2UXCC

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 40
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uxcC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uxcC02
4LF5C 1IBMC 4BSZA 5LMUC 1N2FA 2KZFA 1USPB 3T1YC 4DCVA 4DR7C 4DR2C 4B3MC 2UUBC 4LFAC 4DR4C 2HJGA 3R9XA 2DYJA 2JMPA 4JI8C 4DV5C 1KKGA 1USPA 5A2QD 2CXCA 2E5LC 2F4VC 2EGTA 4DV3C 2ZM6C 4NXNC 2BJOA 1XMQC 4LF7C 3AF5A 1ML8A 4DCUA 1XNQC 1HNXC 3GKUA 2UXCC 2PT7G 4B3SC 2D7VA 4JI2C 4LF4C 3EERA 4DR5C 3IEUA 4MH4A 1JOSA 2ASBA 4XX2A 4AQYC 1N34C 4JI3C 5IWAC 4LF6C 4LF9C 4DR6C 1WH9A 5LMNC 2YCBA 4LFCC 3J7AD 1UKKA 4JI5C 4MTNA 2UUCC 3CJEA 1QWIA 4OX9C 1J5EC 4X65C 2E8FA 1MKYA 4NOZA 4DR3C 1XMOC 2ONFA 3JAMD 2HHHC 2XR1A 2UU9C 2QL8A 4JI7C 4GKJC 2UUAC 2UXDC 4DV0C 1XNRC 4DV6C 1N33C 4DUYC 1HNWC 4JYAC 4JV5C 2OPLA 1N36C 4K0KC 5BR8C 3I07A 4X64C 4X66C 1HH2P 3OTOC 4LF8C 1ZB8A 4GKKC 2VQFC 4NXMC 1L2FA 1HNZC 3IEVA 1HR0C 3AF6A 1EGAA 1PA4A 2PN2A 3J81D 4KHPC 4YY3C 1I94C 2OPLB 1WF3A 1IBKC 5FLXD 4DV2C 4B3RC 1FJGC 1N32C 1NYEA 4DV7C 4YHHC 2VQEC 2CY1A 1LQLA 1ZB9A 1IBLC 4DUZC 4DCTA 4DV4C 1K0RA 4JI0C 3T1HC 2E8CA 4X62C 4DV1C 2E7GA 2E8EA 5IT9D 4DR1C 4LFBC 4JI4C 4B3TC 3R9WA 1VLAA 3LUSA 4JI1C 2ATWA 4DCSA 2UXBC 3J80D 4JI6C
chains in the Genus database with same CATH superfamily
1M6XA 4D56A 2UUBC 4LFAC 2P20A 2DYJA 5KEIA 3K6RA 4JI8C 4DV5C 1KKGA 1USPA 3EQ6A 1UWDA 2F4VC 2EGTA 3H2TA 4G1IA 2BH1X 3LNVA 2VZEA 3UZ0A 1XMQC 1RY2A 3AF5A 1PG4A 4DCUA 1HNXC 4PROC 5ADZA 2PT7G 1P4EA 1ULTA 1FLOA 3LAXA 1QM4A 3TR3A 4DR5C 1XRAA 3UEBA 3ETCA 4LF6C 4AQYC 5E7QA 5IWAC 4LF9C 3L95X 1WH9A 2D27A 4LFCC 3J7AD 4JI5C 4GS5A 1XRBA 3CJEA 4X65C 4DR3C 4PUIA 2HHHC 4ZJZA 2Z51A 4GKJC 2YWCA 2UXDC 1HNWC 3I08A 1VEHA 3PESA 4JV5C 4WS9A 2Y4NA 4RM2A 1O93A 1O90A 4OYCA 4X64C 4BC7A 5A19A 4LF8C 4ZLPA 1HNZC 3IEVA 3E7XA 1LCIA 2PN2A 4IZ6A 3J81D 1XDXA 4KHPC 4YY3C 1I94C 3A25A 4DV2C 1NYEA 4YHHC 2VQEC 3CW9A 3FM7A 1ZB9A 3T1HC 3A9UA 4D4IA 4JI4C 4B3TC 4RMNA 1VLAA 3LUSA 4DCSA 3RV2A 4PZPA 2P02A 5AE1A 1IBMC 4R1LA 1N2FA 3UX2A 2KDNA 4B3MC 4L2ZA 3PBKA 4D4GA 4DR4C 2YWBA 4D57A 3R9XA 2CXCA 5AE2A 1O92A 4NXNC 2BJOA 1AMUA 3A9VA 1ML8A 4ISBA 2OBVA 4BC9A 2AYAA 4HPVA 2PROA 1FUGA 4I9GA 3DHVA 2QVXX 3NI2A 5BSMA 1J5EC 1MKYA 2QVZX 4ODJA 1XMOC 2ONFA 2XR1A 3A26A 2P2MA 2QL8A 3C5EA 4JI7C 4G37A 4G36A 2UUAC 3GR0A 2D1SA 1XNRC 4DV6C 4DUYC 2Y4OA 1N36C 4I9FA 1RG9A 2MM9A 3I07A 3E7WA 3LGXA 1HH2P 3OTOC 4L4QA 4KTTA 4GKKC 3N2QA 3N54B 3UX3A 1YGTA 2JNVA 1L2FA 5KYVA 3AF6A 1EGAA 1NY8A 4FTFA 2D1RA 3NPDA 3SO4A 3AY0A 3VNQA 2KZ0A 5BSRA 1MXAA 3DLPX 4BBYA 4DCTA 5H9UA 1T5DX 5IT9D 2E8EA 3G7SA 4U5YD 4JI1C 2WP0C 2CU6A 5GTDA 3UOWA 1TH5A 2QW0X 5LMUC 2D1QA 2NCLA 2WD9A 3T1YC 4DCVA 4DR2C 3KXWA 4FUTA 2HJGA 2VSQA 1T5HX 2JMPA 1P4EC 2M5OA 5A2QD 4L7IA 3FCEA 3NYQA 2E5LC 4RVOA 4NDNA 3LNOA 4R1MA 4LF7C 5CZVA 4KTVA 1XNQC 2P2FA 5T8TA 3GKUA 2OO4A 1O9TA 4WV3A 2D7VA 2Y27A 1P7LA 1BA3A 1PG3A 3GPCA 3IEUA 4MH4A 1JOSA 2ASBA 1N34C 4GXQA 4DR6C 4JI3C 1V25A 3RG2A 4GXRA 2YCBA 1UKKA 2P2JA 2P2QA 4MTNA 2ZZNA 4OX9C 2D1TA 5BUSA 2E8FA 2D28C 5A1IA 3GR1A 4EATA 2V7BA 4JM1A 2UU9C 1MDBA 3ETOA 3IMLA 4JYAC 4FUQA 4K0KC 3O2EA 3IPLA 4X66C 5BURA 3B7WA 1ZB8A 4DG8A 4R0MA 5IFIA 5KYTA 5BSTA 5LCIA 1IBKC 2YX1A 4B3RC 1N32C 4DV7C 1MDFA 2CY1A 2E0GA 1LQLA 1IBLC 3TUFA 4OXIA 3CW8X 4LFBC 5K8FA 4RM3A 5CZXA 5A1GA 4PUGA 1XHJA 2UXBC 2MCQA 4JI6C 2ATWA 1XRCA 4LF5C 1MD9A 4BSZA 3R44A 2KZFA 1USPB 4DR7C 3TQIA 3A4IA 3VNSA 4DV3C 3CQ3A 3NYRA 2ZM6C 1M6XC 5BSVA 4RLQA 4PUHA 2UXCC 4IR7A 1XS3A 4B3SC 2ZTBA 4JI2C 4LF4C 3EERA 2ZZMA 4XX2A 5BSWA 5LMNC 5K85A 3S82A 2UUCC 1QWIA 1V60A 1MXCA 1MXBA 1IB8A 4NOZA 3JAMD 3FCCA 3VNRA 1GPMA 3L8CA 5AE3A 4DV0C 2P2BA 1N33C 2M5HA 2MMAB 2OPLA 5BR8C 4LE5A 2DHMA 1YJ7A 2VQFC 4NXMC 4PHTA 1HR0C 2PG1E 1PA4A 3TDEA 2DPLA 5T8SA 2OPLB 1WF3A 4RLFA 4DG9A 5FLXD 3DAYA 4BCAA 1FJGC 1PU1A 5BUQA 1V26A 4DUZC 4DV4C 1K0RA 4JI0C 2E8CA 4X62C 4DV1C 5JRHA 2E7GA 4DR1C 3CQ2A 4K0BA 4TPSB 3PROC 2QVYX 3R9WA 4RVNA 5BSUA 3CQ1A 5DV9A 3J80D 1WCJA
chains in the Genus database with same CATH topology
4D56A 2UUBC 4LFAC 2P20A 2DYJA 5KEIA 4JI8C 4DV5C 1KKGA 1USPA 3EQ6A 2F4VC 2EGTA 3H2TA 4G1IA 2BH1X 3LNVA 2VZEA 3UZ0A 1XMQC 1RY2A 3AF5A 1PG4A 4DCUA 1HNXC 4PROC 5ADZA 2PT7G 1ULTA 3LAXA 1QM4A 4DR5C 1XRAA 3ETCA 4LF6C 4AQYC 5E7QA 5IWAC 4LF9C 3L95X 1WH9A 2D27A 4LFCC 3J7AD 4JI5C 4GS5A 1XRBA 3CJEA 4X65C 4DR3C 2HHHC 4ZJZA 4GKJC 2YWCA 2UXDC 1HNWC 3I08A 3PESA 4JV5C 4WS9A 2Y4NA 4RM2A 1O93A 1O90A 4OYCA 4X64C 4BC7A 5A19A 4LF8C 4ZLPA 1HNZC 3IEVA 3E7XA 1LCIA 2PN2A 4IZ6A 3J81D 4KHPC 4YY3C 1I94C 4DV2C 1NYEA 4YHHC 2VQEC 3CW9A 1ZB9A 3T1HC 3A9UA 4D4IA 4JI4C 4B3TC 4RMNA 1VLAA 3LUSA 4DCSA 3RV2A 4PZPA 2P02A 5AE1A 1IBMC 4R1LA 1N2FA 4B3MC 4L2ZA 3PBKA 4D4GA 4DR4C 2YWBA 4D57A 3R9XA 2CXCA 5AE2A 1O92A 4NXNC 2BJOA 1AMUA 3A9VA 1ML8A 4ISBA 2OBVA 4BC9A 2AYAA 4HPVA 2PROA 1FUGA 4I9GA 3DHVA 2QVXX 3NI2A 5BSMA 1J5EC 1MKYA 2QVZX 4ODJA 1XMOC 2ONFA 2XR1A 2P2MA 2QL8A 3C5EA 4JI7C 4G37A 4G36A 2UUAC 3GR0A 2D1SA 1XNRC 4DV6C 4DUYC 2Y4OA 1N36C 4I9FA 1RG9A 3I07A 3E7WA 3LGXA 1HH2P 3OTOC 4L4QA 4KTTA 4GKKC 3N2QA 3N54B 1L2FA 5KYVA 3AF6A 1EGAA 4FTFA 2D1RA 3NPDA 3SO4A 3VNQA 5BSRA 1MXAA 3DLPX 4BBYA 4DCTA 5H9UA 1T5DX 5IT9D 2E8EA 3G7SA 4U5YD 4JI1C 2WP0C 5GTDA 3UOWA 2QW0X 5LMUC 2D1QA 2WD9A 3T1YC 4DCVA 4DR2C 3KXWA 4FUTA 2HJGA 2VSQA 1T5HX 2JMPA 5A2QD 4L7IA 3FCEA 3NYQA 2E5LC 4RVOA 4NDNA 4R1MA 4LF7C 5CZVA 4KTVA 1XNQC 2P2FA 5T8TA 3GKUA 2OO4A 1O9TA 4WV3A 2D7VA 2Y27A 1P7LA 1BA3A 1PG3A 3GPCA 3IEUA 4MH4A 1JOSA 2ASBA 1N34C 4GXQA 4DR6C 4JI3C 1V25A 3RG2A 4GXRA 2YCBA 1UKKA 2P2JA 2P2QA 4MTNA 4OX9C 2D1TA 5BUSA 2E8FA 2D28C 5A1IA 3GR1A 4EATA 2V7BA 4JM1A 2UU9C 1MDBA 3ETOA 3IMLA 4JYAC 4FUQA 4K0KC 3IPLA 4X66C 5BURA 3B7WA 1ZB8A 4DG8A 4R0MA 5IFIA 5KYTA 5BSTA 1IBKC 4B3RC 1N32C 4DV7C 1MDFA 2CY1A 2E0GA 1LQLA 1IBLC 3TUFA 4OXIA 3CW8X 4LFBC 5K8FA 4RM3A 5CZXA 5A1GA 2UXBC 4JI6C 2ATWA 1XRCA 4LF5C 1MD9A 4BSZA 3R44A 2KZFA 1USPB 4DR7C 3TQIA 3A4IA 3VNSA 4DV3C 3NYRA 2ZM6C 5BSVA 4RLQA 2UXCC 4IR7A 4B3SC 4JI2C 4LF4C 3EERA 4XX2A 5BSWA 5LMNC 5K85A 3S82A 2UUCC 1QWIA 1MXCA 1MXBA 4NOZA 3JAMD 3FCCA 3VNRA 1GPMA 3L8CA 5AE3A 4DV0C 2P2BA 1N33C 2OPLA 5BR8C 4LE5A 1YJ7A 2VQFC 4NXMC 4PHTA 1HR0C 1PA4A 3TDEA 2DPLA 5T8SA 2OPLB 1WF3A 4RLFA 4DG9A 5FLXD 3DAYA 4BCAA 1FJGC 5BUQA 1V26A 4DUZC 4DV4C 1K0RA 4JI0C 2E8CA 4X62C 4DV1C 5JRHA 2E7GA 4DR1C 4K0BA 4TPSB 3PROC 2QVYX 3R9WA 4RVNA 5BSUA 5DV9A 3J80D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 C;  1IBM C;  4BSZ A;  5LMU C;  1N2F A;  2KZF A;  1USP B;  3T1Y C;  4DCV A;  4DR7 C;  4DR2 C;  4B3M C;  2UUB C;  4LFA C;  4DR4 C;  2HJG A;  3R9X A;  2DYJ A;  2JMP A;  4JI8 C;  4DV5 C;  1KKG A;  1USP A;  5A2Q D;  2CXC A;  2E5L C;  2F4V C;  2EGT A;  4DV3 C;  2ZM6 C;  4NXN C;  2BJO A;  1XMQ C;  4LF7 C;  3AF5 A;  1ML8 A;  4DCU A;  1XNQ C;  1HNX C;  3GKU A;  2UXC C;  2PT7 G;  4B3S C;  2D7V A;  4JI2 C;  4LF4 C;  3EER A;  4DR5 C;  3IEU A;  4MH4 A;  1JOS A;  2ASB A;  4XX2 A;  4AQY C;  1N34 C;  4JI3 C;  5IWA C;  4LF6 C;  4LF9 C;  4DR6 C;  1WH9 A;  5LMN C;  2YCB A;  4LFC C;  3J7A D;  1UKK A;  4JI5 C;  4MTN A;  2UUC C;  3CJE A;  1QWI A;  4OX9 C;  1J5E C;  4X65 C;  2E8F A;  1MKY A;  4NOZ A;  4DR3 C;  1XMO C;  2ONF A;  3JAM D;  2HHH C;  2XR1 A;  2UU9 C;  2QL8 A;  4JI7 C;  4GKJ C;  2UUA C;  2UXD C;  4DV0 C;  1XNR C;  4DV6 C;  1N33 C;  4DUY C;  1HNW C;  4JYA C;  4JV5 C;  2OPL A;  1N36 C;  4K0K C;  5BR8 C;  3I07 A;  4X64 C;  4X66 C;  1HH2 P;  3OTO C;  4LF8 C;  1ZB8 A;  4GKK C;  2VQF C;  4NXM C;  1L2F A;  1HNZ C;  3IEV A;  1HR0 C;  3AF6 A;  1EGA A;  1PA4 A;  2PN2 A;  3J81 D;  4KHP C;  4YY3 C;  1I94 C;  2OPL B;  1WF3 A;  1IBK C;  5FLX D;  4DV2 C;  4B3R C;  1FJG C;  1N32 C;  1NYE A;  4DV7 C;  4YHH C;  2VQE C;  2CY1 A;  1LQL A;  1ZB9 A;  1IBL C;  4DUZ C;  4DCT A;  4DV4 C;  1K0R A;  4JI0 C;  3T1H C;  2E8C A;  4X62 C;  4DV1 C;  2E7G A;  2E8E A;  5IT9 D;  4DR1 C;  4LFB C;  4JI4 C;  4B3T C;  3R9W A;  1VLA A;  3LUS A;  4JI1 C;  2ATW A;  4DCS A;  2UXB C;  3J80 D;  4JI6 C; 
#chains in the Genus database with same CATH topology
 1M6X A;  4D56 A;  2UUB C;  4LFA C;  2P20 A;  2DYJ A;  5KEI A;  3K6R A;  4JI8 C;  4DV5 C;  1KKG A;  1USP A;  3EQ6 A;  1UWD A;  2F4V C;  2EGT A;  3H2T A;  4G1I A;  2BH1 X;  3LNV A;  2VZE A;  3UZ0 A;  1XMQ C;  1RY2 A;  3AF5 A;  1PG4 A;  4DCU A;  1HNX C;  4PRO C;  5ADZ A;  2PT7 G;  1P4E A;  1ULT A;  1FLO A;  3LAX A;  1QM4 A;  3TR3 A;  4DR5 C;  1XRA A;  3UEB A;  3ETC A;  4LF6 C;  4AQY C;  5E7Q A;  5IWA C;  4LF9 C;  3L95 X;  1WH9 A;  2D27 A;  4LFC C;  3J7A D;  4JI5 C;  4GS5 A;  1XRB A;  3CJE A;  4X65 C;  4DR3 C;  4PUI A;  2HHH C;  4ZJZ A;  2Z51 A;  4GKJ C;  2YWC A;  2UXD C;  1HNW C;  3I08 A;  1VEH A;  3PES A;  4JV5 C;  4WS9 A;  2Y4N A;  4RM2 A;  1O93 A;  1O90 A;  4OYC A;  4X64 C;  4BC7 A;  5A19 A;  4LF8 C;  4ZLP A;  1HNZ C;  3IEV A;  3E7X A;  1LCI A;  2PN2 A;  4IZ6 A;  3J81 D;  1XDX A;  4KHP C;  4YY3 C;  1I94 C;  3A25 A;  4DV2 C;  1NYE A;  4YHH C;  2VQE C;  3CW9 A;  3FM7 A;  1ZB9 A;  3T1H C;  3A9U A;  4D4I A;  4JI4 C;  4B3T C;  4RMN A;  1VLA A;  3LUS A;  4DCS A;  3RV2 A;  4PZP A;  2P02 A;  5AE1 A;  1IBM C;  4R1L A;  1N2F A;  3UX2 A;  2KDN A;  4B3M C;  4L2Z A;  3PBK A;  4D4G A;  4DR4 C;  2YWB A;  4D57 A;  3R9X A;  2CXC A;  5AE2 A;  1O92 A;  4NXN C;  2BJO A;  1AMU A;  3A9V A;  1ML8 A;  4ISB A;  2OBV A;  4BC9 A;  2AYA A;  4HPV A;  2PRO A;  1FUG A;  4I9G A;  3DHV A;  2QVX X;  3NI2 A;  5BSM A;  1J5E C;  1MKY A;  2QVZ X;  4ODJ A;  1XMO C;  2ONF A;  2XR1 A;  3A26 A;  2P2M A;  2QL8 A;  3C5E A;  4JI7 C;  4G37 A;  4G36 A;  2UUA C;  3GR0 A;  2D1S A;  1XNR C;  4DV6 C;  4DUY C;  2Y4O A;  1N36 C;  4I9F A;  1RG9 A;  2MM9 A;  3I07 A;  3E7W A;  3LGX A;  1HH2 P;  3OTO C;  4L4Q A;  4KTT A;  4GKK C;  3N2Q A;  3N54 B;  3UX3 A;  1YGT A;  2JNV A;  1L2F A;  5KYV A;  3AF6 A;  1EGA A;  1NY8 A;  4FTF A;  2D1R A;  3NPD A;  3SO4 A;  3AY0 A;  3VNQ A;  2KZ0 A;  5BSR A;  1MXA A;  3DLP X;  4BBY A;  4DCT A;  5H9U A;  1T5D X;  5IT9 D;  2E8E A;  3G7S A;  4U5Y D;  4JI1 C;  2WP0 C;  2CU6 A;  5GTD A;  3UOW A;  1TH5 A;  2QW0 X;  5LMU C;  2D1Q A;  2NCL A;  2WD9 A;  3T1Y C;  4DCV A;  4DR2 C;  3KXW A;  4FUT A;  2HJG A;  2VSQ A;  1T5H X;  2JMP A;  1P4E C;  2M5O A;  5A2Q D;  4L7I A;  3FCE A;  3NYQ A;  2E5L C;  4RVO A;  4NDN A;  3LNO A;  4R1M A;  4LF7 C;  5CZV A;  4KTV A;  1XNQ C;  2P2F A;  5T8T A;  3GKU A;  2OO4 A;  1O9T A;  4WV3 A;  2D7V A;  2Y27 A;  1P7L A;  1BA3 A;  1PG3 A;  3GPC A;  3IEU A;  4MH4 A;  1JOS A;  2ASB A;  1N34 C;  4GXQ A;  4DR6 C;  4JI3 C;  1V25 A;  3RG2 A;  4GXR A;  2YCB A;  1UKK A;  2P2J A;  2P2Q A;  4MTN A;  2ZZN A;  4OX9 C;  2D1T A;  5BUS A;  2E8F A;  2D28 C;  5A1I A;  3GR1 A;  4EAT A;  2V7B A;  4JM1 A;  2UU9 C;  1MDB A;  3ETO A;  3IML A;  4JYA C;  4FUQ A;  4K0K C;  3O2E A;  3IPL A;  4X66 C;  5BUR A;  3B7W A;  1ZB8 A;  4DG8 A;  4R0M A;  5IFI A;  5KYT A;  5BST A;  5LCI A;  1IBK C;  2YX1 A;  4B3R C;  1N32 C;  4DV7 C;  1MDF A;  2CY1 A;  2E0G A;  1LQL A;  1IBL C;  3TUF A;  4OXI A;  3CW8 X;  4LFB C;  5K8F A;  4RM3 A;  5CZX A;  5A1G A;  4PUG A;  1XHJ A;  2UXB C;  2MCQ A;  4JI6 C;  2ATW A;  1XRC A;  4LF5 C;  1MD9 A;  4BSZ A;  3R44 A;  2KZF A;  1USP B;  4DR7 C;  3TQI A;  3A4I A;  3VNS A;  4DV3 C;  3CQ3 A;  3NYR A;  2ZM6 C;  1M6X C;  5BSV A;  4RLQ A;  4PUH A;  2UXC C;  4IR7 A;  1XS3 A;  4B3S C;  2ZTB A;  4JI2 C;  4LF4 C;  3EER A;  2ZZM A;  4XX2 A;  5BSW A;  5LMN C;  5K85 A;  3S82 A;  2UUC C;  1QWI A;  1V60 A;  1MXC A;  1MXB A;  1IB8 A;  4NOZ A;  3JAM D;  3FCC A;  3VNR A;  1GPM A;  3L8C A;  5AE3 A;  4DV0 C;  2P2B A;  1N33 C;  2M5H A;  2MMA B;  2OPL A;  5BR8 C;  4LE5 A;  2DHM A;  1YJ7 A;  2VQF C;  4NXM C;  4PHT A;  1HR0 C;  2PG1 E;  1PA4 A;  3TDE A;  2DPL A;  5T8S A;  2OPL B;  1WF3 A;  4RLF A;  4DG9 A;  5FLX D;  3DAY A;  4BCA A;  1FJG C;  1PU1 A;  5BUQ A;  1V26 A;  4DUZ C;  4DV4 C;  1K0R A;  4JI0 C;  2E8C A;  4X62 C;  4DV1 C;  5JRH A;  2E7G A;  4DR1 C;  3CQ2 A;  4K0B A;  4TPS B;  3PRO C;  2QVY X;  3R9W A;  4RVN A;  5BSU A;  3CQ1 A;  5DV9 A;  3J80 D;  1WCJ A; 
#chains in the Genus database with same CATH homology
 4D56 A;  2UUB C;  4LFA C;  2P20 A;  2DYJ A;  5KEI A;  4JI8 C;  4DV5 C;  1KKG A;  1USP A;  3EQ6 A;  2F4V C;  2EGT A;  3H2T A;  4G1I A;  2BH1 X;  3LNV A;  2VZE A;  3UZ0 A;  1XMQ C;  1RY2 A;  3AF5 A;  1PG4 A;  4DCU A;  1HNX C;  4PRO C;  5ADZ A;  2PT7 G;  1ULT A;  3LAX A;  1QM4 A;  4DR5 C;  1XRA A;  3ETC A;  4LF6 C;  4AQY C;  5E7Q A;  5IWA C;  4LF9 C;  3L95 X;  1WH9 A;  2D27 A;  4LFC C;  3J7A D;  4JI5 C;  4GS5 A;  1XRB A;  3CJE A;  4X65 C;  4DR3 C;  2HHH C;  4ZJZ A;  4GKJ C;  2YWC A;  2UXD C;  1HNW C;  3I08 A;  3PES A;  4JV5 C;  4WS9 A;  2Y4N A;  4RM2 A;  1O93 A;  1O90 A;  4OYC A;  4X64 C;  4BC7 A;  5A19 A;  4LF8 C;  4ZLP A;  1HNZ C;  3IEV A;  3E7X A;  1LCI A;  2PN2 A;  4IZ6 A;  3J81 D;  4KHP C;  4YY3 C;  1I94 C;  4DV2 C;  1NYE A;  4YHH C;  2VQE C;  3CW9 A;  1ZB9 A;  3T1H C;  3A9U A;  4D4I A;  4JI4 C;  4B3T C;  4RMN A;  1VLA A;  3LUS A;  4DCS A;  3RV2 A;  4PZP A;  2P02 A;  5AE1 A;  1IBM C;  4R1L A;  1N2F A;  4B3M C;  4L2Z A;  3PBK A;  4D4G A;  4DR4 C;  2YWB A;  4D57 A;  3R9X A;  2CXC A;  5AE2 A;  1O92 A;  4NXN C;  2BJO A;  1AMU A;  3A9V A;  1ML8 A;  4ISB A;  2OBV A;  4BC9 A;  2AYA A;  4HPV A;  2PRO A;  1FUG A;  4I9G A;  3DHV A;  2QVX X;  3NI2 A;  5BSM A;  1J5E C;  1MKY A;  2QVZ X;  4ODJ A;  1XMO C;  2ONF A;  2XR1 A;  2P2M A;  2QL8 A;  3C5E A;  4JI7 C;  4G37 A;  4G36 A;  2UUA C;  3GR0 A;  2D1S A;  1XNR C;  4DV6 C;  4DUY C;  2Y4O A;  1N36 C;  4I9F A;  1RG9 A;  3I07 A;  3E7W A;  3LGX A;  1HH2 P;  3OTO C;  4L4Q A;  4KTT A;  4GKK C;  3N2Q A;  3N54 B;  1L2F A;  5KYV A;  3AF6 A;  1EGA A;  4FTF A;  2D1R A;  3NPD A;  3SO4 A;  3VNQ A;  5BSR A;  1MXA A;  3DLP X;  4BBY A;  4DCT A;  5H9U A;  1T5D X;  5IT9 D;  2E8E A;  3G7S A;  4U5Y D;  4JI1 C;  2WP0 C;  5GTD A;  3UOW A;  2QW0 X;  5LMU C;  2D1Q A;  2WD9 A;  3T1Y C;  4DCV A;  4DR2 C;  3KXW A;  4FUT A;  2HJG A;  2VSQ A;  1T5H X;  2JMP A;  5A2Q D;  4L7I A;  3FCE A;  3NYQ A;  2E5L C;  4RVO A;  4NDN A;  4R1M A;  4LF7 C;  5CZV A;  4KTV A;  1XNQ C;  2P2F A;  5T8T A;  3GKU A;  2OO4 A;  1O9T A;  4WV3 A;  2D7V A;  2Y27 A;  1P7L A;  1BA3 A;  1PG3 A;  3GPC A;  3IEU A;  4MH4 A;  1JOS A;  2ASB A;  1N34 C;  4GXQ A;  4DR6 C;  4JI3 C;  1V25 A;  3RG2 A;  4GXR A;  2YCB A;  1UKK A;  2P2J A;  2P2Q A;  4MTN A;  4OX9 C;  2D1T A;  5BUS A;  2E8F A;  2D28 C;  5A1I A;  3GR1 A;  4EAT A;  2V7B A;  4JM1 A;  2UU9 C;  1MDB A;  3ETO A;  3IML A;  4JYA C;  4FUQ A;  4K0K C;  3IPL A;  4X66 C;  5BUR A;  3B7W A;  1ZB8 A;  4DG8 A;  4R0M A;  5IFI A;  5KYT A;  5BST A;  1IBK C;  4B3R C;  1N32 C;  4DV7 C;  1MDF A;  2CY1 A;  2E0G A;  1LQL A;  1IBL C;  3TUF A;  4OXI A;  3CW8 X;  4LFB C;  5K8F A;  4RM3 A;  5CZX A;  5A1G A;  2UXB C;  4JI6 C;  2ATW A;  1XRC A;  4LF5 C;  1MD9 A;  4BSZ A;  3R44 A;  2KZF A;  1USP B;  4DR7 C;  3TQI A;  3A4I A;  3VNS A;  4DV3 C;  3NYR A;  2ZM6 C;  5BSV A;  4RLQ A;  2UXC C;  4IR7 A;  4B3S C;  4JI2 C;  4LF4 C;  3EER A;  4XX2 A;  5BSW A;  5LMN C;  5K85 A;  3S82 A;  2UUC C;  1QWI A;  1MXC A;  1MXB A;  4NOZ A;  3JAM D;  3FCC A;  3VNR A;  1GPM A;  3L8C A;  5AE3 A;  4DV0 C;  2P2B A;  1N33 C;  2OPL A;  5BR8 C;  4LE5 A;  1YJ7 A;  2VQF C;  4NXM C;  4PHT A;  1HR0 C;  1PA4 A;  3TDE A;  2DPL A;  5T8S A;  2OPL B;  1WF3 A;  4RLF A;  4DG9 A;  5FLX D;  3DAY A;  4BCA A;  1FJG C;  5BUQ A;  1V26 A;  4DUZ C;  4DV4 C;  1K0R A;  4JI0 C;  2E8C A;  4X62 C;  4DV1 C;  5JRH A;  2E7G A;  4DR1 C;  4K0B A;  4TPS B;  3PRO C;  2QVY X;  3R9W A;  4RVN A;  5BSU A;  5DV9 A;  3J80 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...