2UXCC

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 40
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uxcC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uxcC02
2ASBA 4LFAC 2E8FA 4B3RC 4DV7C 5FLXD 4DR2C 4YHHC 4JYAC 4JI1C 4LFBC 2PN2A 4JI7C 1L2FA 1N2FA 2BJOA 2OPLB 3J80D 2VQEC 3JAMD 1N34C 4JV5C 3IEVA 4DV4C 2D7VA 1HNXC 4MTNA 4OX9C 2F4VC 2E8CA 4NXNC 2UXDC 1VLAA 1XNQC 4LF7C 4LF8C 2KZFA 2YCBA 4B3SC 2UXCC 4X64C 1HNZC 1PA4A 4K0KC 2CXCA 4YY3C 4DR7C 1XNRC 5LMNC 1WH9A 4DV6C 4DCVA 1USPB 5IWAC 4DV1C 4DCTA 2ZM6C 1NYEA 4JI8C 3R9XA 1N32C 2UUAC 4DR1C 4X66C 3EERA 2XR1A 1MKYA 4DV3C 2UUCC 4JI5C 4DCSA 2ATWA 1JOSA 3OTOC 4DUZC 2PT7G 3R9WA 3J81D 2EGTA 1N36C 3IEUA 4LF6C 5A2QD 4DV2C 3AF5A 4LF4C 1ZB8A 1N33C 1ML8A 3CJEA 1I94C 1J5EC 4LFCC 5BR8C 4AQYC 4MH4A 1QWIA 4JI4C 4GKKC 4X62C 3LUSA 1XMOC 4KHPC 3J7AD 4DR3C 2CY1A 2DYJA 4DR5C 1IBKC 2QL8A 4X65C 4JI2C 2UXBC 5IT9D 1EGAA 1IBLC 4NXMC 5LMUC 2UU9C 4DUYC 1USPA 2HHHC 1ZB9A 2JMPA 1IBMC 2VQFC 4B3MC 2UUBC 4DV5C 2E8EA 4JI0C 4DR6C 2ONFA 1XMQC 4NOZA 1FJGC 4JI6C 4B3TC 4XX2A 4DV0C 1LQLA 4DR4C 3I07A 4DCUA 1HR0C 4GKJC 2OPLA 3T1HC 3T1YC 2E5LC 4BSZA 4LF9C 4JI3C 4LF5C 3GKUA 3AF6A 2HJGA 1HH2P 1HNWC 1UKKA 1K0RA 2E7GA 1WF3A 1KKGA
chains in the Genus database with same CATH superfamily
2E8FA 4LE5A 4D4IA 1YJ7A 1PU1A 2DHMA 3IEVA 4MTNA 2E8CA 3NYQA 2UXDC 1YGTA 3ETCA 2OBVA 2Z51A 2D28C 3A26A 4I9FA 4R0MA 3A9VA 2CXCA 1XNRC 2P20A 2DPLA 5LMNC 3NYRA 5BUSA 3NPDA 4D56A 2NCLA 3TUFA 5IFIA 3RV2A 4KTTA 4PUIA 3EQ6A 2YWBA 2UUCC 4D4GA 4JI5C 2ATWA 3FCCA 4TPSB 3N2QA 4DUZC 5K8FA 3O2EA 1O9TA 3GR0A 4OYCA 3K6RA 2M5HA 3A9UA 2MMAB 4JI4C 3SO4A 1XMOC 1UWDA 3G7SA 4DR5C 4JI2C 2D1TA 4RLQA 5IT9D 4PUGA 4DUYC 5BSUA 3IMLA 2KZ0A 4DV5C 4RM3A 4JI0C 1FJGC 4B3TC 4DCUA 3PBKA 3B7WA 2D1QA 1P4EC 4ZJZA 3AF6A 1HH2P 1HNWC 3LAXA 3VNSA 3NI2A 4U5YD 2BH1X 4KTVA 2P2JA 4DR2C 4NDNA 4RLFA 3TDEA 4JYAC 4JI1C 3CQ2A 3J80D 2PG1E 4GS5A 3JAMD 4JV5C 1XRAA 2D7VA 4OX9C 5T8SA 3DHVA 4GXQA 3UEBA 5K85A 3CQ3A 2YWCA 4RVOA 3UX3A 2UXCC 4X64C 1HNZC 1PA4A 4K0KC 4DR7C 3DLPX 5H9UA 1T5DX 3I08A 2MM9A 4I9GA 5BURA 1MXBA 2MCQA 1JOSA 5BSVA 5JRHA 2D1RA 1N36C 3CQ1A 4LF6C 2V7BA 5A2QD 2D27A 4DV2C 3A4IA 3AF5A 5KYVA 1IB8A 4WS9A 3E7WA 3CJEA 5CZVA 1I94C 5BR8C 1QWIA 1MXAA 3L8CA 3LGXA 3J7AD 2P2BA 1QM4A 2DYJA 2VSQA 5AE2A 2P2QA 1IBKC 4FUQA 4NXMC 5LMUC 2HHHC 1USPA 2UU9C 2JMPA 2ZZNA 1XRCA 4DR6C 1P7LA 5GTDA 1XMQC 3S82A 3UZ0A 3N54B 1VEHA 4JI6C 4DV0C 3I07A 1HR0C 3T1YC 2E5LC 4BCAA 1MXCA 2HJGA 2CU6A 3RG2A 1K0RA 2D1SA 3PESA 3KXWA 4B3RC 4R1LA 4YHHC 1MDBA 2PN2A 3TQIA 4JI7C 1L2FA 1N2FA 4DG9A 4DV4C 1XDXA 1VLAA 1XNQC 2P2FA 2KZFA 2YCBA 4B3SC 2QVXX 4K0BA 1FUGA 3IPLA 5BSTA 2Y27A 4DV6C 4DCVA 2ZTBA 4G36A 3E7XA 4DCTA 1NYEA 4JI8C 1N32C 3FCEA 2UUAC 1P4EA 4DR1C 3EERA 4PHTA 1GPMA 1RY2A 1AMUA 2PROA 1PG3A 3DAYA 1RG9A 3TR3A 1M6XA 3OTOC 4WV3A 3R9WA 3J81D 1BA3A 2EGTA 3CW8X 5E7QA 1ZB8A 4PZPA 2P02A 3R44A 1ML8A 1J5EC 2WP0C 4AQYC 4BBYA 2KDNA 4KHPC 3CW9A 5ADZA 2QW0X 2VZEA 2CY1A 1ULTA 4X65C 2UXBC 1EGAA 3A25A 1IBLC 1MDFA 1ZB9A 1IBMC 2VQFC 4B3MC 4RVNA 3LNOA 2E8EA 4BC7A 2ONFA 4R1MA 3L95X 4ODJA 2OPLA 3T1HC 4BSZA 5BUQA 1XRBA 4DG8A 4PUHA 4ZLPA 2Y4NA 4GKJC 1O93A 1TH5A 2ASBA 4LFAC 1O90A 4DV7C 5FLXD 4EATA 1MD9A 4LFBC 5T8TA 2OPLB 2BJOA 2VQEC 1N34C 4GXRA 1HNXC 2F4VC 4NXNC 1XS3A 4PROC 4LF7C 4LF8C 1T5HX 3GPCA 3GR1A 1FLOA 1LCIA 3H2TA 4YY3C 3VNRA 1WH9A 5A1GA 1M6XC 1USPB 5IWAC 4DV1C 3VNQA 4FTFA 2ZM6C 4JM1A 4BC9A 3R9XA 5BSMA 4X66C 5CZXA 2XR1A 2WD9A 1MKYA 4DV3C 4L4QA 2E0GA 3AY0A 4DCSA 5BSRA 4ISBA 3FM7A 1XHJA 2PT7G 3LNVA 2JNVA 5A19A 3IEUA 4G1IA 2M5OA 4LF4C 5DV9A 1N33C 5BSWA 5AE3A 2Y4OA 4LFCC 4L7IA 4MH4A 4IR7A 1NY8A 1V60A 4GKKC 4X62C 2P2MA 3LUSA 1V26A 4RMNA 4HPVA 1WCJA 4DR3C 2QVZX 2QL8A 4G37A 1V25A 5A1IA 3UOWA 2QVYX 4RM2A 2UUBC 4IZ6A 4NOZA 1PG4A 2OO4A 4OXIA 5KEIA 4XX2A 5AE1A 4L2ZA 4D57A 1LQLA 3PROC 3ETOA 4DR4C 1O92A 4FUTA 2YX1A 2ZZMA 3C5EA 4LF9C 2AYAA 4JI3C 3GKUA 4LF5C 3UX2A 5KYTA 1UKKA 5LCIA 2E7GA 1WF3A 1KKGA
chains in the Genus database with same CATH topology
2E8FA 4LE5A 4D4IA 1YJ7A 3IEVA 4MTNA 2E8CA 3NYQA 2UXDC 3ETCA 2OBVA 2D28C 4I9FA 4R0MA 3A9VA 2CXCA 1XNRC 2P20A 2DPLA 5LMNC 3NYRA 5BUSA 3NPDA 4D56A 3TUFA 5IFIA 3RV2A 4KTTA 3EQ6A 2YWBA 2UUCC 4D4GA 4JI5C 2ATWA 3FCCA 4TPSB 3N2QA 4DUZC 5K8FA 1O9TA 3GR0A 4OYCA 3A9UA 4JI4C 3SO4A 1XMOC 3G7SA 4DR5C 4JI2C 2D1TA 4RLQA 5IT9D 4DUYC 5BSUA 3IMLA 4DV5C 4RM3A 4JI0C 1FJGC 4B3TC 4DCUA 3PBKA 3B7WA 2D1QA 4ZJZA 3AF6A 1HH2P 1HNWC 3LAXA 3VNSA 3NI2A 4U5YD 2BH1X 4KTVA 2P2JA 4DR2C 4NDNA 4RLFA 3TDEA 4JYAC 4JI1C 3J80D 4GS5A 3JAMD 4JV5C 1XRAA 2D7VA 4OX9C 5T8SA 3DHVA 4GXQA 5K85A 2YWCA 4RVOA 2UXCC 4X64C 1HNZC 1PA4A 4K0KC 4DR7C 3DLPX 5H9UA 1T5DX 3I08A 4I9GA 5BURA 1MXBA 1JOSA 5BSVA 5JRHA 2D1RA 1N36C 4LF6C 2V7BA 5A2QD 2D27A 4DV2C 3A4IA 3AF5A 5KYVA 4WS9A 3E7WA 3CJEA 5CZVA 1I94C 5BR8C 1QWIA 1MXAA 3L8CA 3LGXA 3J7AD 2P2BA 1QM4A 2DYJA 2VSQA 5AE2A 2P2QA 1IBKC 4FUQA 2UU9C 4NXMC 5LMUC 1USPA 2HHHC 2JMPA 1XRCA 4DR6C 1P7LA 5GTDA 1XMQC 3S82A 3UZ0A 3N54B 4JI6C 4DV0C 3I07A 1HR0C 3T1YC 2E5LC 4BCAA 1MXCA 2HJGA 3RG2A 1K0RA 2D1SA 3PESA 3KXWA 4B3RC 4R1LA 4YHHC 1MDBA 2PN2A 3TQIA 4JI7C 1L2FA 1N2FA 4DG9A 4DV4C 1VLAA 1XNQC 2P2FA 2KZFA 2YCBA 4B3SC 2QVXX 4K0BA 1FUGA 3IPLA 5BSTA 2Y27A 4DV6C 4DCVA 4G36A 3E7XA 4DCTA 1NYEA 4JI8C 1N32C 3FCEA 2UUAC 4DR1C 3EERA 4PHTA 1GPMA 1RY2A 1AMUA 2PROA 1PG3A 3DAYA 1RG9A 3OTOC 4WV3A 3R9WA 3J81D 1BA3A 2EGTA 3CW8X 5E7QA 1ZB8A 4PZPA 2P02A 3R44A 1ML8A 1J5EC 2WP0C 4AQYC 4BBYA 4KHPC 3CW9A 5ADZA 2QW0X 2VZEA 2CY1A 1ULTA 4X65C 2UXBC 1EGAA 1IBLC 1MDFA 1ZB9A 1IBMC 2VQFC 4B3MC 4RVNA 2E8EA 4BC7A 2ONFA 4R1MA 3L95X 4ODJA 2OPLA 3T1HC 4BSZA 5BUQA 1XRBA 4DG8A 4ZLPA 2Y4NA 4GKJC 1O93A 2ASBA 4LFAC 1O90A 4DV7C 5FLXD 4EATA 1MD9A 4LFBC 5T8TA 2OPLB 2BJOA 2VQEC 1N34C 4GXRA 1HNXC 2F4VC 4NXNC 4PROC 4LF7C 4LF8C 1T5HX 3GPCA 3GR1A 1LCIA 3H2TA 4YY3C 3VNRA 1WH9A 5A1GA 1USPB 5IWAC 4DV1C 3VNQA 4FTFA 2ZM6C 4JM1A 4BC9A 3R9XA 5BSMA 4X66C 5CZXA 2XR1A 2WD9A 1MKYA 4DV3C 4L4QA 2E0GA 4DCSA 5BSRA 4ISBA 2PT7G 3LNVA 5A19A 3IEUA 4G1IA 4LF4C 5DV9A 1N33C 5BSWA 5AE3A 2Y4OA 4LFCC 4L7IA 4MH4A 4IR7A 4GKKC 4X62C 2P2MA 3LUSA 1V26A 4RMNA 4HPVA 4DR3C 2QVZX 2QL8A 4G37A 1V25A 5A1IA 3UOWA 2QVYX 4RM2A 2UUBC 4IZ6A 4NOZA 1PG4A 2OO4A 4OXIA 5KEIA 4XX2A 5AE1A 4L2ZA 4D57A 1LQLA 3PROC 3ETOA 4DR4C 1O92A 4FUTA 3C5EA 4LF9C 2AYAA 4LF5C 4JI3C 3GKUA 5KYTA 1UKKA 2E7GA 1WF3A 1KKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ASB A;  4LFA C;  2E8F A;  4B3R C;  4DV7 C;  5FLX D;  4DR2 C;  4YHH C;  4JYA C;  4JI1 C;  4LFB C;  2PN2 A;  4JI7 C;  1L2F A;  1N2F A;  2BJO A;  2OPL B;  3J80 D;  2VQE C;  3JAM D;  1N34 C;  4JV5 C;  3IEV A;  4DV4 C;  2D7V A;  1HNX C;  4MTN A;  4OX9 C;  2F4V C;  2E8C A;  4NXN C;  2UXD C;  1VLA A;  1XNQ C;  4LF7 C;  4LF8 C;  2KZF A;  2YCB A;  4B3S C;  2UXC C;  4X64 C;  1HNZ C;  1PA4 A;  4K0K C;  2CXC A;  4YY3 C;  4DR7 C;  1XNR C;  5LMN C;  1WH9 A;  4DV6 C;  4DCV A;  1USP B;  5IWA C;  4DV1 C;  4DCT A;  2ZM6 C;  1NYE A;  4JI8 C;  3R9X A;  1N32 C;  2UUA C;  4DR1 C;  4X66 C;  3EER A;  2XR1 A;  1MKY A;  4DV3 C;  2UUC C;  4JI5 C;  4DCS A;  2ATW A;  1JOS A;  3OTO C;  4DUZ C;  2PT7 G;  3R9W A;  3J81 D;  2EGT A;  1N36 C;  3IEU A;  4LF6 C;  5A2Q D;  4DV2 C;  3AF5 A;  4LF4 C;  1ZB8 A;  1N33 C;  1ML8 A;  3CJE A;  1I94 C;  1J5E C;  4LFC C;  5BR8 C;  4AQY C;  4MH4 A;  1QWI A;  4JI4 C;  4GKK C;  4X62 C;  3LUS A;  1XMO C;  4KHP C;  3J7A D;  4DR3 C;  2CY1 A;  2DYJ A;  4DR5 C;  1IBK C;  2QL8 A;  4X65 C;  4JI2 C;  2UXB C;  5IT9 D;  1EGA A;  1IBL C;  4NXM C;  5LMU C;  2UU9 C;  4DUY C;  1USP A;  2HHH C;  1ZB9 A;  2JMP A;  1IBM C;  2VQF C;  4B3M C;  2UUB C;  4DV5 C;  2E8E A;  4JI0 C;  4DR6 C;  2ONF A;  1XMQ C;  4NOZ A;  1FJG C;  4JI6 C;  4B3T C;  4XX2 A;  4DV0 C;  1LQL A;  4DR4 C;  3I07 A;  4DCU A;  1HR0 C;  4GKJ C;  2OPL A;  3T1H C;  3T1Y C;  2E5L C;  4BSZ A;  4LF9 C;  4JI3 C;  4LF5 C;  3GKU A;  3AF6 A;  2HJG A;  1HH2 P;  1HNW C;  1UKK A;  1K0R A;  2E7G A;  1WF3 A;  1KKG A; 
#chains in the Genus database with same CATH topology
 2E8F A;  4LE5 A;  4D4I A;  1YJ7 A;  1PU1 A;  2DHM A;  3IEV A;  4MTN A;  2E8C A;  3NYQ A;  2UXD C;  1YGT A;  3ETC A;  2OBV A;  2Z51 A;  2D28 C;  3A26 A;  4I9F A;  4R0M A;  3A9V A;  2CXC A;  1XNR C;  2P20 A;  2DPL A;  5LMN C;  3NYR A;  5BUS A;  3NPD A;  4D56 A;  2NCL A;  3TUF A;  5IFI A;  3RV2 A;  4KTT A;  4PUI A;  3EQ6 A;  2YWB A;  2UUC C;  4D4G A;  4JI5 C;  2ATW A;  3FCC A;  4TPS B;  3N2Q A;  4DUZ C;  5K8F A;  3O2E A;  1O9T A;  3GR0 A;  4OYC A;  3K6R A;  2M5H A;  3A9U A;  2MMA B;  4JI4 C;  3SO4 A;  1XMO C;  1UWD A;  3G7S A;  4DR5 C;  4JI2 C;  2D1T A;  4RLQ A;  5IT9 D;  4PUG A;  4DUY C;  5BSU A;  3IML A;  2KZ0 A;  4DV5 C;  4RM3 A;  4JI0 C;  1FJG C;  4B3T C;  4DCU A;  3PBK A;  3B7W A;  2D1Q A;  1P4E C;  4ZJZ A;  3AF6 A;  1HH2 P;  1HNW C;  3LAX A;  3VNS A;  3NI2 A;  4U5Y D;  2BH1 X;  4KTV A;  2P2J A;  4DR2 C;  4NDN A;  4RLF A;  3TDE A;  4JYA C;  4JI1 C;  3CQ2 A;  3J80 D;  2PG1 E;  4GS5 A;  3JAM D;  4JV5 C;  1XRA A;  2D7V A;  4OX9 C;  5T8S A;  3DHV A;  4GXQ A;  3UEB A;  5K85 A;  3CQ3 A;  2YWC A;  4RVO A;  3UX3 A;  2UXC C;  4X64 C;  1HNZ C;  1PA4 A;  4K0K C;  4DR7 C;  3DLP X;  5H9U A;  1T5D X;  3I08 A;  2MM9 A;  4I9G A;  5BUR A;  1MXB A;  2MCQ A;  1JOS A;  5BSV A;  5JRH A;  2D1R A;  1N36 C;  3CQ1 A;  4LF6 C;  2V7B A;  5A2Q D;  2D27 A;  4DV2 C;  3A4I A;  3AF5 A;  5KYV A;  1IB8 A;  4WS9 A;  3E7W A;  3CJE A;  5CZV A;  1I94 C;  5BR8 C;  1QWI A;  1MXA A;  3L8C A;  3LGX A;  3J7A D;  2P2B A;  1QM4 A;  2DYJ A;  2VSQ A;  5AE2 A;  2P2Q A;  1IBK C;  4FUQ A;  4NXM C;  5LMU C;  2HHH C;  1USP A;  2UU9 C;  2JMP A;  2ZZN A;  1XRC A;  4DR6 C;  1P7L A;  5GTD A;  1XMQ C;  3S82 A;  3UZ0 A;  3N54 B;  1VEH A;  4JI6 C;  4DV0 C;  3I07 A;  1HR0 C;  3T1Y C;  2E5L C;  4BCA A;  1MXC A;  2HJG A;  2CU6 A;  3RG2 A;  1K0R A;  2D1S A;  3PES A;  3KXW A;  4B3R C;  4R1L A;  4YHH C;  1MDB A;  2PN2 A;  3TQI A;  4JI7 C;  1L2F A;  1N2F A;  4DG9 A;  4DV4 C;  1XDX A;  1VLA A;  1XNQ C;  2P2F A;  2KZF A;  2YCB A;  4B3S C;  2QVX X;  4K0B A;  1FUG A;  3IPL A;  5BST A;  2Y27 A;  4DV6 C;  4DCV A;  2ZTB A;  4G36 A;  3E7X A;  4DCT A;  1NYE A;  4JI8 C;  1N32 C;  3FCE A;  2UUA C;  1P4E A;  4DR1 C;  3EER A;  4PHT A;  1GPM A;  1RY2 A;  1AMU A;  2PRO A;  1PG3 A;  3DAY A;  1RG9 A;  3TR3 A;  1M6X A;  3OTO C;  4WV3 A;  3R9W A;  3J81 D;  1BA3 A;  2EGT A;  3CW8 X;  5E7Q A;  1ZB8 A;  4PZP A;  2P02 A;  3R44 A;  1ML8 A;  1J5E C;  2WP0 C;  4AQY C;  4BBY A;  2KDN A;  4KHP C;  3CW9 A;  5ADZ A;  2QW0 X;  2VZE A;  2CY1 A;  1ULT A;  4X65 C;  2UXB C;  1EGA A;  3A25 A;  1IBL C;  1MDF A;  1ZB9 A;  1IBM C;  2VQF C;  4B3M C;  4RVN A;  3LNO A;  2E8E A;  4BC7 A;  2ONF A;  4R1M A;  3L95 X;  4ODJ A;  2OPL A;  3T1H C;  4BSZ A;  5BUQ A;  1XRB A;  4DG8 A;  4PUH A;  4ZLP A;  2Y4N A;  4GKJ C;  1O93 A;  1TH5 A;  2ASB A;  4LFA C;  1O90 A;  4DV7 C;  5FLX D;  4EAT A;  1MD9 A;  4LFB C;  5T8T A;  2OPL B;  2BJO A;  2VQE C;  1N34 C;  4GXR A;  1HNX C;  2F4V C;  4NXN C;  1XS3 A;  4PRO C;  4LF7 C;  4LF8 C;  1T5H X;  3GPC A;  3GR1 A;  1FLO A;  1LCI A;  3H2T A;  4YY3 C;  3VNR A;  1WH9 A;  5A1G A;  1M6X C;  1USP B;  5IWA C;  4DV1 C;  3VNQ A;  4FTF A;  2ZM6 C;  4JM1 A;  4BC9 A;  3R9X A;  5BSM A;  4X66 C;  5CZX A;  2XR1 A;  2WD9 A;  1MKY A;  4DV3 C;  4L4Q A;  2E0G A;  3AY0 A;  4DCS A;  5BSR A;  4ISB A;  3FM7 A;  1XHJ A;  2PT7 G;  3LNV A;  2JNV A;  5A19 A;  3IEU A;  4G1I A;  2M5O A;  4LF4 C;  5DV9 A;  1N33 C;  5BSW A;  5AE3 A;  2Y4O A;  4LFC C;  4L7I A;  4MH4 A;  4IR7 A;  1NY8 A;  1V60 A;  4GKK C;  4X62 C;  2P2M A;  3LUS A;  1V26 A;  4RMN A;  4HPV A;  1WCJ A;  4DR3 C;  2QVZ X;  2QL8 A;  4G37 A;  1V25 A;  5A1I A;  3UOW A;  2QVY X;  4RM2 A;  2UUB C;  4IZ6 A;  4NOZ A;  1PG4 A;  2OO4 A;  4OXI A;  5KEI A;  4XX2 A;  5AE1 A;  4L2Z A;  4D57 A;  1LQL A;  3PRO C;  3ETO A;  4DR4 C;  1O92 A;  4FUT A;  2YX1 A;  2ZZM A;  3C5E A;  4LF9 C;  2AYA A;  4JI3 C;  3GKU A;  4LF5 C;  3UX2 A;  5KYT A;  1UKK A;  5LCI A;  2E7G A;  1WF3 A;  1KKG A; 
#chains in the Genus database with same CATH homology
 2E8F A;  4LE5 A;  4D4I A;  1YJ7 A;  3IEV A;  4MTN A;  2E8C A;  3NYQ A;  2UXD C;  3ETC A;  2OBV A;  2D28 C;  4I9F A;  4R0M A;  3A9V A;  2CXC A;  1XNR C;  2P20 A;  2DPL A;  5LMN C;  3NYR A;  5BUS A;  3NPD A;  4D56 A;  3TUF A;  5IFI A;  3RV2 A;  4KTT A;  3EQ6 A;  2YWB A;  2UUC C;  4D4G A;  4JI5 C;  2ATW A;  3FCC A;  4TPS B;  3N2Q A;  4DUZ C;  5K8F A;  1O9T A;  3GR0 A;  4OYC A;  3A9U A;  4JI4 C;  3SO4 A;  1XMO C;  3G7S A;  4DR5 C;  4JI2 C;  2D1T A;  4RLQ A;  5IT9 D;  4DUY C;  5BSU A;  3IML A;  4DV5 C;  4RM3 A;  4JI0 C;  1FJG C;  4B3T C;  4DCU A;  3PBK A;  3B7W A;  2D1Q A;  4ZJZ A;  3AF6 A;  1HH2 P;  1HNW C;  3LAX A;  3VNS A;  3NI2 A;  4U5Y D;  2BH1 X;  4KTV A;  2P2J A;  4DR2 C;  4NDN A;  4RLF A;  3TDE A;  4JYA C;  4JI1 C;  3J80 D;  4GS5 A;  3JAM D;  4JV5 C;  1XRA A;  2D7V A;  4OX9 C;  5T8S A;  3DHV A;  4GXQ A;  5K85 A;  2YWC A;  4RVO A;  2UXC C;  4X64 C;  1HNZ C;  1PA4 A;  4K0K C;  4DR7 C;  3DLP X;  5H9U A;  1T5D X;  3I08 A;  4I9G A;  5BUR A;  1MXB A;  1JOS A;  5BSV A;  5JRH A;  2D1R A;  1N36 C;  4LF6 C;  2V7B A;  5A2Q D;  2D27 A;  4DV2 C;  3A4I A;  3AF5 A;  5KYV A;  4WS9 A;  3E7W A;  3CJE A;  5CZV A;  1I94 C;  5BR8 C;  1QWI A;  1MXA A;  3L8C A;  3LGX A;  3J7A D;  2P2B A;  1QM4 A;  2DYJ A;  2VSQ A;  5AE2 A;  2P2Q A;  1IBK C;  4FUQ A;  2UU9 C;  4NXM C;  5LMU C;  1USP A;  2HHH C;  2JMP A;  1XRC A;  4DR6 C;  1P7L A;  5GTD A;  1XMQ C;  3S82 A;  3UZ0 A;  3N54 B;  4JI6 C;  4DV0 C;  3I07 A;  1HR0 C;  3T1Y C;  2E5L C;  4BCA A;  1MXC A;  2HJG A;  3RG2 A;  1K0R A;  2D1S A;  3PES A;  3KXW A;  4B3R C;  4R1L A;  4YHH C;  1MDB A;  2PN2 A;  3TQI A;  4JI7 C;  1L2F A;  1N2F A;  4DG9 A;  4DV4 C;  1VLA A;  1XNQ C;  2P2F A;  2KZF A;  2YCB A;  4B3S C;  2QVX X;  4K0B A;  1FUG A;  3IPL A;  5BST A;  2Y27 A;  4DV6 C;  4DCV A;  4G36 A;  3E7X A;  4DCT A;  1NYE A;  4JI8 C;  1N32 C;  3FCE A;  2UUA C;  4DR1 C;  3EER A;  4PHT A;  1GPM A;  1RY2 A;  1AMU A;  2PRO A;  1PG3 A;  3DAY A;  1RG9 A;  3OTO C;  4WV3 A;  3R9W A;  3J81 D;  1BA3 A;  2EGT A;  3CW8 X;  5E7Q A;  1ZB8 A;  4PZP A;  2P02 A;  3R44 A;  1ML8 A;  1J5E C;  2WP0 C;  4AQY C;  4BBY A;  4KHP C;  3CW9 A;  5ADZ A;  2QW0 X;  2VZE A;  2CY1 A;  1ULT A;  4X65 C;  2UXB C;  1EGA A;  1IBL C;  1MDF A;  1ZB9 A;  1IBM C;  2VQF C;  4B3M C;  4RVN A;  2E8E A;  4BC7 A;  2ONF A;  4R1M A;  3L95 X;  4ODJ A;  2OPL A;  3T1H C;  4BSZ A;  5BUQ A;  1XRB A;  4DG8 A;  4ZLP A;  2Y4N A;  4GKJ C;  1O93 A;  2ASB A;  4LFA C;  1O90 A;  4DV7 C;  5FLX D;  4EAT A;  1MD9 A;  4LFB C;  5T8T A;  2OPL B;  2BJO A;  2VQE C;  1N34 C;  4GXR A;  1HNX C;  2F4V C;  4NXN C;  4PRO C;  4LF7 C;  4LF8 C;  1T5H X;  3GPC A;  3GR1 A;  1LCI A;  3H2T A;  4YY3 C;  3VNR A;  1WH9 A;  5A1G A;  1USP B;  5IWA C;  4DV1 C;  3VNQ A;  4FTF A;  2ZM6 C;  4JM1 A;  4BC9 A;  3R9X A;  5BSM A;  4X66 C;  5CZX A;  2XR1 A;  2WD9 A;  1MKY A;  4DV3 C;  4L4Q A;  2E0G A;  4DCS A;  5BSR A;  4ISB A;  2PT7 G;  3LNV A;  5A19 A;  3IEU A;  4G1I A;  4LF4 C;  5DV9 A;  1N33 C;  5BSW A;  5AE3 A;  2Y4O A;  4LFC C;  4L7I A;  4MH4 A;  4IR7 A;  4GKK C;  4X62 C;  2P2M A;  3LUS A;  1V26 A;  4RMN A;  4HPV A;  4DR3 C;  2QVZ X;  2QL8 A;  4G37 A;  1V25 A;  5A1I A;  3UOW A;  2QVY X;  4RM2 A;  2UUB C;  4IZ6 A;  4NOZ A;  1PG4 A;  2OO4 A;  4OXI A;  5KEI A;  4XX2 A;  5AE1 A;  4L2Z A;  4D57 A;  1LQL A;  3PRO C;  3ETO A;  4DR4 C;  1O92 A;  4FUT A;  3C5E A;  4LF9 C;  2AYA A;  4LF5 C;  4JI3 C;  3GKU A;  5KYT A;  1UKK A;  2E7G A;  1WF3 A;  1KKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...