2UXCC

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 40
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uxcC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uxcC02
4LF7C 4MTNA 4MH4A 2YCBA 1USPA 3J7AD 4JI2C 2BJOA 4K0KC 2QL8A 4OX9C 3EERA 3J80D 4JI0C 2UU9C 1XMOC 4JYAC 2UXCC 1N34C 1USPB 4JI3C 4JI8C 2PN2A 1IBKC 1XNRC 4NOZA 5LMNC 5FLXD 4DV4C 3CJEA 2ONFA 4DV7C 4LF6C 4DV0C 2ATWA 4JI6C 4DCSA 5IT9D 1ZB8A 2HHHC 4DV2C 4LF4C 4DCUA 4DV6C 2E8FA 1MKYA 1HH2P 5IWAC 4JI7C 4X62C 4YHHC 1HNWC 1HNXC 3IEUA 4XX2A 2KZFA 1EGAA 3T1YC 4LF8C 4NXNC 4DUYC 1I94C 4JI5C 1FJGC 3JAMD 4JV5C 1IBMC 4LF5C 2JMPA 1ZB9A 1VLAA 4GKJC 4DR1C 2CXCA 3R9WA 4DV3C 1N33C 1WH9A 1J5EC 1L2FA 2OPLA 4B3TC 3T1HC 4JI1C 4LFBC 2UXDC 4LFAC 4B3MC 4AQYC 1HR0C 4X66C 4DR5C 2ZM6C 4LF9C 2HJGA 1N2FA 4DV5C 1LQLA 4DR4C 2VQFC 4NXMC 4B3RC 1ML8A 2OPLB 1PA4A 2UXBC 2E5LC 1JOSA 2VQEC 3OTOC 2D7VA 3LUSA 4X64C 1N36C 3R9XA 2E8CA 4DR2C 4DCTA 1KKGA 4DR7C 1UKKA 3I07A 5LMUC 4X65C 2UUCC 4DR6C 3AF5A 2XR1A 4DR3C 4GKKC 4KHPC 1QWIA 5A2QD 2ASBA 4JI4C 4BSZA 4YY3C 4LFCC 2E7GA 1IBLC 3J81D 1XNQC 5BR8C 1HNZC 1N32C 3AF6A 2PT7G 1WF3A 1XMQC 4B3SC 4DCVA 2EGTA 3GKUA 2CY1A 2E8EA 3IEVA 4DUZC 1NYEA 4DV1C 2UUBC 2UUAC 2DYJA 2F4VC 1K0RA
chains in the Genus database with same CATH superfamily
3KXWA 2KDNA 2D1QA 2D27A 3AY0A 4WV3A 2WP0C 5BURA 3J80D 2M5OA 2UU9C 1P4EA 4JI3C 3E7WA 1XRCA 1MDBA 3FCEA 5LMNC 4IR7A 4DV4C 4DV7C 3UX2A 2CU6A 4DCSA 5IT9D 4DCUA 1MKYA 5IWAC 4JI7C 4L7IA 4YHHC 1LCIA 3GR0A 3I08A 3VNQA 4BC9A 5KYTA 4NXNC 4JI5C 3ETCA 1V26A 4WS9A 4DG9A 4JV5C 4RM2A 4D57A 1MXBA 1ZB9A 1VLAA 4KTVA 3R9WA 4K0BA 1J5EC 1L2FA 5LCIA 3S82A 5DV9A 2ZM6C 4D4GA 1BA3A 2VSQA 3ETOA 3UOWA 4B3RC 1ML8A 2OPLB 5BSVA 2Y27A 1TH5A 3NYQA 2D1SA 4G37A 3OTOC 3LUSA 5KEIA 1N36C 2E8CA 2MM9A 4DG8A 2BH1X 4G36A 3I07A 2UUCC 3AF5A 5KYVA 4GKKC 4JM1A 4BSZA 3DAYA 4PUHA 3J81D 1XS3A 3A9UA 3PROC 3GPCA 3RV2A 1WF3A 1XHJA 1AMUA 1P4EC 2E8EA 2P2BA 3IEVA 2JNVA 4RLQA 4DV1C 2F4VC 1PU1A 2YCBA 5T8SA 1MDFA 4PHTA 3LNOA 2VZEA 3CQ3A 1MXAA 4ISBA 2QVYX 1YJ7A 2P2JA 1NY8A 1USPB 1XRBA 2PN2A 4NOZA 4FUTA 3B7WA 2Y4NA 4U5YD 4GXQA 3L95X 3TDEA 1T5DX 4G1IA 4DV0C 4D56A 4JI6C 1ZB8A 2HHHC 4DV2C 4LF4C 1V25A 4RM3A 1HH2P 1HNXC 3IEUA 2KZFA 2QW0X 1EGAA 1MD9A 4LF8C 2P20A 1MXCA 4DUYC 3NYRA 1IBMC 2ZTBA 4LF5C 3CQ2A 2JMPA 5A1IA 4RVNA 3SO4A 5BSTA 3TQIA 5AE1A 1N33C 3CQ1A 1O9TA 4RVOA 1O93A 4LFBC 4TPSB 2UXDC 3PESA 1P7LA 5K85A 3LAXA 4X66C 4DR5C 4LF9C 3GR1A 4NXMC 3K6RA 1JOSA 2VQEC 5CZVA 5K8FA 2D7VA 4X64C 2E0GA 3R9XA 3VNSA 4DCTA 1KKGA 3CW8X 2P2QA 2OO4A 4NDNA 5A2QD 4LFCC 1T5HX 5BR8C 3IPLA 4EATA 3TUFA 4FUQA 2ZZNA 4B3SC 2DHMA 3R44A 4DCVA 4IZ6A 3A26A 4ZLPA 1YGTA 4BCAA 5A19A 3CW9A 2P2MA 4LF7C 4MH4A 1USPA 3J7AD 4K0KC 2QL8A 2OBVA 3EERA 4ODJA 1XMOC 1XDXA 3A9VA 4JYAC 2UXCC 1N34C 4JI8C 1FLOA 1XNRC 1PG3A 5FLXD 5BSMA 3CJEA 2QVZX 1PG4A 4LF6C 2ATWA 3DHVA 4GXRA 2E8FA 4BC7A 1WCJA 4I9FA 4X62C 5A1GA 1V60A 3T1YC 5JRHA 1VEHA 3A4IA 1I94C 2M5HA 1FJGC 3JAMD 1UWDA 1GPMA 4FTFA 3FCCA 3EQ6A 5BSWA 3FM7A 3LGXA 4B3TC 4JI1C 4LFAC 4B3MC 3O2EA 3N54B 4BBYA 4DV5C 4DR4C 1LQLA 3H2TA 4PROC 1ULTA 1PA4A 2UXBC 4OXIA 4PZPA 3NPDA 2E5LC 1M6XA 4OYCA 4KTTA 2YWBA 3UEBA 3G7SA 5CZXA 2YX1A 4DR7C 1RY2A 5LMUC 4L4QA 4KHPC 4DR3C 1IB8A 1QWIA 2QVXX 4JI4C 5BUQA 4RMNA 1HNZC 3AF6A 2PT7G 1XMQC 4I9GA 2WD9A 3N2QA 5IFIA 2CY1A 3L8CA 4DUZC 1O90A 4PUIA 2UUBC 2DYJA 2P02A 3LNVA 4MTNA 2KZ0A 1O92A 3UZ0A 3C5EA 2BJOA 4JI2C 2Z51A 4OX9C 3A25A 2D1TA 1M6XC 4JI0C 2PG1E 4ZJZA 2DPLA 1IBKC 2MMAB 2NCLA 2ONFA 3DLPX 2P2FA 4DV6C 4R1MA 1QM4A 1HNWC 4XX2A 1XRAA 5E7QA 2D1RA 5BUSA 3NI2A 1RG9A 5H9UA 5BSUA 5AE2A 2PROA 4GKJC 4DR1C 2CXCA 4DV3C 3TR3A 3PBKA 3VNRA 1WH9A 2OPLA 4R0MA 3T1HC 5T8TA 2D28C 4AQYC 1HR0C 4R1LA 2HJGA 5AE3A 1N2FA 2AYAA 2VQFC 3RG2A 5GTDA 4D4IA 4L2ZA 4DR2C 2YWCA 3IMLA 1UKKA 5ADZA 4X65C 4DR6C 2XR1A 3E7XA 2ASBA 2Y4OA 4YY3C 2E7GA 1IBLC 1XNQC 2ZZMA 1N32C 4HPVA 4GS5A 2V7BA 2MCQA 2EGTA 3GKUA 4PUGA 4RLFA 3UX3A 1FUGA 1NYEA 4LE5A 2UUAC 5BSRA 1K0RA
chains in the Genus database with same CATH topology
3KXWA 2D1QA 2D27A 4WV3A 2WP0C 5BURA 3J80D 2UU9C 4JI3C 3E7WA 1XRCA 1MDBA 3FCEA 5LMNC 4IR7A 4DV4C 4DV7C 4DCSA 5IT9D 4DCUA 1MKYA 5IWAC 4JI7C 4L7IA 4YHHC 1LCIA 3GR0A 3I08A 3VNQA 4BC9A 5KYTA 4NXNC 4JI5C 3ETCA 1V26A 4WS9A 4DG9A 4JV5C 4RM2A 4D57A 1MXBA 1ZB9A 1VLAA 4KTVA 3R9WA 4K0BA 1J5EC 1L2FA 3S82A 5DV9A 2ZM6C 4D4GA 1BA3A 2VSQA 3ETOA 3UOWA 4B3RC 1ML8A 2OPLB 5BSVA 2Y27A 3NYQA 2D1SA 4G37A 3OTOC 3LUSA 5KEIA 1N36C 2E8CA 4DG8A 2BH1X 4G36A 3I07A 2UUCC 3AF5A 5KYVA 4GKKC 4JM1A 4BSZA 3DAYA 3J81D 3A9UA 3PROC 3GPCA 3RV2A 1WF3A 1AMUA 2E8EA 2P2BA 3IEVA 4RLQA 4DV1C 2F4VC 2YCBA 5T8SA 1MDFA 4PHTA 2VZEA 1MXAA 4ISBA 2QVYX 1YJ7A 2P2JA 1USPB 1XRBA 2PN2A 4NOZA 4FUTA 3B7WA 2Y4NA 4U5YD 4GXQA 3L95X 3TDEA 1T5DX 4G1IA 4DV0C 4D56A 4JI6C 1ZB8A 2HHHC 4DV2C 4LF4C 1V25A 4RM3A 1HH2P 1HNXC 3IEUA 2KZFA 2QW0X 1EGAA 1MD9A 4LF8C 2P20A 1MXCA 4DUYC 3NYRA 1IBMC 4LF5C 2JMPA 5A1IA 4RVNA 3SO4A 5BSTA 3TQIA 5AE1A 1N33C 1O9TA 4RVOA 1O93A 4LFBC 4TPSB 2UXDC 3PESA 1P7LA 5K85A 3LAXA 4X66C 4DR5C 4LF9C 3GR1A 4NXMC 1JOSA 2VQEC 5CZVA 5K8FA 2D7VA 4X64C 2E0GA 3R9XA 3VNSA 4DCTA 1KKGA 3CW8X 2P2QA 2OO4A 4NDNA 5A2QD 4LFCC 1T5HX 5BR8C 3IPLA 4EATA 3TUFA 4FUQA 4B3SC 3R44A 4DCVA 4IZ6A 4ZLPA 4BCAA 5A19A 3CW9A 2P2MA 4LF7C 4MH4A 1USPA 3J7AD 4K0KC 2QL8A 2OBVA 3EERA 4ODJA 1XMOC 3A9VA 4JYAC 2UXCC 1N34C 4JI8C 1XNRC 1PG3A 5FLXD 5BSMA 3CJEA 2QVZX 1PG4A 4LF6C 2ATWA 3DHVA 4GXRA 2E8FA 4BC7A 4I9FA 4X62C 5A1GA 3T1YC 5JRHA 3A4IA 1I94C 1FJGC 3JAMD 1GPMA 4FTFA 3FCCA 3EQ6A 5BSWA 3LGXA 4B3TC 4JI1C 4LFAC 4B3MC 3N54B 4BBYA 4DV5C 4DR4C 1LQLA 3H2TA 4PROC 1ULTA 1PA4A 2UXBC 4OXIA 4PZPA 3NPDA 2E5LC 4OYCA 4KTTA 2YWBA 3G7SA 5CZXA 4DR7C 1RY2A 5LMUC 4L4QA 4KHPC 4DR3C 1QWIA 2QVXX 4JI4C 5BUQA 4RMNA 1HNZC 3AF6A 2PT7G 1XMQC 4I9GA 2WD9A 3N2QA 5IFIA 2CY1A 3L8CA 4DUZC 1O90A 2UUBC 2DYJA 2P02A 3LNVA 4MTNA 1O92A 3UZ0A 3C5EA 2BJOA 4JI2C 4OX9C 2D1TA 4JI0C 4ZJZA 2DPLA 1IBKC 2ONFA 3DLPX 2P2FA 4DV6C 4R1MA 1QM4A 1HNWC 4XX2A 1XRAA 5E7QA 2D1RA 5BUSA 3NI2A 1RG9A 5H9UA 5BSUA 5AE2A 2PROA 4GKJC 4DR1C 2CXCA 4DV3C 3PBKA 3VNRA 1WH9A 2OPLA 4R0MA 3T1HC 5T8TA 2D28C 4AQYC 1HR0C 4R1LA 2HJGA 5AE3A 1N2FA 2AYAA 2VQFC 3RG2A 5GTDA 4D4IA 4L2ZA 4DR2C 2YWCA 3IMLA 1UKKA 5ADZA 4X65C 4DR6C 2XR1A 3E7XA 2ASBA 2Y4OA 4YY3C 2E7GA 1IBLC 1XNQC 1N32C 4HPVA 4GS5A 2V7BA 2EGTA 3GKUA 4RLFA 1FUGA 1NYEA 4LE5A 2UUAC 5BSRA 1K0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 C;  4MTN A;  4MH4 A;  2YCB A;  1USP A;  3J7A D;  4JI2 C;  2BJO A;  4K0K C;  2QL8 A;  4OX9 C;  3EER A;  3J80 D;  4JI0 C;  2UU9 C;  1XMO C;  4JYA C;  2UXC C;  1N34 C;  1USP B;  4JI3 C;  4JI8 C;  2PN2 A;  1IBK C;  1XNR C;  4NOZ A;  5LMN C;  5FLX D;  4DV4 C;  3CJE A;  2ONF A;  4DV7 C;  4LF6 C;  4DV0 C;  2ATW A;  4JI6 C;  4DCS A;  5IT9 D;  1ZB8 A;  2HHH C;  4DV2 C;  4LF4 C;  4DCU A;  4DV6 C;  2E8F A;  1MKY A;  1HH2 P;  5IWA C;  4JI7 C;  4X62 C;  4YHH C;  1HNW C;  1HNX C;  3IEU A;  4XX2 A;  2KZF A;  1EGA A;  3T1Y C;  4LF8 C;  4NXN C;  4DUY C;  1I94 C;  4JI5 C;  1FJG C;  3JAM D;  4JV5 C;  1IBM C;  4LF5 C;  2JMP A;  1ZB9 A;  1VLA A;  4GKJ C;  4DR1 C;  2CXC A;  3R9W A;  4DV3 C;  1N33 C;  1WH9 A;  1J5E C;  1L2F A;  2OPL A;  4B3T C;  3T1H C;  4JI1 C;  4LFB C;  2UXD C;  4LFA C;  4B3M C;  4AQY C;  1HR0 C;  4X66 C;  4DR5 C;  2ZM6 C;  4LF9 C;  2HJG A;  1N2F A;  4DV5 C;  1LQL A;  4DR4 C;  2VQF C;  4NXM C;  4B3R C;  1ML8 A;  2OPL B;  1PA4 A;  2UXB C;  2E5L C;  1JOS A;  2VQE C;  3OTO C;  2D7V A;  3LUS A;  4X64 C;  1N36 C;  3R9X A;  2E8C A;  4DR2 C;  4DCT A;  1KKG A;  4DR7 C;  1UKK A;  3I07 A;  5LMU C;  4X65 C;  2UUC C;  4DR6 C;  3AF5 A;  2XR1 A;  4DR3 C;  4GKK C;  4KHP C;  1QWI A;  5A2Q D;  2ASB A;  4JI4 C;  4BSZ A;  4YY3 C;  4LFC C;  2E7G A;  1IBL C;  3J81 D;  1XNQ C;  5BR8 C;  1HNZ C;  1N32 C;  3AF6 A;  2PT7 G;  1WF3 A;  1XMQ C;  4B3S C;  4DCV A;  2EGT A;  3GKU A;  2CY1 A;  2E8E A;  3IEV A;  4DUZ C;  1NYE A;  4DV1 C;  2UUB C;  2UUA C;  2DYJ A;  2F4V C;  1K0R A; 
#chains in the Genus database with same CATH topology
 3KXW A;  2KDN A;  2D1Q A;  2D27 A;  3AY0 A;  4WV3 A;  2WP0 C;  5BUR A;  3J80 D;  2M5O A;  2UU9 C;  1P4E A;  4JI3 C;  3E7W A;  1XRC A;  1MDB A;  3FCE A;  5LMN C;  4IR7 A;  4DV4 C;  4DV7 C;  3UX2 A;  2CU6 A;  4DCS A;  5IT9 D;  4DCU A;  1MKY A;  5IWA C;  4JI7 C;  4L7I A;  4YHH C;  1LCI A;  3GR0 A;  3I08 A;  3VNQ A;  4BC9 A;  5KYT A;  4NXN C;  4JI5 C;  3ETC A;  1V26 A;  4WS9 A;  4DG9 A;  4JV5 C;  4RM2 A;  4D57 A;  1MXB A;  1ZB9 A;  1VLA A;  4KTV A;  3R9W A;  4K0B A;  1J5E C;  1L2F A;  5LCI A;  3S82 A;  5DV9 A;  2ZM6 C;  4D4G A;  1BA3 A;  2VSQ A;  3ETO A;  3UOW A;  4B3R C;  1ML8 A;  2OPL B;  5BSV A;  2Y27 A;  1TH5 A;  3NYQ A;  2D1S A;  4G37 A;  3OTO C;  3LUS A;  5KEI A;  1N36 C;  2E8C A;  2MM9 A;  4DG8 A;  2BH1 X;  4G36 A;  3I07 A;  2UUC C;  3AF5 A;  5KYV A;  4GKK C;  4JM1 A;  4BSZ A;  3DAY A;  4PUH A;  3J81 D;  1XS3 A;  3A9U A;  3PRO C;  3GPC A;  3RV2 A;  1WF3 A;  1XHJ A;  1AMU A;  1P4E C;  2E8E A;  2P2B A;  3IEV A;  2JNV A;  4RLQ A;  4DV1 C;  2F4V C;  1PU1 A;  2YCB A;  5T8S A;  1MDF A;  4PHT A;  3LNO A;  2VZE A;  3CQ3 A;  1MXA A;  4ISB A;  2QVY X;  1YJ7 A;  2P2J A;  1NY8 A;  1USP B;  1XRB A;  2PN2 A;  4NOZ A;  4FUT A;  3B7W A;  2Y4N A;  4U5Y D;  4GXQ A;  3L95 X;  3TDE A;  1T5D X;  4G1I A;  4DV0 C;  4D56 A;  4JI6 C;  1ZB8 A;  2HHH C;  4DV2 C;  4LF4 C;  1V25 A;  4RM3 A;  1HH2 P;  1HNX C;  3IEU A;  2KZF A;  2QW0 X;  1EGA A;  1MD9 A;  4LF8 C;  2P20 A;  1MXC A;  4DUY C;  3NYR A;  1IBM C;  2ZTB A;  4LF5 C;  3CQ2 A;  2JMP A;  5A1I A;  4RVN A;  3SO4 A;  5BST A;  3TQI A;  5AE1 A;  1N33 C;  3CQ1 A;  1O9T A;  4RVO A;  1O93 A;  4LFB C;  4TPS B;  2UXD C;  3PES A;  1P7L A;  5K85 A;  3LAX A;  4X66 C;  4DR5 C;  4LF9 C;  3GR1 A;  4NXM C;  3K6R A;  1JOS A;  2VQE C;  5CZV A;  5K8F A;  2D7V A;  4X64 C;  2E0G A;  3R9X A;  3VNS A;  4DCT A;  1KKG A;  3CW8 X;  2P2Q A;  2OO4 A;  4NDN A;  5A2Q D;  4LFC C;  1T5H X;  5BR8 C;  3IPL A;  4EAT A;  3TUF A;  4FUQ A;  2ZZN A;  4B3S C;  2DHM A;  3R44 A;  4DCV A;  4IZ6 A;  3A26 A;  4ZLP A;  1YGT A;  4BCA A;  5A19 A;  3CW9 A;  2P2M A;  4LF7 C;  4MH4 A;  1USP A;  3J7A D;  4K0K C;  2QL8 A;  2OBV A;  3EER A;  4ODJ A;  1XMO C;  1XDX A;  3A9V A;  4JYA C;  2UXC C;  1N34 C;  4JI8 C;  1FLO A;  1XNR C;  1PG3 A;  5FLX D;  5BSM A;  3CJE A;  2QVZ X;  1PG4 A;  4LF6 C;  2ATW A;  3DHV A;  4GXR A;  2E8F A;  4BC7 A;  1WCJ A;  4I9F A;  4X62 C;  5A1G A;  1V60 A;  3T1Y C;  5JRH A;  1VEH A;  3A4I A;  1I94 C;  2M5H A;  1FJG C;  3JAM D;  1UWD A;  1GPM A;  4FTF A;  3FCC A;  3EQ6 A;  5BSW A;  3FM7 A;  3LGX A;  4B3T C;  4JI1 C;  4LFA C;  4B3M C;  3O2E A;  3N54 B;  4BBY A;  4DV5 C;  4DR4 C;  1LQL A;  3H2T A;  4PRO C;  1ULT A;  1PA4 A;  2UXB C;  4OXI A;  4PZP A;  3NPD A;  2E5L C;  1M6X A;  4OYC A;  4KTT A;  2YWB A;  3UEB A;  3G7S A;  5CZX A;  2YX1 A;  4DR7 C;  1RY2 A;  5LMU C;  4L4Q A;  4KHP C;  4DR3 C;  1IB8 A;  1QWI A;  2QVX X;  4JI4 C;  5BUQ A;  4RMN A;  1HNZ C;  3AF6 A;  2PT7 G;  1XMQ C;  4I9G A;  2WD9 A;  3N2Q A;  5IFI A;  2CY1 A;  3L8C A;  4DUZ C;  1O90 A;  4PUI A;  2UUB C;  2DYJ A;  2P02 A;  3LNV A;  4MTN A;  2KZ0 A;  1O92 A;  3UZ0 A;  3C5E A;  2BJO A;  4JI2 C;  2Z51 A;  4OX9 C;  3A25 A;  2D1T A;  1M6X C;  4JI0 C;  2PG1 E;  4ZJZ A;  2DPL A;  1IBK C;  2MMA B;  2NCL A;  2ONF A;  3DLP X;  2P2F A;  4DV6 C;  4R1M A;  1QM4 A;  1HNW C;  4XX2 A;  1XRA A;  5E7Q A;  2D1R A;  5BUS A;  3NI2 A;  1RG9 A;  5H9U A;  5BSU A;  5AE2 A;  2PRO A;  4GKJ C;  4DR1 C;  2CXC A;  4DV3 C;  3TR3 A;  3PBK A;  3VNR A;  1WH9 A;  2OPL A;  4R0M A;  3T1H C;  5T8T A;  2D28 C;  4AQY C;  1HR0 C;  4R1L A;  2HJG A;  5AE3 A;  1N2F A;  2AYA A;  2VQF C;  3RG2 A;  5GTD A;  4D4I A;  4L2Z A;  4DR2 C;  2YWC A;  3IML A;  1UKK A;  5ADZ A;  4X65 C;  4DR6 C;  2XR1 A;  3E7X A;  2ASB A;  2Y4O A;  4YY3 C;  2E7G A;  1IBL C;  1XNQ C;  2ZZM A;  1N32 C;  4HPV A;  4GS5 A;  2V7B A;  2MCQ A;  2EGT A;  3GKU A;  4PUG A;  4RLF A;  3UX3 A;  1FUG A;  1NYE A;  4LE5 A;  2UUA C;  5BSR A;  1K0R A; 
#chains in the Genus database with same CATH homology
 3KXW A;  2D1Q A;  2D27 A;  4WV3 A;  2WP0 C;  5BUR A;  3J80 D;  2UU9 C;  4JI3 C;  3E7W A;  1XRC A;  1MDB A;  3FCE A;  5LMN C;  4IR7 A;  4DV4 C;  4DV7 C;  4DCS A;  5IT9 D;  4DCU A;  1MKY A;  5IWA C;  4JI7 C;  4L7I A;  4YHH C;  1LCI A;  3GR0 A;  3I08 A;  3VNQ A;  4BC9 A;  5KYT A;  4NXN C;  4JI5 C;  3ETC A;  1V26 A;  4WS9 A;  4DG9 A;  4JV5 C;  4RM2 A;  4D57 A;  1MXB A;  1ZB9 A;  1VLA A;  4KTV A;  3R9W A;  4K0B A;  1J5E C;  1L2F A;  3S82 A;  5DV9 A;  2ZM6 C;  4D4G A;  1BA3 A;  2VSQ A;  3ETO A;  3UOW A;  4B3R C;  1ML8 A;  2OPL B;  5BSV A;  2Y27 A;  3NYQ A;  2D1S A;  4G37 A;  3OTO C;  3LUS A;  5KEI A;  1N36 C;  2E8C A;  4DG8 A;  2BH1 X;  4G36 A;  3I07 A;  2UUC C;  3AF5 A;  5KYV A;  4GKK C;  4JM1 A;  4BSZ A;  3DAY A;  3J81 D;  3A9U A;  3PRO C;  3GPC A;  3RV2 A;  1WF3 A;  1AMU A;  2E8E A;  2P2B A;  3IEV A;  4RLQ A;  4DV1 C;  2F4V C;  2YCB A;  5T8S A;  1MDF A;  4PHT A;  2VZE A;  1MXA A;  4ISB A;  2QVY X;  1YJ7 A;  2P2J A;  1USP B;  1XRB A;  2PN2 A;  4NOZ A;  4FUT A;  3B7W A;  2Y4N A;  4U5Y D;  4GXQ A;  3L95 X;  3TDE A;  1T5D X;  4G1I A;  4DV0 C;  4D56 A;  4JI6 C;  1ZB8 A;  2HHH C;  4DV2 C;  4LF4 C;  1V25 A;  4RM3 A;  1HH2 P;  1HNX C;  3IEU A;  2KZF A;  2QW0 X;  1EGA A;  1MD9 A;  4LF8 C;  2P20 A;  1MXC A;  4DUY C;  3NYR A;  1IBM C;  4LF5 C;  2JMP A;  5A1I A;  4RVN A;  3SO4 A;  5BST A;  3TQI A;  5AE1 A;  1N33 C;  1O9T A;  4RVO A;  1O93 A;  4LFB C;  4TPS B;  2UXD C;  3PES A;  1P7L A;  5K85 A;  3LAX A;  4X66 C;  4DR5 C;  4LF9 C;  3GR1 A;  4NXM C;  1JOS A;  2VQE C;  5CZV A;  5K8F A;  2D7V A;  4X64 C;  2E0G A;  3R9X A;  3VNS A;  4DCT A;  1KKG A;  3CW8 X;  2P2Q A;  2OO4 A;  4NDN A;  5A2Q D;  4LFC C;  1T5H X;  5BR8 C;  3IPL A;  4EAT A;  3TUF A;  4FUQ A;  4B3S C;  3R44 A;  4DCV A;  4IZ6 A;  4ZLP A;  4BCA A;  5A19 A;  3CW9 A;  2P2M A;  4LF7 C;  4MH4 A;  1USP A;  3J7A D;  4K0K C;  2QL8 A;  2OBV A;  3EER A;  4ODJ A;  1XMO C;  3A9V A;  4JYA C;  2UXC C;  1N34 C;  4JI8 C;  1XNR C;  1PG3 A;  5FLX D;  5BSM A;  3CJE A;  2QVZ X;  1PG4 A;  4LF6 C;  2ATW A;  3DHV A;  4GXR A;  2E8F A;  4BC7 A;  4I9F A;  4X62 C;  5A1G A;  3T1Y C;  5JRH A;  3A4I A;  1I94 C;  1FJG C;  3JAM D;  1GPM A;  4FTF A;  3FCC A;  3EQ6 A;  5BSW A;  3LGX A;  4B3T C;  4JI1 C;  4LFA C;  4B3M C;  3N54 B;  4BBY A;  4DV5 C;  4DR4 C;  1LQL A;  3H2T A;  4PRO C;  1ULT A;  1PA4 A;  2UXB C;  4OXI A;  4PZP A;  3NPD A;  2E5L C;  4OYC A;  4KTT A;  2YWB A;  3G7S A;  5CZX A;  4DR7 C;  1RY2 A;  5LMU C;  4L4Q A;  4KHP C;  4DR3 C;  1QWI A;  2QVX X;  4JI4 C;  5BUQ A;  4RMN A;  1HNZ C;  3AF6 A;  2PT7 G;  1XMQ C;  4I9G A;  2WD9 A;  3N2Q A;  5IFI A;  2CY1 A;  3L8C A;  4DUZ C;  1O90 A;  2UUB C;  2DYJ A;  2P02 A;  3LNV A;  4MTN A;  1O92 A;  3UZ0 A;  3C5E A;  2BJO A;  4JI2 C;  4OX9 C;  2D1T A;  4JI0 C;  4ZJZ A;  2DPL A;  1IBK C;  2ONF A;  3DLP X;  2P2F A;  4DV6 C;  4R1M A;  1QM4 A;  1HNW C;  4XX2 A;  1XRA A;  5E7Q A;  2D1R A;  5BUS A;  3NI2 A;  1RG9 A;  5H9U A;  5BSU A;  5AE2 A;  2PRO A;  4GKJ C;  4DR1 C;  2CXC A;  4DV3 C;  3PBK A;  3VNR A;  1WH9 A;  2OPL A;  4R0M A;  3T1H C;  5T8T A;  2D28 C;  4AQY C;  1HR0 C;  4R1L A;  2HJG A;  5AE3 A;  1N2F A;  2AYA A;  2VQF C;  3RG2 A;  5GTD A;  4D4I A;  4L2Z A;  4DR2 C;  2YWC A;  3IML A;  1UKK A;  5ADZ A;  4X65 C;  4DR6 C;  2XR1 A;  3E7X A;  2ASB A;  2Y4O A;  4YY3 C;  2E7G A;  1IBL C;  1XNQ C;  1N32 C;  4HPV A;  4GS5 A;  2V7B A;  2EGT A;  3GKU A;  4RLF A;  1FUG A;  1NYE A;  4LE5 A;  2UUA C;  5BSR A;  1K0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...