2UXCC

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 40
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uxcC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uxcC02
3EERA 4DCVA 4JI0C 4JV5C 4DR4C 2JMPA 4AQYC 4JI2C 2YCBA 1IBMC 4LF7C 1L2FA 2UUBC 2UXDC 4JI4C 1USPA 1HNXC 1HNWC 1LQLA 3J81D 4DR5C 3JAMD 4LF8C 4NOZA 4YHHC 1KKGA 2ASBA 4JYAC 4OX9C 4DV4C 1I94C 4LFCC 4XX2A 1N36C 2EGTA 2KZFA 4BSZA 1USPB 3J7AD 4DV5C 2UXCC 1VLAA 4LF6C 2OPLA 2CY1A 4JI6C 3GKUA 1HH2P 3T1YC 1WH9A 4X62C 4DV6C 2PN2A 4DR3C 2PT7G 3OTOC 2UXBC 4GKKC 3AF5A 1N32C 4KHPC 1WF3A 2BJOA 5LMNC 3I07A 1HNZC 1MKYA 4X64C 4MTNA 1N33C 1ZB9A 4DCTA 4LF4C 5A2QD 1N2FA 4K0KC 4JI8C 1N34C 3CJEA 4DV2C 4DR1C 4DV0C 2DYJA 1IBLC 2VQEC 5BR8C 4DV3C 5IT9D 2VQFC 5IWAC 2E7GA 1J5EC 4GKJC 3J80D 2F4VC 4B3SC 2UU9C 1QWIA 1XNQC 2CXCA 1XMQC 3R9WA 1FJGC 4MH4A 1UKKA 4DCSA 1IBKC 2UUCC 4JI1C 1EGAA 4DR6C 4NXNC 2HHHC 4DR2C 2UUAC 4DUYC 3IEUA 2HJGA 2OPLB 1NYEA 2ONFA 2E8CA 4LF9C 3LUSA 4X65C 4DR7C 2QL8A 4DCUA 4LF5C 2ZM6C 4DV7C 2D7VA 4NXMC 4YY3C 1ZB8A 2ATWA 1PA4A 2E5LC 3IEVA 4LFBC 3AF6A 2XR1A 5LMUC 4DV1C 3T1HC 4B3MC 4X66C 1ML8A 4B3TC 4B3RC 3R9XA 1JOSA 2E8EA 1K0RA 1XMOC 4JI5C 5FLXD 4LFAC 1XNRC 4JI3C 2E8FA 4JI7C 4DUZC 1HR0C
chains in the Genus database with same CATH superfamily
4JI0C 2D1TA 5T8TA 4KTVA 2JMPA 3CW8X 3NYQA 4R0MA 2UXDC 3UZ0A 2P20A 4RLFA 1XDXA 4YHHC 1MXBA 4GXRA 2PROA 5A19A 1I94C 4PZPA 3PBKA 3I08A 1N36C 2EGTA 2MCQA 2QVYX 1O9TA 4DV5C 1ULTA 1VLAA 4LF6C 2OPLA 4PROC 3GKUA 3T1YC 2PG1E 2OBVA 3H2TA 5BSWA 2D1RA 1N32C 4KHPC 2ZTBA 2BJOA 3A9VA 2MM9A 3I07A 5LMNC 1O90A 1HNZC 4BC9A 2P2FA 5A2QD 1PG4A 1N2FA 2D28C 4K0KC 3TDEA 4JI8C 1V60A 1N34C 3TR3A 4I9GA 3LAXA 5BR8C 5IT9D 5IWAC 2E7GA 4JM1A 1J5EC 4GKJC 4FUTA 1P4EA 3NYRA 1QWIA 2ZZMA 4RMNA 1UKKA 2UUCC 1T5DX 4DUYC 3DHVA 4LF9C 2E8CA 3EQ6A 4DR7C 3E7WA 2ZM6C 4WS9A 2D7VA 4NXMC 1MXCA 5CZVA 1PA4A 4OXIA 4D57A 2E5LC 3NI2A 1NY8A 3CQ1A 5BUSA 1ML8A 4BC7A 3CQ2A 1XNRC 4JI7C 2YWBA 1HR0C 3EERA 3G7SA 3A4IA 4DR4C 4G1IA 1M6XC 4AQYC 2YCBA 4LF7C 1AMUA 2UUBC 1FLOA 1LQLA 3J81D 1XRBA 5BSRA 5BURA 4LF8C 2AYAA 2YX1A 1UWDA 3A9UA 1KKGA 1XRCA 1BA3A 4JYAC 4OX9C 4DV4C 2D27A 5BSVA 2KZFA 3CQ3A 2CY1A 5LCIA 1LCIA 4HPVA 5H9UA 3GPCA 1RG9A 4DR3C 3OTOC 2UXBC 3ETCA 2OO4A 4GKKC 1O92A 2MMAB 2P2QA 4RVNA 5E7QA 4DCTA 4I9FA 4GS5A 2KDNA 4DV0C 1GPMA 2VQFC 1XHJA 4KTTA 5CZXA 5DV9A 2F4VC 3K6RA 4B3SC 5IFIA 3NPDA 3PROC 4IZ6A 5BSMA 2QVXX 1EGAA 2HHHC 4R1MA 5T8SA 1YJ7A 2QW0X 3IEUA 2OPLB 1NYEA 3LGXA 4PUGA 3E7XA 4LF5C 4DCUA 1MD9A 3UOWA 4YY3C 3IEVA 3VNRA 1IB8A 2CU6A 5LMUC 2NCLA 3T1HC 1FUGA 4X66C 4B3RC 3L95X 4DG9A 1JOSA 1K0RA 1XMOC 4JI5C 5FLXD 2BH1X 4JI3C 2E8FA 4DUZC 3CW9A 4PHTA 4IR7A 2YWCA 4JV5C 3KXWA 3VNSA 4K0BA 5BSTA 1IBMC 5KYTA 5AE3A 2WD9A 2DPLA 2Y27A 1T5HX 1RY2A 1V25A 2P2MA 4G37A 4GXQA 2ZZNA 1XRAA 1HNWC 2VSQA 4D4IA 4D4GA 3RV2A 5ADZA 3RG2A 3AY0A 4U5YD 4LFCC 1O93A 1XS3A 4XX2A 4BSZA 3J7AD 3S82A 2UXCC 4ODJA 3A25A 4JI6C 5K85A 1V26A 3AF5A 5BUQA 4ZLPA 1MKYA 2WP0C 4X64C 4MTNA 1ZB9A 3DAYA 1MDFA 3CJEA 2QVZX 1VEHA 3UX3A 2DYJA 1IBLC 2E0GA 2VQEC 1MXAA 3DLPX 4R1LA 4RVOA 2UU9C 3A26A 4ZJZA 3FCCA 1FJGC 4MH4A 4NDNA 4DCSA 4RM3A 1IBKC 4DR6C 4NXNC 4DR2C 3FM7A 5AE1A 2M5OA 1PU1A 4L7IA 5A1GA 4FUQA 3R44A 3LUSA 3LNOA 2P02A 4G36A 2QL8A 5A1IA 4DV7C 2Y4OA 2D1SA 2ATWA 4TPSB 4LFBC 3AF6A 5KEIA 3VNQA 4EATA 4B3MC 4B3TC 4DG8A 3R9XA 2E8EA 3N2QA 5GTDA 4DCVA 1P4EC 2V7BA 4JI2C 4LE5A 2Y4NA 1L2FA 3SO4A 4PUHA 4JI4C 1USPA 1HNXC 5AE2A 4DR5C 4OYCA 2VZEA 3JAMD 4NOZA 3C5EA 2Z51A 3N54B 4ISBA 1MDBA 2ASBA 2DHMA 1PG3A 2P2JA 1USPB 4PUIA 3O2EA 1HH2P 5KYVA 1WH9A 4X62C 4DV6C 2PN2A 1YGTA 2PT7G 3TQIA 5BSUA 1WF3A 5JRHA 1N33C 4D56A 4LF4C 1WCJA 5K8FA 3GR0A 4DV2C 4DR1C 3IMLA 4FTFA 4BCAA 4DV3C 3J80D 3B7WA 3UEBA 3LNVA 4RLQA 2JNVA 3UX2A 4L4QA 1XNQC 2CXCA 1XMQC 1QM4A 3R9WA 1TH5A 3PESA 4JI1C 4WV3A 1M6XA 1P7LA 2UUAC 2HJGA 2KZ0A 3L8CA 2ONFA 4X65C 4BBYA 4L2ZA 1ZB8A 3GR1A 2M5HA 2XR1A 4DV1C 2D1QA 2P2BA 4RM2A 4LFAC 3FCEA 3TUFA 3ETOA 3IPLA
chains in the Genus database with same CATH topology
4JI0C 2D1TA 5T8TA 4KTVA 2JMPA 3CW8X 3NYQA 4R0MA 2UXDC 3UZ0A 2P20A 4RLFA 4YHHC 1MXBA 4GXRA 2PROA 5A19A 1I94C 4PZPA 3PBKA 3I08A 1N36C 2EGTA 2QVYX 1O9TA 4DV5C 1ULTA 1VLAA 4LF6C 2OPLA 4PROC 3GKUA 3T1YC 2OBVA 3H2TA 5BSWA 2D1RA 1N32C 4KHPC 2BJOA 3A9VA 5LMNC 3I07A 1O90A 1HNZC 4BC9A 2P2FA 5A2QD 1PG4A 1N2FA 2D28C 4K0KC 3TDEA 4JI8C 1N34C 4I9GA 3LAXA 5BR8C 5IT9D 5IWAC 2E7GA 4JM1A 1J5EC 4GKJC 4FUTA 3NYRA 1QWIA 4RMNA 1UKKA 2UUCC 1T5DX 4DUYC 3DHVA 4LF9C 2E8CA 3EQ6A 4DR7C 3E7WA 2ZM6C 4WS9A 2D7VA 4NXMC 1MXCA 5CZVA 1PA4A 4OXIA 4D57A 2E5LC 3NI2A 5BUSA 1ML8A 4BC7A 1XNRC 4JI7C 1HR0C 2YWBA 3EERA 3G7SA 3A4IA 4DR4C 4G1IA 4AQYC 2YCBA 4LF7C 1AMUA 2UUBC 1LQLA 3J81D 1XRBA 5BSRA 5BURA 4LF8C 2AYAA 3A9UA 1KKGA 1XRCA 1BA3A 4JYAC 4OX9C 4DV4C 2D27A 5BSVA 2KZFA 2CY1A 1LCIA 4HPVA 5H9UA 3GPCA 1RG9A 4DR3C 3OTOC 2UXBC 3ETCA 2OO4A 4GKKC 1O92A 2P2QA 4RVNA 5E7QA 4DCTA 4I9FA 4GS5A 4DV0C 1GPMA 2VQFC 4KTTA 5CZXA 5DV9A 2F4VC 4B3SC 5IFIA 3NPDA 3PROC 4IZ6A 5BSMA 2QVXX 1EGAA 2HHHC 4R1MA 5T8SA 1YJ7A 2QW0X 3IEUA 2OPLB 1NYEA 3LGXA 3E7XA 4LF5C 4DCUA 1MD9A 3UOWA 4YY3C 3IEVA 3VNRA 5LMUC 3T1HC 1FUGA 4X66C 4B3RC 3L95X 4DG9A 1JOSA 1K0RA 1XMOC 4JI5C 5FLXD 2BH1X 4JI3C 2E8FA 4DUZC 3CW9A 4PHTA 4IR7A 2YWCA 4JV5C 3KXWA 3VNSA 4K0BA 5BSTA 1IBMC 5KYTA 5AE3A 2WD9A 2DPLA 2Y27A 1T5HX 1RY2A 1V25A 2P2MA 4G37A 4GXQA 1HNWC 1XRAA 2VSQA 4D4IA 4D4GA 3RV2A 5ADZA 3RG2A 4U5YD 4LFCC 1O93A 4XX2A 4BSZA 3J7AD 3S82A 2UXCC 4ODJA 4JI6C 5K85A 1V26A 3AF5A 5BUQA 4ZLPA 1MKYA 2WP0C 4X64C 4MTNA 1ZB9A 3DAYA 1MDFA 3CJEA 2QVZX 2DYJA 1IBLC 2E0GA 2VQEC 1MXAA 3DLPX 4R1LA 4RVOA 2UU9C 4ZJZA 3FCCA 1FJGC 4MH4A 4NDNA 4DCSA 4RM3A 1IBKC 4DR6C 4NXNC 4DR2C 5AE1A 4L7IA 5A1GA 4FUQA 3R44A 3LUSA 4G36A 2P02A 2QL8A 5A1IA 4DV7C 2Y4OA 2D1SA 2ATWA 4TPSB 4LFBC 3AF6A 5KEIA 3VNQA 4EATA 4B3MC 4B3TC 4DG8A 3R9XA 2E8EA 3N2QA 5GTDA 4DCVA 2V7BA 4JI2C 4LE5A 2Y4NA 1L2FA 3SO4A 4JI4C 1USPA 1HNXC 5AE2A 4DR5C 4OYCA 2VZEA 3JAMD 4NOZA 3C5EA 3N54B 4ISBA 1MDBA 2ASBA 1PG3A 2P2JA 1USPB 1HH2P 5KYVA 1WH9A 4X62C 4DV6C 2PN2A 2PT7G 3TQIA 5BSUA 1WF3A 5JRHA 1N33C 4D56A 4LF4C 5K8FA 3GR0A 4DV2C 4DR1C 3IMLA 4FTFA 4BCAA 4DV3C 3J80D 3B7WA 3LNVA 4RLQA 4L4QA 1XNQC 2CXCA 1XMQC 1QM4A 3R9WA 3PESA 4JI1C 4WV3A 1P7LA 2UUAC 2HJGA 3L8CA 2ONFA 4X65C 4BBYA 4L2ZA 1ZB8A 3GR1A 2XR1A 4DV1C 2D1QA 2P2BA 4RM2A 4LFAC 3FCEA 3TUFA 3ETOA 3IPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EER A;  4DCV A;  4JI0 C;  4JV5 C;  4DR4 C;  2JMP A;  4AQY C;  4JI2 C;  2YCB A;  1IBM C;  4LF7 C;  1L2F A;  2UUB C;  2UXD C;  4JI4 C;  1USP A;  1HNX C;  1HNW C;  1LQL A;  3J81 D;  4DR5 C;  3JAM D;  4LF8 C;  4NOZ A;  4YHH C;  1KKG A;  2ASB A;  4JYA C;  4OX9 C;  4DV4 C;  1I94 C;  4LFC C;  4XX2 A;  1N36 C;  2EGT A;  2KZF A;  4BSZ A;  1USP B;  3J7A D;  4DV5 C;  2UXC C;  1VLA A;  4LF6 C;  2OPL A;  2CY1 A;  4JI6 C;  3GKU A;  1HH2 P;  3T1Y C;  1WH9 A;  4X62 C;  4DV6 C;  2PN2 A;  4DR3 C;  2PT7 G;  3OTO C;  2UXB C;  4GKK C;  3AF5 A;  1N32 C;  4KHP C;  1WF3 A;  2BJO A;  5LMN C;  3I07 A;  1HNZ C;  1MKY A;  4X64 C;  4MTN A;  1N33 C;  1ZB9 A;  4DCT A;  4LF4 C;  5A2Q D;  1N2F A;  4K0K C;  4JI8 C;  1N34 C;  3CJE A;  4DV2 C;  4DR1 C;  4DV0 C;  2DYJ A;  1IBL C;  2VQE C;  5BR8 C;  4DV3 C;  5IT9 D;  2VQF C;  5IWA C;  2E7G A;  1J5E C;  4GKJ C;  3J80 D;  2F4V C;  4B3S C;  2UU9 C;  1QWI A;  1XNQ C;  2CXC A;  1XMQ C;  3R9W A;  1FJG C;  4MH4 A;  1UKK A;  4DCS A;  1IBK C;  2UUC C;  4JI1 C;  1EGA A;  4DR6 C;  4NXN C;  2HHH C;  4DR2 C;  2UUA C;  4DUY C;  3IEU A;  2HJG A;  2OPL B;  1NYE A;  2ONF A;  2E8C A;  4LF9 C;  3LUS A;  4X65 C;  4DR7 C;  2QL8 A;  4DCU A;  4LF5 C;  2ZM6 C;  4DV7 C;  2D7V A;  4NXM C;  4YY3 C;  1ZB8 A;  2ATW A;  1PA4 A;  2E5L C;  3IEV A;  4LFB C;  3AF6 A;  2XR1 A;  5LMU C;  4DV1 C;  3T1H C;  4B3M C;  4X66 C;  1ML8 A;  4B3T C;  4B3R C;  3R9X A;  1JOS A;  2E8E A;  1K0R A;  1XMO C;  4JI5 C;  5FLX D;  4LFA C;  1XNR C;  4JI3 C;  2E8F A;  4JI7 C;  4DUZ C;  1HR0 C; 
#chains in the Genus database with same CATH topology
 4JI0 C;  2D1T A;  5T8T A;  4KTV A;  2JMP A;  3CW8 X;  3NYQ A;  4R0M A;  2UXD C;  3UZ0 A;  2P20 A;  4RLF A;  1XDX A;  4YHH C;  1MXB A;  4GXR A;  2PRO A;  5A19 A;  1I94 C;  4PZP A;  3PBK A;  3I08 A;  1N36 C;  2EGT A;  2MCQ A;  2QVY X;  1O9T A;  4DV5 C;  1ULT A;  1VLA A;  4LF6 C;  2OPL A;  4PRO C;  3GKU A;  3T1Y C;  2PG1 E;  2OBV A;  3H2T A;  5BSW A;  2D1R A;  1N32 C;  4KHP C;  2ZTB A;  2BJO A;  3A9V A;  2MM9 A;  3I07 A;  5LMN C;  1O90 A;  1HNZ C;  4BC9 A;  2P2F A;  5A2Q D;  1PG4 A;  1N2F A;  2D28 C;  4K0K C;  3TDE A;  4JI8 C;  1V60 A;  1N34 C;  3TR3 A;  4I9G A;  3LAX A;  5BR8 C;  5IT9 D;  5IWA C;  2E7G A;  4JM1 A;  1J5E C;  4GKJ C;  4FUT A;  1P4E A;  3NYR A;  1QWI A;  2ZZM A;  4RMN A;  1UKK A;  2UUC C;  1T5D X;  4DUY C;  3DHV A;  4LF9 C;  2E8C A;  3EQ6 A;  4DR7 C;  3E7W A;  2ZM6 C;  4WS9 A;  2D7V A;  4NXM C;  1MXC A;  5CZV A;  1PA4 A;  4OXI A;  4D57 A;  2E5L C;  3NI2 A;  1NY8 A;  3CQ1 A;  5BUS A;  1ML8 A;  4BC7 A;  3CQ2 A;  1XNR C;  4JI7 C;  2YWB A;  1HR0 C;  3EER A;  3G7S A;  3A4I A;  4DR4 C;  4G1I A;  1M6X C;  4AQY C;  2YCB A;  4LF7 C;  1AMU A;  2UUB C;  1FLO A;  1LQL A;  3J81 D;  1XRB A;  5BSR A;  5BUR A;  4LF8 C;  2AYA A;  2YX1 A;  1UWD A;  3A9U A;  1KKG A;  1XRC A;  1BA3 A;  4JYA C;  4OX9 C;  4DV4 C;  2D27 A;  5BSV A;  2KZF A;  3CQ3 A;  2CY1 A;  5LCI A;  1LCI A;  4HPV A;  5H9U A;  3GPC A;  1RG9 A;  4DR3 C;  3OTO C;  2UXB C;  3ETC A;  2OO4 A;  4GKK C;  1O92 A;  2MMA B;  2P2Q A;  4RVN A;  5E7Q A;  4DCT A;  4I9F A;  4GS5 A;  2KDN A;  4DV0 C;  1GPM A;  2VQF C;  1XHJ A;  4KTT A;  5CZX A;  5DV9 A;  2F4V C;  3K6R A;  4B3S C;  5IFI A;  3NPD A;  3PRO C;  4IZ6 A;  5BSM A;  2QVX X;  1EGA A;  2HHH C;  4R1M A;  5T8S A;  1YJ7 A;  2QW0 X;  3IEU A;  2OPL B;  1NYE A;  3LGX A;  4PUG A;  3E7X A;  4LF5 C;  4DCU A;  1MD9 A;  3UOW A;  4YY3 C;  3IEV A;  3VNR A;  1IB8 A;  2CU6 A;  5LMU C;  2NCL A;  3T1H C;  1FUG A;  4X66 C;  4B3R C;  3L95 X;  4DG9 A;  1JOS A;  1K0R A;  1XMO C;  4JI5 C;  5FLX D;  2BH1 X;  4JI3 C;  2E8F A;  4DUZ C;  3CW9 A;  4PHT A;  4IR7 A;  2YWC A;  4JV5 C;  3KXW A;  3VNS A;  4K0B A;  5BST A;  1IBM C;  5KYT A;  5AE3 A;  2WD9 A;  2DPL A;  2Y27 A;  1T5H X;  1RY2 A;  1V25 A;  2P2M A;  4G37 A;  4GXQ A;  2ZZN A;  1XRA A;  1HNW C;  2VSQ A;  4D4I A;  4D4G A;  3RV2 A;  5ADZ A;  3RG2 A;  3AY0 A;  4U5Y D;  4LFC C;  1O93 A;  1XS3 A;  4XX2 A;  4BSZ A;  3J7A D;  3S82 A;  2UXC C;  4ODJ A;  3A25 A;  4JI6 C;  5K85 A;  1V26 A;  3AF5 A;  5BUQ A;  4ZLP A;  1MKY A;  2WP0 C;  4X64 C;  4MTN A;  1ZB9 A;  3DAY A;  1MDF A;  3CJE A;  2QVZ X;  1VEH A;  3UX3 A;  2DYJ A;  1IBL C;  2E0G A;  2VQE C;  1MXA A;  3DLP X;  4R1L A;  4RVO A;  2UU9 C;  3A26 A;  4ZJZ A;  3FCC A;  1FJG C;  4MH4 A;  4NDN A;  4DCS A;  4RM3 A;  1IBK C;  4DR6 C;  4NXN C;  4DR2 C;  3FM7 A;  5AE1 A;  2M5O A;  1PU1 A;  4L7I A;  5A1G A;  4FUQ A;  3R44 A;  3LUS A;  3LNO A;  2P02 A;  4G36 A;  2QL8 A;  5A1I A;  4DV7 C;  2Y4O A;  2D1S A;  2ATW A;  4TPS B;  4LFB C;  3AF6 A;  5KEI A;  3VNQ A;  4EAT A;  4B3M C;  4B3T C;  4DG8 A;  3R9X A;  2E8E A;  3N2Q A;  5GTD A;  4DCV A;  1P4E C;  2V7B A;  4JI2 C;  4LE5 A;  2Y4N A;  1L2F A;  3SO4 A;  4PUH A;  4JI4 C;  1USP A;  1HNX C;  5AE2 A;  4DR5 C;  4OYC A;  2VZE A;  3JAM D;  4NOZ A;  3C5E A;  2Z51 A;  3N54 B;  4ISB A;  1MDB A;  2ASB A;  2DHM A;  1PG3 A;  2P2J A;  1USP B;  4PUI A;  3O2E A;  1HH2 P;  5KYV A;  1WH9 A;  4X62 C;  4DV6 C;  2PN2 A;  1YGT A;  2PT7 G;  3TQI A;  5BSU A;  1WF3 A;  5JRH A;  1N33 C;  4D56 A;  4LF4 C;  1WCJ A;  5K8F A;  3GR0 A;  4DV2 C;  4DR1 C;  3IML A;  4FTF A;  4BCA A;  4DV3 C;  3J80 D;  3B7W A;  3UEB A;  3LNV A;  4RLQ A;  2JNV A;  3UX2 A;  4L4Q A;  1XNQ C;  2CXC A;  1XMQ C;  1QM4 A;  3R9W A;  1TH5 A;  3PES A;  4JI1 C;  4WV3 A;  1M6X A;  1P7L A;  2UUA C;  2HJG A;  2KZ0 A;  3L8C A;  2ONF A;  4X65 C;  4BBY A;  4L2Z A;  1ZB8 A;  3GR1 A;  2M5H A;  2XR1 A;  4DV1 C;  2D1Q A;  2P2B A;  4RM2 A;  4LFA C;  3FCE A;  3TUF A;  3ETO A;  3IPL A; 
#chains in the Genus database with same CATH homology
 4JI0 C;  2D1T A;  5T8T A;  4KTV A;  2JMP A;  3CW8 X;  3NYQ A;  4R0M A;  2UXD C;  3UZ0 A;  2P20 A;  4RLF A;  4YHH C;  1MXB A;  4GXR A;  2PRO A;  5A19 A;  1I94 C;  4PZP A;  3PBK A;  3I08 A;  1N36 C;  2EGT A;  2QVY X;  1O9T A;  4DV5 C;  1ULT A;  1VLA A;  4LF6 C;  2OPL A;  4PRO C;  3GKU A;  3T1Y C;  2OBV A;  3H2T A;  5BSW A;  2D1R A;  1N32 C;  4KHP C;  2BJO A;  3A9V A;  5LMN C;  3I07 A;  1O90 A;  1HNZ C;  4BC9 A;  2P2F A;  5A2Q D;  1PG4 A;  1N2F A;  2D28 C;  4K0K C;  3TDE A;  4JI8 C;  1N34 C;  4I9G A;  3LAX A;  5BR8 C;  5IT9 D;  5IWA C;  2E7G A;  4JM1 A;  1J5E C;  4GKJ C;  4FUT A;  3NYR A;  1QWI A;  4RMN A;  1UKK A;  2UUC C;  1T5D X;  4DUY C;  3DHV A;  4LF9 C;  2E8C A;  3EQ6 A;  4DR7 C;  3E7W A;  2ZM6 C;  4WS9 A;  2D7V A;  4NXM C;  1MXC A;  5CZV A;  1PA4 A;  4OXI A;  4D57 A;  2E5L C;  3NI2 A;  5BUS A;  1ML8 A;  4BC7 A;  1XNR C;  4JI7 C;  1HR0 C;  2YWB A;  3EER A;  3G7S A;  3A4I A;  4DR4 C;  4G1I A;  4AQY C;  2YCB A;  4LF7 C;  1AMU A;  2UUB C;  1LQL A;  3J81 D;  1XRB A;  5BSR A;  5BUR A;  4LF8 C;  2AYA A;  3A9U A;  1KKG A;  1XRC A;  1BA3 A;  4JYA C;  4OX9 C;  4DV4 C;  2D27 A;  5BSV A;  2KZF A;  2CY1 A;  1LCI A;  4HPV A;  5H9U A;  3GPC A;  1RG9 A;  4DR3 C;  3OTO C;  2UXB C;  3ETC A;  2OO4 A;  4GKK C;  1O92 A;  2P2Q A;  4RVN A;  5E7Q A;  4DCT A;  4I9F A;  4GS5 A;  4DV0 C;  1GPM A;  2VQF C;  4KTT A;  5CZX A;  5DV9 A;  2F4V C;  4B3S C;  5IFI A;  3NPD A;  3PRO C;  4IZ6 A;  5BSM A;  2QVX X;  1EGA A;  2HHH C;  4R1M A;  5T8S A;  1YJ7 A;  2QW0 X;  3IEU A;  2OPL B;  1NYE A;  3LGX A;  3E7X A;  4LF5 C;  4DCU A;  1MD9 A;  3UOW A;  4YY3 C;  3IEV A;  3VNR A;  5LMU C;  3T1H C;  1FUG A;  4X66 C;  4B3R C;  3L95 X;  4DG9 A;  1JOS A;  1K0R A;  1XMO C;  4JI5 C;  5FLX D;  2BH1 X;  4JI3 C;  2E8F A;  4DUZ C;  3CW9 A;  4PHT A;  4IR7 A;  2YWC A;  4JV5 C;  3KXW A;  3VNS A;  4K0B A;  5BST A;  1IBM C;  5KYT A;  5AE3 A;  2WD9 A;  2DPL A;  2Y27 A;  1T5H X;  1RY2 A;  1V25 A;  2P2M A;  4G37 A;  4GXQ A;  1HNW C;  1XRA A;  2VSQ A;  4D4I A;  4D4G A;  3RV2 A;  5ADZ A;  3RG2 A;  4U5Y D;  4LFC C;  1O93 A;  4XX2 A;  4BSZ A;  3J7A D;  3S82 A;  2UXC C;  4ODJ A;  4JI6 C;  5K85 A;  1V26 A;  3AF5 A;  5BUQ A;  4ZLP A;  1MKY A;  2WP0 C;  4X64 C;  4MTN A;  1ZB9 A;  3DAY A;  1MDF A;  3CJE A;  2QVZ X;  2DYJ A;  1IBL C;  2E0G A;  2VQE C;  1MXA A;  3DLP X;  4R1L A;  4RVO A;  2UU9 C;  4ZJZ A;  3FCC A;  1FJG C;  4MH4 A;  4NDN A;  4DCS A;  4RM3 A;  1IBK C;  4DR6 C;  4NXN C;  4DR2 C;  5AE1 A;  4L7I A;  5A1G A;  4FUQ A;  3R44 A;  3LUS A;  4G36 A;  2P02 A;  2QL8 A;  5A1I A;  4DV7 C;  2Y4O A;  2D1S A;  2ATW A;  4TPS B;  4LFB C;  3AF6 A;  5KEI A;  3VNQ A;  4EAT A;  4B3M C;  4B3T C;  4DG8 A;  3R9X A;  2E8E A;  3N2Q A;  5GTD A;  4DCV A;  2V7B A;  4JI2 C;  4LE5 A;  2Y4N A;  1L2F A;  3SO4 A;  4JI4 C;  1USP A;  1HNX C;  5AE2 A;  4DR5 C;  4OYC A;  2VZE A;  3JAM D;  4NOZ A;  3C5E A;  3N54 B;  4ISB A;  1MDB A;  2ASB A;  1PG3 A;  2P2J A;  1USP B;  1HH2 P;  5KYV A;  1WH9 A;  4X62 C;  4DV6 C;  2PN2 A;  2PT7 G;  3TQI A;  5BSU A;  1WF3 A;  5JRH A;  1N33 C;  4D56 A;  4LF4 C;  5K8F A;  3GR0 A;  4DV2 C;  4DR1 C;  3IML A;  4FTF A;  4BCA A;  4DV3 C;  3J80 D;  3B7W A;  3LNV A;  4RLQ A;  4L4Q A;  1XNQ C;  2CXC A;  1XMQ C;  1QM4 A;  3R9W A;  3PES A;  4JI1 C;  4WV3 A;  1P7L A;  2UUA C;  2HJG A;  3L8C A;  2ONF A;  4X65 C;  4BBY A;  4L2Z A;  1ZB8 A;  3GR1 A;  2XR1 A;  4DV1 C;  2D1Q A;  2P2B A;  4RM2 A;  4LFA C;  3FCE A;  3TUF A;  3ETO A;  3IPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...