2UXCC

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 40
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uxcC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uxcC02
4DUZC 2UXBC 2KZFA 4X66C 2UUAC 3R9XA 3CJEA 1XNRC 4LF8C 4LFCC 2UUBC 2E8CA 2OPLB 2JMPA 2BJOA 2ATWA 3AF6A 1ZB9A 4LF5C 1N32C 4DR7C 4JI3C 1EGAA 4MTNA 5BR8C 4AQYC 1KKGA 1XMQC 4JI7C 1N33C 2UXDC 4JI0C 4YHHC 4DR3C 3OTOC 1L2FA 3I07A 4DCSA 4DR5C 2E8FA 2QL8A 3T1YC 4YY3C 4K0KC 4B3MC 2E7GA 4DUYC 2YCBA 4B3TC 4B3SC 3J7AD 4DR1C 1HH2P 4NOZA 1ML8A 2ASBA 2VQEC 4DV2C 1IBKC 5LMNC 2OPLA 3IEUA 2E5LC 4DV5C 5IWAC 5FLXD 4JI1C 2VQFC 4JI2C 1N36C 2ZM6C 1N2FA 4MH4A 1WH9A 4NXMC 4LFBC 2EGTA 4DV1C 2D7VA 1ZB8A 1N34C 4LFAC 1I94C 3J81D 4X64C 1HNZC 4X65C 4DR4C 3EERA 2UUCC 4DCVA 3R9WA 3J80D 2PT7G 4JI5C 1HNWC 4LF9C 4GKJC 4GKKC 1WF3A 2HHHC 1VLAA 4BSZA 1JOSA 3T1HC 5IT9D 3IEVA 4LF6C 1XNQC 1HNXC 2CXCA 4XX2A 4OX9C 1USPB 1UKKA 4KHPC 1J5EC 4JV5C 3JAMD 3LUSA 4X62C 4DV6C 1USPA 4DCUA 3AF5A 4B3RC 4LF4C 5LMUC 4DV3C 4DR2C 1QWIA 4DR6C 1PA4A 4JI6C 1K0RA 1FJGC 1MKYA 4JYAC 4DV4C 1XMOC 4JI8C 1LQLA 4NXNC 4JI4C 2HJGA 2XR1A 2CY1A 2ONFA 1HR0C 4DV0C 2E8EA 4DCTA 2DYJA 2UU9C 2UXCC 2PN2A 1NYEA 1IBLC 2F4VC 5A2QD 1IBMC 4LF7C 3GKUA 4DV7C
chains in the Genus database with same CATH superfamily
4DUZC 2UXBC 2KZFA 2UUAC 3R9XA 1XNRC 4LFCC 2P2QA 3CW9A 4JI7C 4ISBA 2P2MA 4YHHC 4DR3C 1L2FA 4RM2A 1UWDA 2E8FA 3NYQA 1P7LA 3PROC 2V7BA 3S82A 4B3TC 4R1LA 2DPLA 2M5OA 4WV3A 4DV2C 3PBKA 3RV2A 1IBKC 5LMNC 2OPLA 2E5LC 4R0MA 1M6XA 5T8TA 4MH4A 4LFBC 2EGTA 5BSWA 2PROA 1N34C 4LFAC 4D57A 4GS5A 5IFIA 4X64C 1HNZC 2YWCA 4X65C 3EERA 4DR4C 5CZVA 3A9UA 2PT7G 4LF9C 4D56A 2P2JA 5A1IA 4IR7A 2MM9A 1JOSA 4BCAA 5KYTA 2DHMA 4L4QA 1XNQC 1UKKA 1USPB 1J5EC 2ZZNA 4X62C 3N2QA 4RLQA 3LGXA 4RLFA 5JRHA 4DV3C 4PUHA 2MMAB 5BUQA 3NPDA 4DR6C 1PA4A 4JI6C 2QVYX 2QVXX 1PG4A 1O90A 5K85A 4FUTA 4JI4C 3TDEA 2D1SA 1LCIA 4ODJA 2F4VC 3SO4A 5A2QD 3N54B 3ETOA 3CQ2A 1NY8A 3CJEA 4LF8C 1T5HX 2OO4A 2UUBC 2E8CA 2BJOA 3B7WA 4R1MA 4RMNA 2P20A 4LF5C 4JI3C 1EGAA 1T5DX 1KKGA 2UXDC 2VSQA 1MD9A 3FCEA 3I07A 2KZ0A 1GPMA 3A9VA 4B3MC 2ZTBA 2VZEA 1XDXA 2KDNA 4I9GA 1XRBA 2NCLA 2JNVA 1V60A 5IWAC 2D1QA 4JI1C 3IPLA 4JI2C 5T8SA 1N2FA 2D7VA 4DG8A 2QW0X 3H2TA 2UUCC 2M5HA 1VEHA 1P4EC 2HHHC 4BSZA 2CU6A 4G1IA 5IT9D 4BC9A 3IEVA 3CQ3A 3VNSA 4PZPA 5GTDA 2CXCA 3TUFA 1RG9A 3RG2A 4DG9A 1XRCA 5LMUC 1QWIA 5LCIA 3DAYA 4IZ6A 1K0RA 5ADZA 3UX3A 1FJGC 3TQIA 5A19A 1XMOC 1LQLA 2D1RA 4NXNC 2P02A 2CY1A 2ONFA 3NI2A 4NDNA 4DCTA 4FTFA 4G36A 5BSMA 1NYEA 4BBYA 3UOWA 1IBLC 2Y4OA 1IBMC 3GKUA 4D4GA 3ETCA 2WP0C 1YGTA 3LNVA 3PESA 2JMPA 4KTTA 3AF6A 4DR7C 3A4IA 5BURA 4AQYC 1N33C 2Y27A 4JI0C 5CZXA 3OTOC 1MXAA 2QL8A 4G37A 3T1YC 3UZ0A 4OYCA 4B3SC 4DR1C 1HH2P 3LAXA 2VQEC 2Y4NA 3GR1A 4DV5C 5FLXD 1YJ7A 1N36C 4K0BA 2ZM6C 4ZLPA 4DV1C 3UEBA 2WD9A 1ZB8A 1I94C 3GPCA 3VNRA 3J81D 3G7SA 4DCVA 3R9WA 3CQ1A 3J80D 4PROC 4JI5C 4U5YD 2D27A 4GKJC 4GKKC 1VLAA 3T1HC 3A25A 1O93A 1IB8A 1BA3A 1V26A 3K6RA 4XX2A 4JV5C 5DV9A 2BH1X 4DV6C 1USPA 4GXQA 2OBVA 2YX1A 4B3RC 4LF4C 3FM7A 4D4IA 1QM4A 5AE1A 3EQ6A 4JI8C 3R44A 4LE5A 1MXCA 2UU9C 5AE2A 2UXCC 2PN2A 1XS3A 1ULTA 4LF7C 2PG1E 5H9UA 4DV7C 4PUIA 4X66C 2OPLB 2ATWA 3TR3A 1FUGA 3E7WA 1ZB9A 1N32C 4RVOA 1MXBA 4MTNA 5BR8C 3VNQA 4I9FA 1AMUA 4WS9A 2P2BA 1MDBA 2QVZX 1XMQC 3DLPX 3NYRA 4PHTA 4EATA 4DCSA 5KYVA 3AY0A 4DR5C 1PG3A 1M6XC 3O2EA 4RVNA 5BSUA 5BSTA 4YY3C 4K0KC 3L8CA 2E7GA 4DUYC 1V25A 2YCBA 3I08A 5K8FA 3J7AD 5AE3A 4NOZA 1ML8A 1WCJA 2ASBA 4RM3A 3KXWA 1PU1A 4GXRA 3IEUA 3GR0A 2Z51A 2VQFC 4OXIA 5BSRA 5BUSA 5BSVA 1WH9A 4NXMC 5KEIA 4BC7A 3LNOA 1P4EA 2AYAA 2E0GA 5A1GA 4L2ZA 3CW8X 4L7IA 4PUGA 3E7XA 1HNWC 1WF3A 4TPSB 4LF6C 4ZJZA 1FLOA 1HNXC 4KTVA 3UX2A 4OX9C 4FUQA 4KHPC 3JAMD 3LUSA 2YWBA 2ZZMA 5E7QA 4DCUA 3AF5A 3FCCA 4DR2C 3C5EA 1O9TA 2D1TA 1MKYA 4JYAC 4DV4C 2MCQA 2HJGA 1O92A 2XR1A 3IMLA 1MDFA 1HR0C 4DV0C 2E8EA 1RY2A 2DYJA 1TH5A 1XRAA 3A26A 4JM1A 1XHJA 2D28C 3L95X 3DHVA 4HPVA 2P2FA
chains in the Genus database with same CATH topology
4DUZC 2UXBC 2KZFA 2UUAC 3R9XA 1XNRC 4LFCC 2P2QA 3CW9A 4JI7C 4ISBA 2P2MA 4YHHC 4DR3C 1L2FA 4RM2A 2E8FA 3NYQA 1P7LA 3PROC 2V7BA 3S82A 4B3TC 4R1LA 2DPLA 4WV3A 4DV2C 3PBKA 3RV2A 1IBKC 5LMNC 2OPLA 2E5LC 4R0MA 5T8TA 4MH4A 4LFBC 2EGTA 5BSWA 2PROA 1N34C 4LFAC 4D57A 4GS5A 5IFIA 4X64C 1HNZC 2YWCA 4X65C 3EERA 4DR4C 5CZVA 3A9UA 2PT7G 4LF9C 4D56A 2P2JA 5A1IA 4IR7A 1JOSA 4BCAA 5KYTA 4L4QA 1XNQC 1UKKA 1USPB 1J5EC 4X62C 3N2QA 4RLQA 3LGXA 4RLFA 5JRHA 4DV3C 5BUQA 3NPDA 4DR6C 1PA4A 4JI6C 2QVYX 2QVXX 1PG4A 1O90A 5K85A 4FUTA 4JI4C 3TDEA 2D1SA 1LCIA 4ODJA 2F4VC 3SO4A 5A2QD 3N54B 3ETOA 3CJEA 4LF8C 1T5HX 2OO4A 2UUBC 2E8CA 2BJOA 3B7WA 4R1MA 4RMNA 2P20A 4LF5C 4JI3C 1EGAA 1T5DX 1KKGA 2UXDC 2VSQA 1MD9A 3FCEA 3I07A 1GPMA 3A9VA 4B3MC 2VZEA 4I9GA 1XRBA 5IWAC 2D1QA 4JI1C 3IPLA 4JI2C 5T8SA 1N2FA 2D7VA 4DG8A 2QW0X 3H2TA 2UUCC 2HHHC 4BSZA 4G1IA 5IT9D 4BC9A 3IEVA 3VNSA 4PZPA 5GTDA 2CXCA 3TUFA 1RG9A 3RG2A 4DG9A 1XRCA 5LMUC 1QWIA 3DAYA 4IZ6A 1K0RA 5ADZA 1FJGC 3TQIA 5A19A 1XMOC 1LQLA 2D1RA 4NXNC 2P02A 2CY1A 2ONFA 3NI2A 4NDNA 4DCTA 4FTFA 4G36A 5BSMA 1NYEA 4BBYA 3UOWA 1IBLC 2Y4OA 1IBMC 3GKUA 4D4GA 3ETCA 2WP0C 3LNVA 3PESA 2JMPA 4KTTA 3AF6A 4DR7C 3A4IA 5BURA 4AQYC 1N33C 2Y27A 4JI0C 5CZXA 3OTOC 1MXAA 2QL8A 4G37A 3T1YC 3UZ0A 4OYCA 4B3SC 4DR1C 1HH2P 3LAXA 2VQEC 2Y4NA 3GR1A 4DV5C 5FLXD 1YJ7A 1N36C 4K0BA 2ZM6C 4ZLPA 4DV1C 2WD9A 1ZB8A 1I94C 3GPCA 3VNRA 3J81D 3G7SA 4DCVA 3R9WA 3J80D 4PROC 4JI5C 4U5YD 2D27A 4GKJC 4GKKC 1VLAA 3T1HC 1O93A 1BA3A 1V26A 4XX2A 4JV5C 5DV9A 2BH1X 4DV6C 1USPA 4GXQA 2OBVA 4B3RC 4LF4C 4D4IA 1QM4A 5AE1A 3EQ6A 4JI8C 3R44A 4LE5A 1MXCA 2UU9C 5AE2A 2UXCC 2PN2A 1ULTA 4LF7C 5H9UA 4DV7C 4X66C 2OPLB 2ATWA 1FUGA 3E7WA 1ZB9A 1N32C 4RVOA 1MXBA 4MTNA 5BR8C 3VNQA 4I9FA 1AMUA 4WS9A 2P2BA 1MDBA 2QVZX 1XMQC 3DLPX 3NYRA 4PHTA 4EATA 4DCSA 5KYVA 4DR5C 1PG3A 4RVNA 5BSUA 5BSTA 4YY3C 4K0KC 3L8CA 2E7GA 4DUYC 1V25A 2YCBA 3I08A 5K8FA 3J7AD 5AE3A 4NOZA 1ML8A 2ASBA 4RM3A 3KXWA 4GXRA 3IEUA 3GR0A 2VQFC 4OXIA 5BSRA 5BUSA 5BSVA 1WH9A 4NXMC 5KEIA 4BC7A 2AYAA 2E0GA 5A1GA 4L2ZA 3CW8X 4L7IA 3E7XA 1HNWC 1WF3A 4TPSB 4LF6C 4ZJZA 1HNXC 4KTVA 4OX9C 4FUQA 4KHPC 3JAMD 3LUSA 2YWBA 5E7QA 4DCUA 3AF5A 3FCCA 4DR2C 3C5EA 1O9TA 2D1TA 1MKYA 4JYAC 4DV4C 2HJGA 1O92A 2XR1A 3IMLA 1MDFA 1HR0C 4DV0C 2E8EA 1RY2A 2DYJA 1XRAA 4JM1A 2D28C 3L95X 3DHVA 4HPVA 2P2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ C;  2UXB C;  2KZF A;  4X66 C;  2UUA C;  3R9X A;  3CJE A;  1XNR C;  4LF8 C;  4LFC C;  2UUB C;  2E8C A;  2OPL B;  2JMP A;  2BJO A;  2ATW A;  3AF6 A;  1ZB9 A;  4LF5 C;  1N32 C;  4DR7 C;  4JI3 C;  1EGA A;  4MTN A;  5BR8 C;  4AQY C;  1KKG A;  1XMQ C;  4JI7 C;  1N33 C;  2UXD C;  4JI0 C;  4YHH C;  4DR3 C;  3OTO C;  1L2F A;  3I07 A;  4DCS A;  4DR5 C;  2E8F A;  2QL8 A;  3T1Y C;  4YY3 C;  4K0K C;  4B3M C;  2E7G A;  4DUY C;  2YCB A;  4B3T C;  4B3S C;  3J7A D;  4DR1 C;  1HH2 P;  4NOZ A;  1ML8 A;  2ASB A;  2VQE C;  4DV2 C;  1IBK C;  5LMN C;  2OPL A;  3IEU A;  2E5L C;  4DV5 C;  5IWA C;  5FLX D;  4JI1 C;  2VQF C;  4JI2 C;  1N36 C;  2ZM6 C;  1N2F A;  4MH4 A;  1WH9 A;  4NXM C;  4LFB C;  2EGT A;  4DV1 C;  2D7V A;  1ZB8 A;  1N34 C;  4LFA C;  1I94 C;  3J81 D;  4X64 C;  1HNZ C;  4X65 C;  4DR4 C;  3EER A;  2UUC C;  4DCV A;  3R9W A;  3J80 D;  2PT7 G;  4JI5 C;  1HNW C;  4LF9 C;  4GKJ C;  4GKK C;  1WF3 A;  2HHH C;  1VLA A;  4BSZ A;  1JOS A;  3T1H C;  5IT9 D;  3IEV A;  4LF6 C;  1XNQ C;  1HNX C;  2CXC A;  4XX2 A;  4OX9 C;  1USP B;  1UKK A;  4KHP C;  1J5E C;  4JV5 C;  3JAM D;  3LUS A;  4X62 C;  4DV6 C;  1USP A;  4DCU A;  3AF5 A;  4B3R C;  4LF4 C;  5LMU C;  4DV3 C;  4DR2 C;  1QWI A;  4DR6 C;  1PA4 A;  4JI6 C;  1K0R A;  1FJG C;  1MKY A;  4JYA C;  4DV4 C;  1XMO C;  4JI8 C;  1LQL A;  4NXN C;  4JI4 C;  2HJG A;  2XR1 A;  2CY1 A;  2ONF A;  1HR0 C;  4DV0 C;  2E8E A;  4DCT A;  2DYJ A;  2UU9 C;  2UXC C;  2PN2 A;  1NYE A;  1IBL C;  2F4V C;  5A2Q D;  1IBM C;  4LF7 C;  3GKU A;  4DV7 C; 
#chains in the Genus database with same CATH topology
 4DUZ C;  2UXB C;  2KZF A;  2UUA C;  3R9X A;  1XNR C;  4LFC C;  2P2Q A;  3CW9 A;  4JI7 C;  4ISB A;  2P2M A;  4YHH C;  4DR3 C;  1L2F A;  4RM2 A;  1UWD A;  2E8F A;  3NYQ A;  1P7L A;  3PRO C;  2V7B A;  3S82 A;  4B3T C;  4R1L A;  2DPL A;  2M5O A;  4WV3 A;  4DV2 C;  3PBK A;  3RV2 A;  1IBK C;  5LMN C;  2OPL A;  2E5L C;  4R0M A;  1M6X A;  5T8T A;  4MH4 A;  4LFB C;  2EGT A;  5BSW A;  2PRO A;  1N34 C;  4LFA C;  4D57 A;  4GS5 A;  5IFI A;  4X64 C;  1HNZ C;  2YWC A;  4X65 C;  3EER A;  4DR4 C;  5CZV A;  3A9U A;  2PT7 G;  4LF9 C;  4D56 A;  2P2J A;  5A1I A;  4IR7 A;  2MM9 A;  1JOS A;  4BCA A;  5KYT A;  2DHM A;  4L4Q A;  1XNQ C;  1UKK A;  1USP B;  1J5E C;  2ZZN A;  4X62 C;  3N2Q A;  4RLQ A;  3LGX A;  4RLF A;  5JRH A;  4DV3 C;  4PUH A;  2MMA B;  5BUQ A;  3NPD A;  4DR6 C;  1PA4 A;  4JI6 C;  2QVY X;  2QVX X;  1PG4 A;  1O90 A;  5K85 A;  4FUT A;  4JI4 C;  3TDE A;  2D1S A;  1LCI A;  4ODJ A;  2F4V C;  3SO4 A;  5A2Q D;  3N54 B;  3ETO A;  3CQ2 A;  1NY8 A;  3CJE A;  4LF8 C;  1T5H X;  2OO4 A;  2UUB C;  2E8C A;  2BJO A;  3B7W A;  4R1M A;  4RMN A;  2P20 A;  4LF5 C;  4JI3 C;  1EGA A;  1T5D X;  1KKG A;  2UXD C;  2VSQ A;  1MD9 A;  3FCE A;  3I07 A;  2KZ0 A;  1GPM A;  3A9V A;  4B3M C;  2ZTB A;  2VZE A;  1XDX A;  2KDN A;  4I9G A;  1XRB A;  2NCL A;  2JNV A;  1V60 A;  5IWA C;  2D1Q A;  4JI1 C;  3IPL A;  4JI2 C;  5T8S A;  1N2F A;  2D7V A;  4DG8 A;  2QW0 X;  3H2T A;  2UUC C;  2M5H A;  1VEH A;  1P4E C;  2HHH C;  4BSZ A;  2CU6 A;  4G1I A;  5IT9 D;  4BC9 A;  3IEV A;  3CQ3 A;  3VNS A;  4PZP A;  5GTD A;  2CXC A;  3TUF A;  1RG9 A;  3RG2 A;  4DG9 A;  1XRC A;  5LMU C;  1QWI A;  5LCI A;  3DAY A;  4IZ6 A;  1K0R A;  5ADZ A;  3UX3 A;  1FJG C;  3TQI A;  5A19 A;  1XMO C;  1LQL A;  2D1R A;  4NXN C;  2P02 A;  2CY1 A;  2ONF A;  3NI2 A;  4NDN A;  4DCT A;  4FTF A;  4G36 A;  5BSM A;  1NYE A;  4BBY A;  3UOW A;  1IBL C;  2Y4O A;  1IBM C;  3GKU A;  4D4G A;  3ETC A;  2WP0 C;  1YGT A;  3LNV A;  3PES A;  2JMP A;  4KTT A;  3AF6 A;  4DR7 C;  3A4I A;  5BUR A;  4AQY C;  1N33 C;  2Y27 A;  4JI0 C;  5CZX A;  3OTO C;  1MXA A;  2QL8 A;  4G37 A;  3T1Y C;  3UZ0 A;  4OYC A;  4B3S C;  4DR1 C;  1HH2 P;  3LAX A;  2VQE C;  2Y4N A;  3GR1 A;  4DV5 C;  5FLX D;  1YJ7 A;  1N36 C;  4K0B A;  2ZM6 C;  4ZLP A;  4DV1 C;  3UEB A;  2WD9 A;  1ZB8 A;  1I94 C;  3GPC A;  3VNR A;  3J81 D;  3G7S A;  4DCV A;  3R9W A;  3CQ1 A;  3J80 D;  4PRO C;  4JI5 C;  4U5Y D;  2D27 A;  4GKJ C;  4GKK C;  1VLA A;  3T1H C;  3A25 A;  1O93 A;  1IB8 A;  1BA3 A;  1V26 A;  3K6R A;  4XX2 A;  4JV5 C;  5DV9 A;  2BH1 X;  4DV6 C;  1USP A;  4GXQ A;  2OBV A;  2YX1 A;  4B3R C;  4LF4 C;  3FM7 A;  4D4I A;  1QM4 A;  5AE1 A;  3EQ6 A;  4JI8 C;  3R44 A;  4LE5 A;  1MXC A;  2UU9 C;  5AE2 A;  2UXC C;  2PN2 A;  1XS3 A;  1ULT A;  4LF7 C;  2PG1 E;  5H9U A;  4DV7 C;  4PUI A;  4X66 C;  2OPL B;  2ATW A;  3TR3 A;  1FUG A;  3E7W A;  1ZB9 A;  1N32 C;  4RVO A;  1MXB A;  4MTN A;  5BR8 C;  3VNQ A;  4I9F A;  1AMU A;  4WS9 A;  2P2B A;  1MDB A;  2QVZ X;  1XMQ C;  3DLP X;  3NYR A;  4PHT A;  4EAT A;  4DCS A;  5KYV A;  3AY0 A;  4DR5 C;  1PG3 A;  1M6X C;  3O2E A;  4RVN A;  5BSU A;  5BST A;  4YY3 C;  4K0K C;  3L8C A;  2E7G A;  4DUY C;  1V25 A;  2YCB A;  3I08 A;  5K8F A;  3J7A D;  5AE3 A;  4NOZ A;  1ML8 A;  1WCJ A;  2ASB A;  4RM3 A;  3KXW A;  1PU1 A;  4GXR A;  3IEU A;  3GR0 A;  2Z51 A;  2VQF C;  4OXI A;  5BSR A;  5BUS A;  5BSV A;  1WH9 A;  4NXM C;  5KEI A;  4BC7 A;  3LNO A;  1P4E A;  2AYA A;  2E0G A;  5A1G A;  4L2Z A;  3CW8 X;  4L7I A;  4PUG A;  3E7X A;  1HNW C;  1WF3 A;  4TPS B;  4LF6 C;  4ZJZ A;  1FLO A;  1HNX C;  4KTV A;  3UX2 A;  4OX9 C;  4FUQ A;  4KHP C;  3JAM D;  3LUS A;  2YWB A;  2ZZM A;  5E7Q A;  4DCU A;  3AF5 A;  3FCC A;  4DR2 C;  3C5E A;  1O9T A;  2D1T A;  1MKY A;  4JYA C;  4DV4 C;  2MCQ A;  2HJG A;  1O92 A;  2XR1 A;  3IML A;  1MDF A;  1HR0 C;  4DV0 C;  2E8E A;  1RY2 A;  2DYJ A;  1TH5 A;  1XRA A;  3A26 A;  4JM1 A;  1XHJ A;  2D28 C;  3L95 X;  3DHV A;  4HPV A;  2P2F A; 
#chains in the Genus database with same CATH homology
 4DUZ C;  2UXB C;  2KZF A;  2UUA C;  3R9X A;  1XNR C;  4LFC C;  2P2Q A;  3CW9 A;  4JI7 C;  4ISB A;  2P2M A;  4YHH C;  4DR3 C;  1L2F A;  4RM2 A;  2E8F A;  3NYQ A;  1P7L A;  3PRO C;  2V7B A;  3S82 A;  4B3T C;  4R1L A;  2DPL A;  4WV3 A;  4DV2 C;  3PBK A;  3RV2 A;  1IBK C;  5LMN C;  2OPL A;  2E5L C;  4R0M A;  5T8T A;  4MH4 A;  4LFB C;  2EGT A;  5BSW A;  2PRO A;  1N34 C;  4LFA C;  4D57 A;  4GS5 A;  5IFI A;  4X64 C;  1HNZ C;  2YWC A;  4X65 C;  3EER A;  4DR4 C;  5CZV A;  3A9U A;  2PT7 G;  4LF9 C;  4D56 A;  2P2J A;  5A1I A;  4IR7 A;  1JOS A;  4BCA A;  5KYT A;  4L4Q A;  1XNQ C;  1UKK A;  1USP B;  1J5E C;  4X62 C;  3N2Q A;  4RLQ A;  3LGX A;  4RLF A;  5JRH A;  4DV3 C;  5BUQ A;  3NPD A;  4DR6 C;  1PA4 A;  4JI6 C;  2QVY X;  2QVX X;  1PG4 A;  1O90 A;  5K85 A;  4FUT A;  4JI4 C;  3TDE A;  2D1S A;  1LCI A;  4ODJ A;  2F4V C;  3SO4 A;  5A2Q D;  3N54 B;  3ETO A;  3CJE A;  4LF8 C;  1T5H X;  2OO4 A;  2UUB C;  2E8C A;  2BJO A;  3B7W A;  4R1M A;  4RMN A;  2P20 A;  4LF5 C;  4JI3 C;  1EGA A;  1T5D X;  1KKG A;  2UXD C;  2VSQ A;  1MD9 A;  3FCE A;  3I07 A;  1GPM A;  3A9V A;  4B3M C;  2VZE A;  4I9G A;  1XRB A;  5IWA C;  2D1Q A;  4JI1 C;  3IPL A;  4JI2 C;  5T8S A;  1N2F A;  2D7V A;  4DG8 A;  2QW0 X;  3H2T A;  2UUC C;  2HHH C;  4BSZ A;  4G1I A;  5IT9 D;  4BC9 A;  3IEV A;  3VNS A;  4PZP A;  5GTD A;  2CXC A;  3TUF A;  1RG9 A;  3RG2 A;  4DG9 A;  1XRC A;  5LMU C;  1QWI A;  3DAY A;  4IZ6 A;  1K0R A;  5ADZ A;  1FJG C;  3TQI A;  5A19 A;  1XMO C;  1LQL A;  2D1R A;  4NXN C;  2P02 A;  2CY1 A;  2ONF A;  3NI2 A;  4NDN A;  4DCT A;  4FTF A;  4G36 A;  5BSM A;  1NYE A;  4BBY A;  3UOW A;  1IBL C;  2Y4O A;  1IBM C;  3GKU A;  4D4G A;  3ETC A;  2WP0 C;  3LNV A;  3PES A;  2JMP A;  4KTT A;  3AF6 A;  4DR7 C;  3A4I A;  5BUR A;  4AQY C;  1N33 C;  2Y27 A;  4JI0 C;  5CZX A;  3OTO C;  1MXA A;  2QL8 A;  4G37 A;  3T1Y C;  3UZ0 A;  4OYC A;  4B3S C;  4DR1 C;  1HH2 P;  3LAX A;  2VQE C;  2Y4N A;  3GR1 A;  4DV5 C;  5FLX D;  1YJ7 A;  1N36 C;  4K0B A;  2ZM6 C;  4ZLP A;  4DV1 C;  2WD9 A;  1ZB8 A;  1I94 C;  3GPC A;  3VNR A;  3J81 D;  3G7S A;  4DCV A;  3R9W A;  3J80 D;  4PRO C;  4JI5 C;  4U5Y D;  2D27 A;  4GKJ C;  4GKK C;  1VLA A;  3T1H C;  1O93 A;  1BA3 A;  1V26 A;  4XX2 A;  4JV5 C;  5DV9 A;  2BH1 X;  4DV6 C;  1USP A;  4GXQ A;  2OBV A;  4B3R C;  4LF4 C;  4D4I A;  1QM4 A;  5AE1 A;  3EQ6 A;  4JI8 C;  3R44 A;  4LE5 A;  1MXC A;  2UU9 C;  5AE2 A;  2UXC C;  2PN2 A;  1ULT A;  4LF7 C;  5H9U A;  4DV7 C;  4X66 C;  2OPL B;  2ATW A;  1FUG A;  3E7W A;  1ZB9 A;  1N32 C;  4RVO A;  1MXB A;  4MTN A;  5BR8 C;  3VNQ A;  4I9F A;  1AMU A;  4WS9 A;  2P2B A;  1MDB A;  2QVZ X;  1XMQ C;  3DLP X;  3NYR A;  4PHT A;  4EAT A;  4DCS A;  5KYV A;  4DR5 C;  1PG3 A;  4RVN A;  5BSU A;  5BST A;  4YY3 C;  4K0K C;  3L8C A;  2E7G A;  4DUY C;  1V25 A;  2YCB A;  3I08 A;  5K8F A;  3J7A D;  5AE3 A;  4NOZ A;  1ML8 A;  2ASB A;  4RM3 A;  3KXW A;  4GXR A;  3IEU A;  3GR0 A;  2VQF C;  4OXI A;  5BSR A;  5BUS A;  5BSV A;  1WH9 A;  4NXM C;  5KEI A;  4BC7 A;  2AYA A;  2E0G A;  5A1G A;  4L2Z A;  3CW8 X;  4L7I A;  3E7X A;  1HNW C;  1WF3 A;  4TPS B;  4LF6 C;  4ZJZ A;  1HNX C;  4KTV A;  4OX9 C;  4FUQ A;  4KHP C;  3JAM D;  3LUS A;  2YWB A;  5E7Q A;  4DCU A;  3AF5 A;  3FCC A;  4DR2 C;  3C5E A;  1O9T A;  2D1T A;  1MKY A;  4JYA C;  4DV4 C;  2HJG A;  1O92 A;  2XR1 A;  3IML A;  1MDF A;  1HR0 C;  4DV0 C;  2E8E A;  1RY2 A;  2DYJ A;  1XRA A;  4JM1 A;  2D28 C;  3L95 X;  3DHV A;  4HPV A;  2P2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...