 2UXCC 3A9UA 4R1MA 2BH1X 1USPB 4ISBA 2YCBA 4G37A 4RLFA 1MXBA 1V26A 2VSQA 3VNSA 4GKJC 2OPLA 3L8CA 1MDBA 2QL8A 3J81D 2CY1A 3R9WA 5GTDA 4FTFA 4LE5A 1RG9A 2XR1A 1EGAA 2VZEA 4PZPA 4DUYC 3RV2A 4GXQA 3NI2A 3OTOC 4JI1C 4NDNA 5BR8C 2E8FA 4OXIA 2WP0C 2DPLA 1N34C 2DYJA 4RLQA 4WS9A 2P2BA 5BURA 2PN2A 3RG2A 4I9GA 1JOSA 4B3TC 4U5YD 1ZB8A 4XX2A 3S82A 1GPMA 4DV0C 4DV6C 3E7XA 1J5EC 1ML8A 4LF5C 1QM4A 1ULTA 4BC9A 4D57A 1O90A 3R44A 1IBMC 1WF3A 1MD9A 5ADZA 1FJGC 5K8FA 3LUSA 5IFIA 4DR4C 4DUZC 4JI6C 4ODJA 3EERA 1PG4A 4B3SC 3NPDA 5AE3A 4AQYC 1N36C 1AMUA 1QWIA 4RVOA 3VNRA 3I08A 1VLAA 3JAMD 5E7QA 4DV3C 5JRHA 4B3RC 4DCVA 5AE1A 4KHPC 2EGTA 5FLXD 2UUCC 1XRCA 4ZJZA 4MH4A 4K0KC 4BBYA 2E8EA 3LGXA 3T1YC 2QW0X 4LF8C 1XNQC 3I07A 3TQIA 2D27A 5A1IA 1WH9A 1HNZC 2P2JA 4WV3A 4BSZA 1XMOC 4R1LA 5BSVA 4DR1C 5A1GA 4RMNA 2UU9C 4X65C 4DG8A 1K0RA 4IZ6A 2KZFA 2OBVA 3GR0A 2V7BA 3UOWA 2HHHC 4JI7C 5BUQA 4YY3C 4DV7C 2P2MA 3NYQA 4LFBC 3GR1A 1HR0C 4LF6C 2ZM6C 2Y4OA 3J7AD 2OPLB 3N54B 3VNQA 2D1TA 4X64C 4DR7C 3A9VA 3CW9A 5KEIA 3H2TA 2ASBA 1IBLC 3PBKA 4DR6C 5BSWA 2Y4NA 4DG9A 5KYVA 1T5HX 3TDEA 4JM1A 3J80D 4DV5C 4JI8C 4BCAA 4TPSB 2YWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPL A;  4DR5 C;  4DCV A;  4LF4 C;  4B3R C;  1IBK C;  4DCT A;  5IWA C;  3AF6 A;  1XMQ C;  2QL8 A;  2E5L C;  1XNR C;  3J81 D;  4KHP C;  4JI5 C;  2EGT A;  2CY1 A;  4JI2 C;  5LMN C;  5FLX D;  3R9W A;  1HNW C;  2UUC C;  4JYA C;  4MH4 A;  4DV3 C;  1USP A;  4K0K C;  2D7V A;  4DCU A;  2E8C A;  2VQE C;  2E8E A;  2XR1 A;  3T1Y C;  3CJE A;  4X66 C;  1EGA A;  4DUY C;  2JMP A;  4DCS A;  4JI1 C;  3OTO C;  4LF8 C;  1N2F A;  1XNQ C;  3IEU A;  3I07 A;  5BR8 C;  2E8F A;  1WH9 A;  2HJG A;  4JI4 C;  3T1H C;  1HNZ C;  2VQF C;  1ZB9 A;  1KKG A;  4BSZ A;  4JV5 C;  1XMO C;  1N34 C;  2DYJ A;  4DR1 C;  1PA4 A;  4DV4 C;  2CXC A;  1HNX C;  2UU9 C;  1N32 C;  4X62 C;  4X65 C;  4DV2 C;  4LF9 C;  2BJO A;  2PN2 A;  5IT9 D;  2KZF A;  4NXM C;  2ONF A;  2HHH C;  4JI0 C;  2UUA C;  5LMU C;  4JI7 C;  4LFC C;  4LFA C;  1JOS A;  4B3T C;  4DR2 C;  4YY3 C;  4DV7 C;  1ZB8 A;  4XX2 A;  2ATW A;  4LFB C;  4DV0 C;  4DV6 C;  2E7G A;  1J5E C;  2UUB C;  1ML8 A;  1HR0 C;  4LF5 C;  4LF6 C;  2ZM6 C;  4OX9 C;  3IEV A;  4GKK C;  2UXD C;  4NOZ A;  1IBM C;  2UXB C;  4NXN C;  3J7A D;  5A2Q D;  3AF5 A;  2F4V C;  2OPL B;  4LF7 C;  1WF3 A;  1UKK A;  1FJG C;  1I94 C;  4X64 C;  4DR7 C;  3LUS A;  1LQL A;  1N33 C;  1L2F A;  2UXC C;  4DR4 C;  2ASB A;  1IBL C;  3GKU A;  1USP B;  2YCB A;  4DUZ C;  4JI6 C;  3EER A;  1MKY A;  4DR6 C;  4DV1 C;  4B3S C;  1N36 C;  1HH2 P;  1NYE A;  4AQY C;  1QWI A;  4B3M C;  2PT7 G;  4YHH C;  3J80 D;  4DV5 C;  4DR3 C;  1VLA A;  4JI8 C;  4MTN A;  3JAM D;  3R9X A;  1K0R A;  4GKJ C;  4JI3 C; 
#chains in the Genus database with same CATH topology
 2M5H A;  1V25 A;  4PHT A;  4L2Z A;  4DR5 C;  1MDF A;  3LNV A;  4ZLP A;  3EQ6 A;  4FUT A;  1XRB A;  1XNR C;  1O92 A;  4JI5 C;  5CZX A;  1WCJ A;  1YJ7 A;  3E7W A;  3ETO A;  5LMN C;  4EAT A;  3PRO C;  3KXW A;  1P4E C;  5A19 A;  1USP A;  1BA3 A;  2E8C A;  3IPL A;  4OYC A;  1T5D X;  3CJE A;  4X66 C;  2JMP A;  1O93 A;  5BUS A;  2HJG A;  3T1H C;  2QVY X;  3UZ0 A;  2P2Q A;  2P02 A;  1KKG A;  1FUG A;  4JV5 C;  3TUF A;  3DHV A;  1PA4 A;  5KYT A;  4DV4 C;  3DAY A;  1N32 C;  4X62 C;  4DV2 C;  4LF9 C;  3FCC A;  2BJO A;  5BSR A;  4NXM C;  1P7L A;  2P2F A;  1LCI A;  2ONF A;  4JI0 C;  3A4I A;  5LMU C;  3CW8 X;  3FCE A;  4DR2 C;  2P20 A;  1V60 A;  3CQ1 A;  2UUB C;  3UX2 A;  4OX9 C;  3IEV A;  2QVZ X;  3TR3 A;  4NXN C;  3AF5 A;  2F4V C;  1UKK A;  3C5E A;  4D4G A;  2Y27 A;  2MCQ A;  3IML A;  1L2F A;  5T8S A;  3L95 X;  2MMA B;  3GKU A;  1YGT A;  1MKY A;  5AE2 A;  4DV1 C;  4G1I A;  4B3M C;  1HH2 P;  1NYE A;  2PRO A;  4L4Q A;  2Z51 A;  2PT7 G;  3N2Q A;  4YHH C;  4DR3 C;  4PRO C;  4MTN A;  4RM2 A;  3R9X A;  2D1R A;  4JI3 C;  5BSU A;  4KTV A;  5BSM A;  4LF4 C;  4K0B A;  1IBK C;  2PG1 E;  3SO4 A;  3LAX A;  4DCT A;  2D1S A;  5IWA C;  3AF6 A;  4BC7 A;  1XMQ C;  4D4I A;  2E5L C;  4JI2 C;  2M5O A;  1HNW C;  4G36 A;  2ZZN A;  4GXR A;  4JYA C;  2YX1 A;  2OO4 A;  1PG3 A;  1RY2 A;  4DCU A;  2D7V A;  4HPV A;  2VQE C;  3DLP X;  2WD9 A;  4DCS A;  5K85 A;  3O2E A;  1N2F A;  4R0M A;  3IEU A;  4JI4 C;  2VQF C;  4RVN A;  1ZB9 A;  2AYA A;  3B7W A;  2CXC A;  1HNX C;  2E0G A;  4KTT A;  5IT9 D;  5BST A;  1XRA A;  2UUA C;  4FUQ A;  4LFC C;  4I9F A;  4LFA C;  1MXC A;  3PES A;  5DV9 A;  5H9U A;  1XS3 A;  2ATW A;  3G7S A;  5CZV A;  1O9T A;  2E7G A;  2D1Q A;  2YWC A;  5T8T A;  4GKK C;  2UXD C;  4NOZ A;  2UXB C;  2QVX X;  4RM3 A;  3GPC A;  4D56 A;  5A2Q D;  3NYR A;  4LF7 C;  2D28 C;  1I94 C;  3ETC A;  1PU1 A;  4GS5 A;  1NY8 A;  4L7I A;  3FM7 A;  1LQL A;  1MXA A;  1N33 C;  3CQ3 A;  4IR7 A;  2UXC C;  3A9U A;  4R1M A;  2BH1 X;  1USP B;  4ISB A;  2NCL A;  2YCB A;  4G37 A;  4RLF A;  1MXB A;  1V26 A;  2VSQ A;  3VNS A;  4GKJ C;  2OPL A;  1TH5 A;  3L8C A;  1MDB A;  1XDX A;  2QL8 A;  3J81 D;  2CY1 A;  3R9W A;  3K6R A;  5GTD A;  4FTF A;  4LE5 A;  1RG9 A;  2CU6 A;  4PUG A;  2XR1 A;  1EGA A;  2VZE A;  4PZP A;  4DUY C;  3RV2 A;  4GXQ A;  3NI2 A;  3OTO C;  4JI1 C;  4NDN A;  5BR8 C;  2E8F A;  4OXI A;  2WP0 C;  2ZZM A;  2DPL A;  1N34 C;  2DYJ A;  4RLQ A;  4WS9 A;  2P2B A;  5BUR A;  2MM9 A;  2PN2 A;  3RG2 A;  4I9G A;  1JOS A;  1XHJ A;  4B3T C;  4U5Y D;  1ZB8 A;  4XX2 A;  3S82 A;  1GPM A;  4DV0 C;  1IB8 A;  4DV6 C;  3E7X A;  1J5E C;  1ML8 A;  4LF5 C;  1QM4 A;  2KDN A;  1ULT A;  4BC9 A;  4D57 A;  1O90 A;  3R44 A;  1IBM C;  3A26 A;  1WF3 A;  1MD9 A;  5ADZ A;  1FJG C;  5K8F A;  3LUS A;  5IFI A;  4DR4 C;  3LNO A;  2ZTB A;  4DUZ C;  4JI6 C;  4ODJ A;  3EER A;  1M6X A;  5LCI A;  1PG4 A;  4B3S C;  3NPD A;  5AE3 A;  4AQY C;  1N36 C;  1AMU A;  1QWI A;  4RVO A;  3VNR A;  3I08 A;  1VLA A;  1FLO A;  3JAM D;  5E7Q A;  4DV3 C;  3A25 A;  5JRH A;  4B3R C;  4DCV A;  5AE1 A;  4KHP C;  2EGT A;  5FLX D;  2JNV A;  2DHM A;  2UUC C;  1XRC A;  4ZJZ A;  4MH4 A;  4PUH A;  4K0K C;  4BBY A;  2E8E A;  3LGX A;  3T1Y C;  2QW0 X;  4LF8 C;  1XNQ C;  1P4E A;  3I07 A;  3TQI A;  2D27 A;  5A1I A;  1WH9 A;  1HNZ C;  2P2J A;  4WV3 A;  4BSZ A;  1XMO C;  4R1L A;  5BSV A;  4DR1 C;  5A1G A;  4RMN A;  3UEB A;  2UU9 C;  4X65 C;  4DG8 A;  1K0R A;  4IZ6 A;  2KZF A;  2OBV A;  3GR0 A;  2V7B A;  3UOW A;  2HHH C;  3UX3 A;  4JI7 C;  5BUQ A;  4YY3 C;  4DV7 C;  2P2M A;  3NYQ A;  4LFB C;  3GR1 A;  1HR0 C;  4LF6 C;  3AY0 A;  2ZM6 C;  2Y4O A;  3J7A D;  2OPL B;  3N54 B;  3VNQ A;  2D1T A;  3CQ2 A;  4X64 C;  4DR7 C;  3A9V A;  1VEH A;  3CW9 A;  1M6X C;  5KEI A;  3H2T A;  2ASB A;  1IBL C;  3PBK A;  4DR6 C;  5BSW A;  2Y4N A;  4DG9 A;  5KYV A;  3TDE A;  1T5H X;  4JM1 A;  3J80 D;  4DV5 C;  4JI8 C;  4BCA A;  1UWD A;  4TPS B;  2YWB A;  2KZ0 A;  4PUI A; 
#chains in the Genus database with same CATH homology
 1V25 A;  4PHT A;  4L2Z A;  4DR5 C;  1MDF A;  3LNV A;  4ZLP A;  3EQ6 A;  4FUT A;  1XRB A;  1XNR C;  1O92 A;  4JI5 C;  5CZX A;  1YJ7 A;  3E7W A;  3ETO A;  5LMN C;  4EAT A;  3PRO C;  3KXW A;  5A19 A;  1USP A;  1BA3 A;  2E8C A;  3IPL A;  4OYC A;  1T5D X;  3CJE A;  4X66 C;  2JMP A;  1O93 A;  5BUS A;  2HJG A;  3T1H C;  2QVY X;  3UZ0 A;  2P2Q A;  2P02 A;  1KKG A;  1FUG A;  4JV5 C;  3TUF A;  3DHV A;  1PA4 A;  5KYT A;  4DV4 C;  3DAY A;  1N32 C;  4X62 C;  4DV2 C;  4LF9 C;  3FCC A;  2BJO A;  5BSR A;  4NXM C;  1P7L A;  2P2F A;  1LCI A;  2ONF A;  4JI0 C;  3A4I A;  5LMU C;  3CW8 X;  3FCE A;  4DR2 C;  2P20 A;  2UUB C;  4OX9 C;  3IEV A;  2QVZ X;  4NXN C;  3AF5 A;  2F4V C;  1UKK A;  3C5E A;  4D4G A;  2Y27 A;  3IML A;  1L2F A;  5T8S A;  3L95 X;  3GKU A;  1MKY A;  5AE2 A;  4DV1 C;  4G1I A;  4B3M C;  1HH2 P;  1NYE A;  2PRO A;  4L4Q A;  2PT7 G;  3N2Q A;  4YHH C;  4DR3 C;  4PRO C;  4MTN A;  4RM2 A;  3R9X A;  2D1R A;  4JI3 C;  5BSU A;  4KTV A;  5BSM A;  4LF4 C;  4K0B A;  1IBK C;  3SO4 A;  3LAX A;  4DCT A;  2D1S A;  5IWA C;  3AF6 A;  4BC7 A;  1XMQ C;  4D4I A;  2E5L C;  4JI2 C;  1HNW C;  4G36 A;  4GXR A;  4JYA C;  2OO4 A;  1PG3 A;  1RY2 A;  4DCU A;  2D7V A;  4HPV A;  2VQE C;  3DLP X;  2WD9 A;  4DCS A;  5K85 A;  1N2F A;  4R0M A;  3IEU A;  4JI4 C;  2VQF C;  4RVN A;  1ZB9 A;  2AYA A;  3B7W A;  2CXC A;  1HNX C;  2E0G A;  4KTT A;  5IT9 D;  5BST A;  1XRA A;  2UUA C;  4FUQ A;  4LFC C;  4I9F A;  4LFA C;  1MXC A;  3PES A;  5DV9 A;  5H9U A;  2ATW A;  3G7S A;  5CZV A;  1O9T A;  2E7G A;  2D1Q A;  2YWC A;  5T8T A;  4GKK C;  2UXD C;  4NOZ A;  2UXB C;  2QVX X;  4RM3 A;  3GPC A;  4D56 A;  5A2Q D;  3NYR A;  4LF7 C;  2D28 C;  1I94 C;  3ETC A;  4GS5 A;  4L7I A;  1LQL A;  1MXA A;  1N33 C;  4IR7 A;  2UXC C;  3A9U A;  4R1M A;  2BH1 X;  1USP B;  4ISB A;  2YCB A;  4G37 A;  4RLF A;  1MXB A;  1V26 A;  2VSQ A;  3VNS A;  4GKJ C;  2OPL A;  3L8C A;  1MDB A;  2QL8 A;  3J81 D;  2CY1 A;  3R9W A;  5GTD A;  4FTF A;  4LE5 A;  1RG9 A;  2XR1 A;  1EGA A;  2VZE A;  4PZP A;  4DUY C;  3RV2 A;  4GXQ A;  3NI2 A;  3OTO C;  4JI1 C;  4NDN A;  5BR8 C;  2E8F A;  4OXI A;  2WP0 C;  2DPL A;  1N34 C;  2DYJ A;  4RLQ A;  4WS9 A;  2P2B A;  5BUR A;  2PN2 A;  3RG2 A;  4I9G A;  1JOS A;  4B3T C;  4U5Y D;  1ZB8 A;  4XX2 A;  3S82 A;  1GPM A;  4DV0 C;  4DV6 C;  3E7X A;  1J5E C;  1ML8 A;  4LF5 C;  1QM4 A;  1ULT A;  4BC9 A;  4D57 A;  1O90 A;  3R44 A;  1IBM C;  1WF3 A;  1MD9 A;  5ADZ A;  1FJG C;  5K8F A;  3LUS A;  5IFI A;  4DR4 C;  4DUZ C;  4JI6 C;  4ODJ A;  3EER A;  1PG4 A;  4B3S C;  3NPD A;  5AE3 A;  4AQY C;  1N36 C;  1AMU A;  1QWI A;  4RVO A;  3VNR A;  3I08 A;  1VLA A;  3JAM D;  5E7Q A;  4DV3 C;  5JRH A;  4B3R C;  4DCV A;  5AE1 A;  4KHP C;  2EGT A;  5FLX D;  2UUC C;  1XRC A;  4ZJZ A;  4MH4 A;  4K0K C;  4BBY A;  2E8E A;  3LGX A;  3T1Y C;  2QW0 X;  4LF8 C;  1XNQ C;  3I07 A;  3TQI A;  2D27 A;  5A1I A;  1WH9 A;  1HNZ C;  2P2J A;  4WV3 A;  4BSZ A;  1XMO C;  4R1L A;  5BSV A;  4DR1 C;  5A1G A;  4RMN A;  2UU9 C;  4X65 C;  4DG8 A;  1K0R A;  4IZ6 A;  2KZF A;  2OBV A;  3GR0 A;  2V7B A;  3UOW A;  2HHH C;  4JI7 C;  5BUQ A;  4YY3 C;  4DV7 C;  2P2M A;  3NYQ A;  4LFB C;  3GR1 A;  1HR0 C;  4LF6 C;  2ZM6 C;  2Y4O A;  3J7A D;  2OPL B;  3N54 B;  3VNQ A;  2D1T A;  4X64 C;  4DR7 C;  3A9V A;  3CW9 A;  5KEI A;  3H2T A;  2ASB A;  1IBL C;  3PBK A;  4DR6 C;  5BSW A;  2Y4N A;  4DG9 A;  5KYV A;  1T5H X;  3TDE A;  4JM1 A;  3J80 D;  4DV5 C;  4JI8 C;  4BCA A;  4TPS B;  2YWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...