2UXBC

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 30
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uxbC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uxbC02
4DV1C 4DR3C 1IBMC 2E5LC 1N33C 4DV2C 4GKJC 4JI5C 4LF5C 1N36C 2YCBA 4DR5C 4JI8C 4DUYC 2OPLB 1N32C 4NXNC 3J7AD 3J80D 2VQEC 2BJOA 5IWAC 4JI4C 5IT9D 2ASBA 4DR7C 4DV4C 5LMNC 4JI3C 1HNXC 3R9XA 4X66C 4DUZC 4AQYC 2HHHC 1HH2P 3I07A 2PN2A 5LMUC 4DV5C 2UUBC 2UXBC 3T1HC 1LQLA 1ZB9A 4DV3C 4DCTA 4B3RC 3CJEA 4B3SC 4JI6C 4B3TC 4JI1C 1IBLC 1PA4A 3EERA 2OPLA 2HJGA 3T1YC 2CXCA 1ZB8A 1HR0C 4XX2A 4K0KC 2UUAC 4X64C 4JI2C 4OX9C 3IEUA 4DV7C 2ATWA 4LF4C 3IEVA 1XMOC 1HNWC 1XNQC 4JV5C 4X62C 2EGTA 4LF6C 2DYJA 1HNZC 4DCVA 2PT7G 2XR1A 3R9WA 4YY3C 1QWIA 4DR6C 3AF5A 2E8FA 3JAMD 2UU9C 3OTOC 4NOZA 4JI0C 2ONFA 4YHHC 2UUCC 2ZM6C 1WF3A 4LF7C 2VQFC 4LF8C 4DR4C 5BR8C 1XNRC 2KZFA 1N34C 4MH4A 2E7GA 4KHPC 3J81D 1I94C 4LFCC 3GKUA 2F4VC 2E8EA 1N2FA 1WH9A 1ML8A 2E8CA 1MKYA 1K0RA 4DCSA 4DCUA 4MTNA 4DV6C 4LF9C 5FLXD 3AF6A 1VLAA 4B3MC 1USPB 1FJGC 4DR2C 3LUSA 4DR1C 4JI7C 1USPA 1L2FA 5A2QD 1JOSA 1NYEA 4JYAC 1J5EC 4BSZA 1EGAA 2QL8A 4DV0C 1IBKC 2UXCC 2UXDC 2JMPA 4LFAC 2CY1A 4GKKC 4X65C 2D7VA 4NXMC 1XMQC 4LFBC 1UKKA 1KKGA
chains in the Genus database with same CATH superfamily
1V60A 4WV3A 1XRCA 5JRHA 4JM1A 2D1SA 5GTDA 3NYRA 1O92A 3J7AD 1UWDA 4LE5A 2D1QA 4D57A 4WS9A 4BBYA 3TQIA 1P4EA 4X66C 4DUZC 2PN2A 4DV5C 5LCIA 1ZB9A 4FTFA 3C5EA 5BSWA 3CQ3A 3CQ1A 4NDNA 4PROC 2CXCA 4XX2A 3FM7A 2UUAC 4OX9C 4DV7C 1YJ7A 3O2EA 3IEVA 1HNWC 1XNQC 4RLFA 3PESA 3TR3A 2PROA 3K6RA 2DYJA 1AMUA 5ADZA 3I08A 4D56A 3AF5A 2E8FA 1V26A 2UU9C 4LF7C 1O93A 2ZM6C 3A9UA 2VQFC 1MXCA 3RG2A 4RMNA 4LFCC 3A9VA 1ML8A 4L4QA 4GXQA 5H9UA 1K0RA 4R1MA 4OYCA 1P7LA 4LF9C 3AF6A 1T5DX 4DG8A 1USPB 1FJGC 1GPMA 5KEIA 3LUSA 4L2ZA 3B7WA 1NYEA 4ISBA 3S82A 3A26A 2CY1A 1VEHA 4D4IA 5AE1A 2ZZNA 4DV1C 1IBMC 4L7IA 4K0BA 4G36A 4JI5C 2YCBA 4HPVA 2MCQA 3A25A 2OPLB 4KTTA 2BJOA 2ZTBA 5IWAC 1PG4A 2QVXX 2P20A 5IT9D 2ASBA 5LMNC 4AQYC 1HH2P 2NCLA 3N54B 4KTVA 4BCAA 2UXBC 1LQLA 3PROC 1MDBA 1IB8A 2VZEA 4B3SC 4JI6C 2PG1E 2HJGA 1BA3A 4K0KC 1T5HX 4JI2C 4RVOA 3N2QA 1FLOA 2ZZMA 3KXWA 4JV5C 4RM2A 4LF6C 3ETOA 1HNZC 3UX3A 2PT7G 2V7BA 2VSQA 3IMLA 1XHJA 1MD9A 1QWIA 1XRBA 5BSVA 2WP0C 3L95X 2KZ0A 3IPLA 4GS5A 1MXBA 4NOZA 2ONFA 2UUCC 1WF3A 2OBVA 4PUHA 3G7SA 2KZFA 4RLQA 3TUFA 1XDXA 3ETCA 3GPCA 2F4VC 1N2FA 2MMAB 2E8CA 2YWBA 4DCSA 4MTNA 3NI2A 5FLXD 2P2MA 3GR1A 4JI7C 1L2FA 2D28C 5KYVA 4BSZA 2Y27A 4RM3A 2UXCC 4G37A 1LCIA 5DV9A 4NXMC 1XMQC 3LAXA 1UKKA 3DLPX 4DR3C 2E5LC 4DV2C 4FUQA 4LF5C 4U5YD 4DR5C 2YWCA 4D4GA 4NXNC 3J80D 4PHTA 3NYQA 4OXIA 3SO4A 5BURA 1MDFA 4DR7C 4PUGA 3R9XA 4FUTA 2HHHC 3E7XA 3I07A 3UOWA 5LMUC 3UZ0A 4DV3C 4DCTA 1M6XC 2M5OA 2DPLA 2E0GA 4X64C 3IEUA 3LNVA 2ATWA 4LF4C 4BC7A 1XMOC 2KDNA 4X62C 4IZ6A 1M6XA 4DG9A 2BH1X 1NY8A 4EATA 4DCVA 2AYAA 2MM9A 4DR6C 3NPDA 3DAYA 4YHHC 5T8TA 5IFIA 3CW8X 4R0MA 1N34C 2E7GA 3J81D 3GKUA 3GR0A 1WH9A 5BUQA 4I9FA 4DCUA 3LGXA 5CZVA 3FCEA 4B3MC 3LNOA 5A19A 3E7WA 3R44A 3FCCA 2Y4NA 4DR1C 1V25A 5A2QD 1JOSA 2JNVA 2QVZX 1J5EC 3L8CA 5BUSA 2D27A 1ULTA 2JMPA 5BSTA 4LFAC 5A1GA 4GKKC 1TH5A 4X65C 2D7VA 2P2BA 4LFBC 4PZPA 3H2TA 1N33C 4GKJC 1N36C 1WCJA 4JI8C 4DUYC 2P2QA 1N32C 5AE2A 3DHVA 2VQEC 4JI4C 5BSUA 2QW0X 4DV4C 1HNXC 4JI3C 1O9TA 2M5HA 4RVNA 1O90A 5KYTA 3UX2A 4GXRA 2UUBC 3T1HC 2D1TA 4R1LA 1PU1A 4B3RC 5E7QA 3CJEA 4B3TC 2Z51A 4JI1C 1IBLC 4ODJA 1PA4A 3EERA 3AY0A 4ZLPA 2OPLA 3T1YC 2P2FA 1ZB8A 2D1RA 1HR0C 4IR7A 4BC9A 2DHMA 1RY2A 3UEBA 5BSRA 2OO4A 1RG9A 2EGTA 5BSMA 3CQ2A 4I9GA 2XR1A 4TPSB 4ZJZA 3R9WA 4YY3C 3JAMD 1XRAA 2CU6A 4JI0C 3OTOC 1P4EC 5AE3A 2YX1A 3VNSA 3EQ6A 4LF8C 4DR4C 5BR8C 1XNRC 4G1IA 5K8FA 4MH4A 4KHPC 1XS3A 5CZXA 1I94C 2P02A 2E8EA 2Y4OA 1MKYA 2P2JA 4DV6C 3RV2A 1YGTA 1VLAA 3PBKA 3TDEA 4DR2C 1FUGA 3VNRA 1USPA 5K85A 3CW9A 4JYAC 2QVYX 1MXAA 5T8SA 1EGAA 2QL8A 4DV0C 1IBKC 3VNQA 2UXDC 1PG3A 1QM4A 2WD9A 4PUIA 5A1IA 3A4IA 1KKGA
chains in the Genus database with same CATH topology
4WV3A 1XRCA 5JRHA 4JM1A 2D1SA 5GTDA 3NYRA 1O92A 3J7AD 4LE5A 2D1QA 4D57A 4WS9A 4BBYA 3TQIA 4X66C 4DUZC 2PN2A 4DV5C 1ZB9A 4FTFA 3C5EA 5BSWA 4NDNA 4PROC 2CXCA 4XX2A 2UUAC 4OX9C 4DV7C 1YJ7A 3IEVA 1HNWC 1XNQC 4RLFA 3PESA 2PROA 2DYJA 1AMUA 5ADZA 3I08A 4D56A 3AF5A 2E8FA 1V26A 2UU9C 4LF7C 1O93A 2ZM6C 3A9UA 2VQFC 1MXCA 3RG2A 4RMNA 4LFCC 3A9VA 1ML8A 4L4QA 4GXQA 5H9UA 1K0RA 4R1MA 4OYCA 1P7LA 4LF9C 3AF6A 1T5DX 4DG8A 1USPB 1FJGC 1GPMA 5KEIA 3LUSA 4L2ZA 3B7WA 1NYEA 4ISBA 3S82A 2CY1A 4D4IA 5AE1A 4DV1C 1IBMC 4L7IA 4K0BA 4G36A 4JI5C 2YCBA 4HPVA 2OPLB 4KTTA 2BJOA 5IWAC 1PG4A 2QVXX 2P20A 5IT9D 2ASBA 5LMNC 4AQYC 1HH2P 3N54B 4KTVA 4BCAA 2UXBC 1LQLA 3PROC 1MDBA 2VZEA 4B3SC 4JI6C 2HJGA 1BA3A 4K0KC 1T5HX 4JI2C 4RVOA 3N2QA 3KXWA 4JV5C 4RM2A 4LF6C 3ETOA 1HNZC 2PT7G 2V7BA 2VSQA 3IMLA 1MD9A 1QWIA 1XRBA 5BSVA 2WP0C 3L95X 3IPLA 4GS5A 1MXBA 4NOZA 2ONFA 2UUCC 1WF3A 2OBVA 3G7SA 2KZFA 4RLQA 3TUFA 3ETCA 3GPCA 2F4VC 1N2FA 2E8CA 2YWBA 4DCSA 4MTNA 3NI2A 5FLXD 2P2MA 3GR1A 4JI7C 1L2FA 2D28C 5KYVA 4BSZA 2Y27A 4RM3A 2UXCC 4G37A 1LCIA 5DV9A 4NXMC 1XMQC 3LAXA 1UKKA 3DLPX 4DR3C 2E5LC 4DV2C 4FUQA 4LF5C 4U5YD 4DR5C 2YWCA 4D4GA 4NXNC 3J80D 4PHTA 3NYQA 4OXIA 3SO4A 5BURA 1MDFA 4DR7C 3R9XA 4FUTA 2HHHC 3E7XA 3I07A 3UOWA 5LMUC 3UZ0A 4DV3C 4DCTA 2DPLA 2E0GA 4X64C 3IEUA 3LNVA 2ATWA 4LF4C 4BC7A 1XMOC 4X62C 4IZ6A 4DG9A 2BH1X 4EATA 4DCVA 2AYAA 4DR6C 3NPDA 3DAYA 4YHHC 5T8TA 5IFIA 3CW8X 4R0MA 1N34C 2E7GA 3J81D 3GKUA 3GR0A 1WH9A 5BUQA 4I9FA 4DCUA 3LGXA 5CZVA 3FCEA 4B3MC 3E7WA 5A19A 3R44A 3FCCA 2Y4NA 4DR1C 1V25A 5A2QD 1JOSA 2QVZX 1J5EC 3L8CA 5BUSA 2D27A 1ULTA 2JMPA 4LFAC 5BSTA 5A1GA 4GKKC 4X65C 2D7VA 2P2BA 4LFBC 4PZPA 3H2TA 1N33C 4GKJC 1N36C 4JI8C 4DUYC 2P2QA 1N32C 5AE2A 3DHVA 2VQEC 4JI4C 5BSUA 2QW0X 4DV4C 1HNXC 4JI3C 1O9TA 4RVNA 1O90A 5KYTA 4GXRA 2UUBC 3T1HC 2D1TA 4R1LA 4B3RC 5E7QA 3CJEA 4B3TC 4JI1C 1IBLC 4ODJA 1PA4A 3EERA 4ZLPA 2OPLA 3T1YC 2P2FA 1ZB8A 2D1RA 1HR0C 4IR7A 4BC9A 1RY2A 5BSRA 2OO4A 1RG9A 2EGTA 5BSMA 4I9GA 2XR1A 4TPSB 4ZJZA 3R9WA 4YY3C 3JAMD 1XRAA 3OTOC 4JI0C 5AE3A 3VNSA 3EQ6A 4LF8C 4DR4C 5BR8C 1XNRC 4G1IA 5K8FA 4MH4A 4KHPC 5CZXA 1I94C 2P02A 2E8EA 2Y4OA 1MKYA 2P2JA 4DV6C 3RV2A 1VLAA 3PBKA 3TDEA 4DR2C 1FUGA 3VNRA 1USPA 5K85A 3CW9A 4JYAC 2QVYX 1MXAA 5T8SA 1EGAA 2QL8A 4DV0C 1IBKC 3VNQA 2UXDC 1PG3A 1QM4A 2WD9A 5A1IA 3A4IA 1KKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 C;  4DR3 C;  1IBM C;  2E5L C;  1N33 C;  4DV2 C;  4GKJ C;  4JI5 C;  4LF5 C;  1N36 C;  2YCB A;  4DR5 C;  4JI8 C;  4DUY C;  2OPL B;  1N32 C;  4NXN C;  3J7A D;  3J80 D;  2VQE C;  2BJO A;  5IWA C;  4JI4 C;  5IT9 D;  2ASB A;  4DR7 C;  4DV4 C;  5LMN C;  4JI3 C;  1HNX C;  3R9X A;  4X66 C;  4DUZ C;  4AQY C;  2HHH C;  1HH2 P;  3I07 A;  2PN2 A;  5LMU C;  4DV5 C;  2UUB C;  2UXB C;  3T1H C;  1LQL A;  1ZB9 A;  4DV3 C;  4DCT A;  4B3R C;  3CJE A;  4B3S C;  4JI6 C;  4B3T C;  4JI1 C;  1IBL C;  1PA4 A;  3EER A;  2OPL A;  2HJG A;  3T1Y C;  2CXC A;  1ZB8 A;  1HR0 C;  4XX2 A;  4K0K C;  2UUA C;  4X64 C;  4JI2 C;  4OX9 C;  3IEU A;  4DV7 C;  2ATW A;  4LF4 C;  3IEV A;  1XMO C;  1HNW C;  1XNQ C;  4JV5 C;  4X62 C;  2EGT A;  4LF6 C;  2DYJ A;  1HNZ C;  4DCV A;  2PT7 G;  2XR1 A;  3R9W A;  4YY3 C;  1QWI A;  4DR6 C;  3AF5 A;  2E8F A;  3JAM D;  2UU9 C;  3OTO C;  4NOZ A;  4JI0 C;  2ONF A;  4YHH C;  2UUC C;  2ZM6 C;  1WF3 A;  4LF7 C;  2VQF C;  4LF8 C;  4DR4 C;  5BR8 C;  1XNR C;  2KZF A;  1N34 C;  4MH4 A;  2E7G A;  4KHP C;  3J81 D;  1I94 C;  4LFC C;  3GKU A;  2F4V C;  2E8E A;  1N2F A;  1WH9 A;  1ML8 A;  2E8C A;  1MKY A;  1K0R A;  4DCS A;  4DCU A;  4MTN A;  4DV6 C;  4LF9 C;  5FLX D;  3AF6 A;  1VLA A;  4B3M C;  1USP B;  1FJG C;  4DR2 C;  3LUS A;  4DR1 C;  4JI7 C;  1USP A;  1L2F A;  5A2Q D;  1JOS A;  1NYE A;  4JYA C;  1J5E C;  4BSZ A;  1EGA A;  2QL8 A;  4DV0 C;  1IBK C;  2UXC C;  2UXD C;  2JMP A;  4LFA C;  2CY1 A;  4GKK C;  4X65 C;  2D7V A;  4NXM C;  1XMQ C;  4LFB C;  1UKK A;  1KKG A; 
#chains in the Genus database with same CATH topology
 1V60 A;  4WV3 A;  1XRC A;  5JRH A;  4JM1 A;  2D1S A;  5GTD A;  3NYR A;  1O92 A;  3J7A D;  1UWD A;  4LE5 A;  2D1Q A;  4D57 A;  4WS9 A;  4BBY A;  3TQI A;  1P4E A;  4X66 C;  4DUZ C;  2PN2 A;  4DV5 C;  5LCI A;  1ZB9 A;  4FTF A;  3C5E A;  5BSW A;  3CQ3 A;  3CQ1 A;  4NDN A;  4PRO C;  2CXC A;  4XX2 A;  3FM7 A;  2UUA C;  4OX9 C;  4DV7 C;  1YJ7 A;  3O2E A;  3IEV A;  1HNW C;  1XNQ C;  4RLF A;  3PES A;  3TR3 A;  2PRO A;  3K6R A;  2DYJ A;  1AMU A;  5ADZ A;  3I08 A;  4D56 A;  3AF5 A;  2E8F A;  1V26 A;  2UU9 C;  4LF7 C;  1O93 A;  2ZM6 C;  3A9U A;  2VQF C;  1MXC A;  3RG2 A;  4RMN A;  4LFC C;  3A9V A;  1ML8 A;  4L4Q A;  4GXQ A;  5H9U A;  1K0R A;  4R1M A;  4OYC A;  1P7L A;  4LF9 C;  3AF6 A;  1T5D X;  4DG8 A;  1USP B;  1FJG C;  1GPM A;  5KEI A;  3LUS A;  4L2Z A;  3B7W A;  1NYE A;  4ISB A;  3S82 A;  3A26 A;  2CY1 A;  1VEH A;  4D4I A;  5AE1 A;  2ZZN A;  4DV1 C;  1IBM C;  4L7I A;  4K0B A;  4G36 A;  4JI5 C;  2YCB A;  4HPV A;  2MCQ A;  3A25 A;  2OPL B;  4KTT A;  2BJO A;  2ZTB A;  5IWA C;  1PG4 A;  2QVX X;  2P20 A;  5IT9 D;  2ASB A;  5LMN C;  4AQY C;  1HH2 P;  2NCL A;  3N54 B;  4KTV A;  4BCA A;  2UXB C;  1LQL A;  3PRO C;  1MDB A;  1IB8 A;  2VZE A;  4B3S C;  4JI6 C;  2PG1 E;  2HJG A;  1BA3 A;  4K0K C;  1T5H X;  4JI2 C;  4RVO A;  3N2Q A;  1FLO A;  2ZZM A;  3KXW A;  4JV5 C;  4RM2 A;  4LF6 C;  3ETO A;  1HNZ C;  3UX3 A;  2PT7 G;  2V7B A;  2VSQ A;  3IML A;  1XHJ A;  1MD9 A;  1QWI A;  1XRB A;  5BSV A;  2WP0 C;  3L95 X;  2KZ0 A;  3IPL A;  4GS5 A;  1MXB A;  4NOZ A;  2ONF A;  2UUC C;  1WF3 A;  2OBV A;  4PUH A;  3G7S A;  2KZF A;  4RLQ A;  3TUF A;  1XDX A;  3ETC A;  3GPC A;  2F4V C;  1N2F A;  2MMA B;  2E8C A;  2YWB A;  4DCS A;  4MTN A;  3NI2 A;  5FLX D;  2P2M A;  3GR1 A;  4JI7 C;  1L2F A;  2D28 C;  5KYV A;  4BSZ A;  2Y27 A;  4RM3 A;  2UXC C;  4G37 A;  1LCI A;  5DV9 A;  4NXM C;  1XMQ C;  3LAX A;  1UKK A;  3DLP X;  4DR3 C;  2E5L C;  4DV2 C;  4FUQ A;  4LF5 C;  4U5Y D;  4DR5 C;  2YWC A;  4D4G A;  4NXN C;  3J80 D;  4PHT A;  3NYQ A;  4OXI A;  3SO4 A;  5BUR A;  1MDF A;  4DR7 C;  4PUG A;  3R9X A;  4FUT A;  2HHH C;  3E7X A;  3I07 A;  3UOW A;  5LMU C;  3UZ0 A;  4DV3 C;  4DCT A;  1M6X C;  2M5O A;  2DPL A;  2E0G A;  4X64 C;  3IEU A;  3LNV A;  2ATW A;  4LF4 C;  4BC7 A;  1XMO C;  2KDN A;  4X62 C;  4IZ6 A;  1M6X A;  4DG9 A;  2BH1 X;  1NY8 A;  4EAT A;  4DCV A;  2AYA A;  2MM9 A;  4DR6 C;  3NPD A;  3DAY A;  4YHH C;  5T8T A;  5IFI A;  3CW8 X;  4R0M A;  1N34 C;  2E7G A;  3J81 D;  3GKU A;  3GR0 A;  1WH9 A;  5BUQ A;  4I9F A;  4DCU A;  3LGX A;  5CZV A;  3FCE A;  4B3M C;  3LNO A;  5A19 A;  3E7W A;  3R44 A;  3FCC A;  2Y4N A;  4DR1 C;  1V25 A;  5A2Q D;  1JOS A;  2JNV A;  2QVZ X;  1J5E C;  3L8C A;  5BUS A;  2D27 A;  1ULT A;  2JMP A;  5BST A;  4LFA C;  5A1G A;  4GKK C;  1TH5 A;  4X65 C;  2D7V A;  2P2B A;  4LFB C;  4PZP A;  3H2T A;  1N33 C;  4GKJ C;  1N36 C;  1WCJ A;  4JI8 C;  4DUY C;  2P2Q A;  1N32 C;  5AE2 A;  3DHV A;  2VQE C;  4JI4 C;  5BSU A;  2QW0 X;  4DV4 C;  1HNX C;  4JI3 C;  1O9T A;  2M5H A;  4RVN A;  1O90 A;  5KYT A;  3UX2 A;  4GXR A;  2UUB C;  3T1H C;  2D1T A;  4R1L A;  1PU1 A;  4B3R C;  5E7Q A;  3CJE A;  4B3T C;  2Z51 A;  4JI1 C;  1IBL C;  4ODJ A;  1PA4 A;  3EER A;  3AY0 A;  4ZLP A;  2OPL A;  3T1Y C;  2P2F A;  1ZB8 A;  2D1R A;  1HR0 C;  4IR7 A;  4BC9 A;  2DHM A;  1RY2 A;  3UEB A;  5BSR A;  2OO4 A;  1RG9 A;  2EGT A;  5BSM A;  3CQ2 A;  4I9G A;  2XR1 A;  4TPS B;  4ZJZ A;  3R9W A;  4YY3 C;  3JAM D;  1XRA A;  2CU6 A;  4JI0 C;  3OTO C;  1P4E C;  5AE3 A;  2YX1 A;  3VNS A;  3EQ6 A;  4LF8 C;  4DR4 C;  5BR8 C;  1XNR C;  4G1I A;  5K8F A;  4MH4 A;  4KHP C;  1XS3 A;  5CZX A;  1I94 C;  2P02 A;  2E8E A;  2Y4O A;  1MKY A;  2P2J A;  4DV6 C;  3RV2 A;  1YGT A;  1VLA A;  3PBK A;  3TDE A;  4DR2 C;  1FUG A;  3VNR A;  1USP A;  5K85 A;  3CW9 A;  4JYA C;  2QVY X;  1MXA A;  5T8S A;  1EGA A;  2QL8 A;  4DV0 C;  1IBK C;  3VNQ A;  2UXD C;  1PG3 A;  1QM4 A;  2WD9 A;  4PUI A;  5A1I A;  3A4I A;  1KKG A; 
#chains in the Genus database with same CATH homology
 4WV3 A;  1XRC A;  5JRH A;  4JM1 A;  2D1S A;  5GTD A;  3NYR A;  1O92 A;  3J7A D;  4LE5 A;  2D1Q A;  4D57 A;  4WS9 A;  4BBY A;  3TQI A;  4X66 C;  4DUZ C;  2PN2 A;  4DV5 C;  1ZB9 A;  4FTF A;  3C5E A;  5BSW A;  4NDN A;  4PRO C;  2CXC A;  4XX2 A;  2UUA C;  4OX9 C;  4DV7 C;  1YJ7 A;  3IEV A;  1HNW C;  1XNQ C;  4RLF A;  3PES A;  2PRO A;  2DYJ A;  1AMU A;  5ADZ A;  3I08 A;  4D56 A;  3AF5 A;  2E8F A;  1V26 A;  2UU9 C;  4LF7 C;  1O93 A;  2ZM6 C;  3A9U A;  2VQF C;  1MXC A;  3RG2 A;  4RMN A;  4LFC C;  3A9V A;  1ML8 A;  4L4Q A;  4GXQ A;  5H9U A;  1K0R A;  4R1M A;  4OYC A;  1P7L A;  4LF9 C;  3AF6 A;  1T5D X;  4DG8 A;  1USP B;  1FJG C;  1GPM A;  5KEI A;  3LUS A;  4L2Z A;  3B7W A;  1NYE A;  4ISB A;  3S82 A;  2CY1 A;  4D4I A;  5AE1 A;  4DV1 C;  1IBM C;  4L7I A;  4K0B A;  4G36 A;  4JI5 C;  2YCB A;  4HPV A;  2OPL B;  4KTT A;  2BJO A;  5IWA C;  1PG4 A;  2QVX X;  2P20 A;  5IT9 D;  2ASB A;  5LMN C;  4AQY C;  1HH2 P;  3N54 B;  4KTV A;  4BCA A;  2UXB C;  1LQL A;  3PRO C;  1MDB A;  2VZE A;  4B3S C;  4JI6 C;  2HJG A;  1BA3 A;  4K0K C;  1T5H X;  4JI2 C;  4RVO A;  3N2Q A;  3KXW A;  4JV5 C;  4RM2 A;  4LF6 C;  3ETO A;  1HNZ C;  2PT7 G;  2V7B A;  2VSQ A;  3IML A;  1MD9 A;  1QWI A;  1XRB A;  5BSV A;  2WP0 C;  3L95 X;  3IPL A;  4GS5 A;  1MXB A;  4NOZ A;  2ONF A;  2UUC C;  1WF3 A;  2OBV A;  3G7S A;  2KZF A;  4RLQ A;  3TUF A;  3ETC A;  3GPC A;  2F4V C;  1N2F A;  2E8C A;  2YWB A;  4DCS A;  4MTN A;  3NI2 A;  5FLX D;  2P2M A;  3GR1 A;  4JI7 C;  1L2F A;  2D28 C;  5KYV A;  4BSZ A;  2Y27 A;  4RM3 A;  2UXC C;  4G37 A;  1LCI A;  5DV9 A;  4NXM C;  1XMQ C;  3LAX A;  1UKK A;  3DLP X;  4DR3 C;  2E5L C;  4DV2 C;  4FUQ A;  4LF5 C;  4U5Y D;  4DR5 C;  2YWC A;  4D4G A;  4NXN C;  3J80 D;  4PHT A;  3NYQ A;  4OXI A;  3SO4 A;  5BUR A;  1MDF A;  4DR7 C;  3R9X A;  4FUT A;  2HHH C;  3E7X A;  3I07 A;  3UOW A;  5LMU C;  3UZ0 A;  4DV3 C;  4DCT A;  2DPL A;  2E0G A;  4X64 C;  3IEU A;  3LNV A;  2ATW A;  4LF4 C;  4BC7 A;  1XMO C;  4X62 C;  4IZ6 A;  4DG9 A;  2BH1 X;  4EAT A;  4DCV A;  2AYA A;  4DR6 C;  3NPD A;  3DAY A;  4YHH C;  5T8T A;  5IFI A;  3CW8 X;  4R0M A;  1N34 C;  2E7G A;  3J81 D;  3GKU A;  3GR0 A;  1WH9 A;  5BUQ A;  4I9F A;  4DCU A;  3LGX A;  5CZV A;  3FCE A;  4B3M C;  3E7W A;  5A19 A;  3R44 A;  3FCC A;  2Y4N A;  4DR1 C;  1V25 A;  5A2Q D;  1JOS A;  2QVZ X;  1J5E C;  3L8C A;  5BUS A;  2D27 A;  1ULT A;  2JMP A;  4LFA C;  5BST A;  5A1G A;  4GKK C;  4X65 C;  2D7V A;  2P2B A;  4LFB C;  4PZP A;  3H2T A;  1N33 C;  4GKJ C;  1N36 C;  4JI8 C;  4DUY C;  2P2Q A;  1N32 C;  5AE2 A;  3DHV A;  2VQE C;  4JI4 C;  5BSU A;  2QW0 X;  4DV4 C;  1HNX C;  4JI3 C;  1O9T A;  4RVN A;  1O90 A;  5KYT A;  4GXR A;  2UUB C;  3T1H C;  2D1T A;  4R1L A;  4B3R C;  5E7Q A;  3CJE A;  4B3T C;  4JI1 C;  1IBL C;  4ODJ A;  1PA4 A;  3EER A;  4ZLP A;  2OPL A;  3T1Y C;  2P2F A;  1ZB8 A;  2D1R A;  1HR0 C;  4IR7 A;  4BC9 A;  1RY2 A;  5BSR A;  2OO4 A;  1RG9 A;  2EGT A;  5BSM A;  4I9G A;  2XR1 A;  4TPS B;  4ZJZ A;  3R9W A;  4YY3 C;  3JAM D;  1XRA A;  3OTO C;  4JI0 C;  5AE3 A;  3VNS A;  3EQ6 A;  4LF8 C;  4DR4 C;  5BR8 C;  1XNR C;  4G1I A;  5K8F A;  4MH4 A;  4KHP C;  5CZX A;  1I94 C;  2P02 A;  2E8E A;  2Y4O A;  1MKY A;  2P2J A;  4DV6 C;  3RV2 A;  1VLA A;  3PBK A;  3TDE A;  4DR2 C;  1FUG A;  3VNR A;  1USP A;  5K85 A;  3CW9 A;  4JYA C;  2QVY X;  1MXA A;  5T8S A;  1EGA A;  2QL8 A;  4DV0 C;  1IBK C;  3VNQ A;  2UXD C;  1PG3 A;  1QM4 A;  2WD9 A;  5A1I A;  3A4I A;  1KKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...