2UXBC

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
total genus 30
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uxbC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uxbC02
2KZFA 3J7AD 3R9WA 4LF5C 4JI8C 4LF9C 1I94C 2EGTA 1HR0C 4DV1C 4B3RC 4NOZA 1IBMC 1XNRC 4KHPC 4X62C 3T1YC 4JI6C 4DV6C 2JMPA 1ZB8A 4DCUA 1ML8A 1USPA 4JI3C 4AQYC 2DYJA 4DCTA 4DUZC 2E8CA 4DV0C 4LF7C 3IEUA 1LQLA 4DR2C 3R9XA 4YHHC 3OTOC 2VQFC 1N36C 1WH9A 1IBKC 1HNXC 4DCVA 1IBLC 1N2FA 4DV2C 2E8EA 2UU9C 2UXDC 3IEVA 4XX2A 3CJEA 4DV4C 2CXCA 4DUYC 4NXNC 4JI2C 4LFCC 1K0RA 2HJGA 5IT9D 5BR8C 1XMOC 2ZM6C 5LMUC 4LF8C 4DR5C 3T1HC 2UXCC 4NXMC 4BSZA 2OPLA 4JI5C 4B3SC 2VQEC 4DR1C 5LMNC 4DV5C 1VLAA 1USPB 2UXBC 1JOSA 4YY3C 2ONFA 3JAMD 4JI1C 4DR4C 4JI7C 3LUSA 2D7VA 2E5LC 4DR7C 1MKYA 3EERA 1HH2P 2QL8A 2YCBA 2ASBA 5IWAC 5FLXD 4GKKC 4JYAC 1HNZC 2UUBC 4LFAC 4DCSA 4DR6C 1XMQC 1WF3A 4LFBC 2ATWA 1EGAA 1FJGC 1ZB9A 1J5EC 2E8FA 4JI0C 4DV7C 2PN2A 2UUAC 2PT7G 4B3MC 1UKKA 1QWIA 1N33C 1PA4A 4LF6C 1L2FA 4GKJC 3AF5A 4LF4C 4X64C 3J81D 4B3TC 1N32C 1KKGA 4DR3C 4X66C 2F4VC 2OPLB 2HHHC 1NYEA 1N34C 4JV5C 4K0KC 2XR1A 3AF6A 4DV3C 3GKUA 4X65C 4JI4C 2CY1A 2E7GA 3I07A 4MH4A 3J80D 4OX9C 1XNQC 2BJOA 1HNWC 2UUCC 5A2QD 4MTNA
chains in the Genus database with same CATH superfamily
2KZFA 4R1LA 3R9WA 4LF9C 2KZ0A 4B3RC 4NOZA 4GXRA 4KHPC 4JI6C 2JMPA 2ZTBA 1ZB8A 4DCUA 1ML8A 4JI3C 3A9VA 2MCQA 1MD9A 4DV0C 3PBKA 2Y4NA 2V7BA 4BC9A 3OTOC 2VQFC 3DLPX 2YX1A 3R44A 3UOWA 1IBLC 5BURA 5DV9A 3L8CA 2M5OA 2CXCA 4L2ZA 3FM7A 1AMUA 1V60A 4RLQA 5KEIA 2ZZMA 2ZZNA 5IT9D 5BR8C 3C5EA 5LMUC 4LF8C 3SO4A 4DR5C 1NY8A 4DV5C 3N54B 1VLAA 4IZ6A 3PESA 2E5LC 1GPMA 3K6RA 4GKKC 5FLXD 5KYTA 4DG9A 1HNZC 2UUBC 4D4IA 4DCSA 3A25A 1QM4A 1EGAA 3N2QA 4D57A 4JI0C 2PT7G 3RV2A 4JM1A 2PROA 1RG9A 4ODJA 1P4EC 5CZVA 3DHVA 4B3TC 2D1QA 5AE3A 1NYEA 4JV5C 3CW8X 3AF6A 4L4QA 3GKUA 4LE5A 3J80D 5A2QD 3S82A 2JNVA 3ETOA 3J7AD 4LF5C 1PU1A 1I94C 4ISBA 4RVOA 2EGTA 2Y4OA 1FLOA 3UZ0A 2CU6A 5T8SA 1XNRC 1YGTA 4PROC 3T1YC 2OO4A 4AQYC 1MXAA 3ETCA 4NDNA 4DCTA 5LCIA 3A4IA 5A1IA 3RG2A 4DUZC 2E8CA 3VNRA 4DR2C 3A9UA 3TUFA 1N36C 4GXQA 1IBKC 1N2FA 3LGXA 1XDXA 4WS9A 2UU9C 1T5HX 5ADZA 3CJEA 4D4GA 4DUYC 1P4EA 1YJ7A 4NXNC 4LFCC 4RVNA 2ZM6C 2BH1X 4IR7A 3T1HC 4DR1C 4I9GA 3GPCA 1JOSA 1TH5A 2P02A 4FUTA 4YY3C 2PG1E 3JAMD 5BSTA 2DPLA 4PHTA 3UX2A 3LUSA 4JI7C 1MKYA 3EERA 2QL8A 1RY2A 1XRAA 4KTTA 4DR6C 3B7WA 4TPSB 4LFBC 1FJGC 4G37A 5BSMA 2UUAC 1N33C 4HPVA 3FCEA 2VZEA 1XHJA 4X64C 4OYCA 2P2JA 2QW0X 1XRBA 1N32C 4DR3C 2HHHC 3CQ1A 4EATA 1PG4A 3VNSA 4JI4C 2CY1A 1ULTA 2VSQA 4MH4A 1XNQC 4OX9C 2BJOA 1M6XC 4L7IA 4RLFA 1XRCA 5K8FA 4JI8C 5T8TA 5BSWA 4DV1C 1VEHA 3CQ2A 1IB8A 3LNOA 3KXWA 5BSRA 3NYQA 1USPA 5A1GA 3L95X 4G1IA 4ZLPA 1PG3A 4LF7C 3IEUA 2P20A 3E7XA 1LQLA 2MM9A 3R9XA 4YHHC 4DCVA 5GTDA 2E8EA 4RM3A 2UXDC 3IEVA 4DV4C 5KYVA 1K0RA 2HJGA 2D28C 4NXMC 4BSZA 2OPLA 3NPDA 4B3SC 3TDEA 3IPLA 3I08A 1USPB 3EQ6A 2MMAB 1P7LA 2ONFA 4JI1C 2NCLA 4DR4C 4DR7C 2D7VA 3E7WA 5A19A 2AYAA 1M6XA 1HH2P 3GR0A 5IWAC 4JYAC 5BSUA 1BA3A 1O9TA 3VNQA 5AE2A 4PUIA 2QVZX 3PROC 2ATWA 1LCIA 1FUGA 1ZB9A 1O93A 4WV3A 2Z51A 2PN2A 3TR3A 1UKKA 4OXIA 2WP0C 4LF6C 4RMNA 3G7SA 5IFIA 3AF5A 4G36A 4LF4C 1O92A 2D1TA 5JRHA 2OPLB 1N34C 4FUQA 1O90A 4K0KC 2XR1A 3DAYA 3TQIA 1HNWC 2UUCC 3CW9A 2P2MA 4GS5A 2D27A 4PUHA 2Y27A 5K85A 1HR0C 5BSVA 1MXBA 1IBMC 4X62C 4DV6C 4K0BA 2DYJA 4BCAA 3O2EA 1UWDA 3A26A 2WD9A 4KTVA 1WH9A 4D56A 1HNXC 4DV2C 1V26A 2M5HA 3FCCA 4FTFA 3LNVA 1V25A 4XX2A 4R0MA 2QVYX 4JI2C 5AE1A 1XMOC 3NI2A 3IMLA 2UXCC 2KDNA 1MDFA 4JI5C 2VQEC 2OBVA 5LMNC 5E7QA 2UXBC 2D1RA 4R1MA 4BBYA 2YCBA 2YWCA 2ASBA 3UX3A 2P2QA 4LFAC 3NYRA 1WCJA 5BUSA 5H9UA 1XMQC 3UEBA 2QVXX 1WF3A 2P2BA 4DG8A 4BC7A 3LAXA 1J5EC 2E8FA 4DV7C 2YWBA 1XS3A 3GR1A 4B3MC 1QWIA 1PA4A 2P2FA 3H2TA 5CZXA 2E0GA 4PUGA 4ZJZA 1L2FA 4GKJC 2D1SA 1MDBA 4I9FA 4U5YD 3J81D 1KKGA 2DHMA 4X66C 2F4VC 4RM2A 4DV3C 1MXCA 4X65C 2E7GA 5BUQA 3I07A 3AY0A 4PZPA 1T5DX 3CQ3A 4MTNA
chains in the Genus database with same CATH topology
2KZFA 4R1LA 3R9WA 4LF9C 4B3RC 4NOZA 4GXRA 4KHPC 4JI6C 2JMPA 1ZB8A 4DCUA 1ML8A 4JI3C 3A9VA 1MD9A 4DV0C 3PBKA 2Y4NA 2V7BA 4BC9A 3OTOC 2VQFC 3DLPX 3R44A 3UOWA 1IBLC 5BURA 5DV9A 3L8CA 2CXCA 4L2ZA 1AMUA 4RLQA 5KEIA 5IT9D 5BR8C 3C5EA 5LMUC 4LF8C 3SO4A 4DR5C 4DV5C 3N54B 1VLAA 4IZ6A 3PESA 2E5LC 1GPMA 4GKKC 5FLXD 5KYTA 4DG9A 1HNZC 2UUBC 4D4IA 4DCSA 1QM4A 1EGAA 3N2QA 4D57A 4JI0C 2PT7G 3RV2A 4JM1A 2PROA 1RG9A 4ODJA 5CZVA 3DHVA 4B3TC 2D1QA 5AE3A 1NYEA 4JV5C 3CW8X 3AF6A 4L4QA 3GKUA 4LE5A 3J80D 5A2QD 3S82A 3ETOA 3J7AD 4LF5C 1I94C 4ISBA 4RVOA 2EGTA 2Y4OA 3UZ0A 5T8SA 1XNRC 4PROC 3T1YC 2OO4A 4AQYC 1MXAA 3ETCA 4NDNA 4DCTA 3A4IA 5A1IA 3RG2A 4DUZC 2E8CA 3VNRA 4DR2C 3A9UA 3TUFA 1N36C 4GXQA 1IBKC 1N2FA 3LGXA 4WS9A 2UU9C 1T5HX 5ADZA 3CJEA 4D4GA 4DUYC 1YJ7A 4NXNC 4LFCC 4RVNA 2ZM6C 2BH1X 4IR7A 3T1HC 4DR1C 4I9GA 3GPCA 1JOSA 2P02A 4FUTA 4YY3C 3JAMD 5BSTA 2DPLA 4PHTA 4JI7C 3LUSA 1MKYA 3EERA 2QL8A 1RY2A 1XRAA 4KTTA 4DR6C 3B7WA 4TPSB 4LFBC 1FJGC 4G37A 5BSMA 2UUAC 1N33C 4HPVA 3FCEA 2VZEA 4X64C 4OYCA 2P2JA 2QW0X 1XRBA 1N32C 4DR3C 2HHHC 4EATA 1PG4A 3VNSA 4JI4C 2CY1A 1ULTA 2VSQA 4MH4A 1XNQC 4OX9C 2BJOA 4L7IA 4RLFA 1XRCA 5K8FA 4JI8C 5T8TA 5BSWA 4DV1C 3KXWA 5BSRA 3NYQA 1USPA 5A1GA 3L95X 4G1IA 4ZLPA 1PG3A 4LF7C 3IEUA 2P20A 3E7XA 1LQLA 3R9XA 4YHHC 4DCVA 5GTDA 2E8EA 4RM3A 2UXDC 3IEVA 4DV4C 5KYVA 1K0RA 2HJGA 2D28C 4NXMC 4BSZA 2OPLA 3NPDA 4B3SC 3TDEA 3IPLA 3I08A 1USPB 3EQ6A 1P7LA 2ONFA 4JI1C 4DR4C 4DR7C 2D7VA 3E7WA 5A19A 2AYAA 1HH2P 3GR0A 5IWAC 4JYAC 5BSUA 1BA3A 1O9TA 3VNQA 5AE2A 2QVZX 3PROC 2ATWA 1LCIA 1FUGA 1ZB9A 1O93A 4WV3A 2PN2A 1UKKA 4OXIA 2WP0C 4LF6C 4RMNA 3G7SA 5IFIA 3AF5A 4G36A 4LF4C 1O92A 2D1TA 5JRHA 2OPLB 1N34C 4FUQA 1O90A 4K0KC 2XR1A 3DAYA 3TQIA 1HNWC 2UUCC 3CW9A 2P2MA 4GS5A 2D27A 2Y27A 5K85A 1HR0C 5BSVA 1MXBA 1IBMC 4X62C 4DV6C 4K0BA 2DYJA 4BCAA 2WD9A 4KTVA 1WH9A 4D56A 1HNXC 4DV2C 1V26A 3FCCA 4FTFA 3LNVA 1V25A 4XX2A 4R0MA 2QVYX 4JI2C 5AE1A 1XMOC 3NI2A 3IMLA 2UXCC 1MDFA 4JI5C 2VQEC 2OBVA 5LMNC 5E7QA 2UXBC 2D1RA 4R1MA 4BBYA 2YCBA 2YWCA 2ASBA 2P2QA 4LFAC 3NYRA 5BUSA 5H9UA 1XMQC 2QVXX 1WF3A 2P2BA 4DG8A 4BC7A 3LAXA 1J5EC 2E8FA 4DV7C 2YWBA 4B3MC 3GR1A 1QWIA 1PA4A 2P2FA 3H2TA 5CZXA 2E0GA 4ZJZA 1L2FA 4GKJC 2D1SA 1MDBA 4I9FA 4U5YD 3J81D 1KKGA 4X66C 2F4VC 4RM2A 4DV3C 1MXCA 4X65C 2E7GA 5BUQA 3I07A 4PZPA 1T5DX 4MTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZF A;  3J7A D;  3R9W A;  4LF5 C;  4JI8 C;  4LF9 C;  1I94 C;  2EGT A;  1HR0 C;  4DV1 C;  4B3R C;  4NOZ A;  1IBM C;  1XNR C;  4KHP C;  4X62 C;  3T1Y C;  4JI6 C;  4DV6 C;  2JMP A;  1ZB8 A;  4DCU A;  1ML8 A;  1USP A;  4JI3 C;  4AQY C;  2DYJ A;  4DCT A;  4DUZ C;  2E8C A;  4DV0 C;  4LF7 C;  3IEU A;  1LQL A;  4DR2 C;  3R9X A;  4YHH C;  3OTO C;  2VQF C;  1N36 C;  1WH9 A;  1IBK C;  1HNX C;  4DCV A;  1IBL C;  1N2F A;  4DV2 C;  2E8E A;  2UU9 C;  2UXD C;  3IEV A;  4XX2 A;  3CJE A;  4DV4 C;  2CXC A;  4DUY C;  4NXN C;  4JI2 C;  4LFC C;  1K0R A;  2HJG A;  5IT9 D;  5BR8 C;  1XMO C;  2ZM6 C;  5LMU C;  4LF8 C;  4DR5 C;  3T1H C;  2UXC C;  4NXM C;  4BSZ A;  2OPL A;  4JI5 C;  4B3S C;  2VQE C;  4DR1 C;  5LMN C;  4DV5 C;  1VLA A;  1USP B;  2UXB C;  1JOS A;  4YY3 C;  2ONF A;  3JAM D;  4JI1 C;  4DR4 C;  4JI7 C;  3LUS A;  2D7V A;  2E5L C;  4DR7 C;  1MKY A;  3EER A;  1HH2 P;  2QL8 A;  2YCB A;  2ASB A;  5IWA C;  5FLX D;  4GKK C;  4JYA C;  1HNZ C;  2UUB C;  4LFA C;  4DCS A;  4DR6 C;  1XMQ C;  1WF3 A;  4LFB C;  2ATW A;  1EGA A;  1FJG C;  1ZB9 A;  1J5E C;  2E8F A;  4JI0 C;  4DV7 C;  2PN2 A;  2UUA C;  2PT7 G;  4B3M C;  1UKK A;  1QWI A;  1N33 C;  1PA4 A;  4LF6 C;  1L2F A;  4GKJ C;  3AF5 A;  4LF4 C;  4X64 C;  3J81 D;  4B3T C;  1N32 C;  1KKG A;  4DR3 C;  4X66 C;  2F4V C;  2OPL B;  2HHH C;  1NYE A;  1N34 C;  4JV5 C;  4K0K C;  2XR1 A;  3AF6 A;  4DV3 C;  3GKU A;  4X65 C;  4JI4 C;  2CY1 A;  2E7G A;  3I07 A;  4MH4 A;  3J80 D;  4OX9 C;  1XNQ C;  2BJO A;  1HNW C;  2UUC C;  5A2Q D;  4MTN A; 
#chains in the Genus database with same CATH topology
 2KZF A;  4R1L A;  3R9W A;  4LF9 C;  2KZ0 A;  4B3R C;  4NOZ A;  4GXR A;  4KHP C;  4JI6 C;  2JMP A;  2ZTB A;  1ZB8 A;  4DCU A;  1ML8 A;  4JI3 C;  3A9V A;  2MCQ A;  1MD9 A;  4DV0 C;  3PBK A;  2Y4N A;  2V7B A;  4BC9 A;  3OTO C;  2VQF C;  3DLP X;  2YX1 A;  3R44 A;  3UOW A;  1IBL C;  5BUR A;  5DV9 A;  3L8C A;  2M5O A;  2CXC A;  4L2Z A;  3FM7 A;  1AMU A;  1V60 A;  4RLQ A;  5KEI A;  2ZZM A;  2ZZN A;  5IT9 D;  5BR8 C;  3C5E A;  5LMU C;  4LF8 C;  3SO4 A;  4DR5 C;  1NY8 A;  4DV5 C;  3N54 B;  1VLA A;  4IZ6 A;  3PES A;  2E5L C;  1GPM A;  3K6R A;  4GKK C;  5FLX D;  5KYT A;  4DG9 A;  1HNZ C;  2UUB C;  4D4I A;  4DCS A;  3A25 A;  1QM4 A;  1EGA A;  3N2Q A;  4D57 A;  4JI0 C;  2PT7 G;  3RV2 A;  4JM1 A;  2PRO A;  1RG9 A;  4ODJ A;  1P4E C;  5CZV A;  3DHV A;  4B3T C;  2D1Q A;  5AE3 A;  1NYE A;  4JV5 C;  3CW8 X;  3AF6 A;  4L4Q A;  3GKU A;  4LE5 A;  3J80 D;  5A2Q D;  3S82 A;  2JNV A;  3ETO A;  3J7A D;  4LF5 C;  1PU1 A;  1I94 C;  4ISB A;  4RVO A;  2EGT A;  2Y4O A;  1FLO A;  3UZ0 A;  2CU6 A;  5T8S A;  1XNR C;  1YGT A;  4PRO C;  3T1Y C;  2OO4 A;  4AQY C;  1MXA A;  3ETC A;  4NDN A;  4DCT A;  5LCI A;  3A4I A;  5A1I A;  3RG2 A;  4DUZ C;  2E8C A;  3VNR A;  4DR2 C;  3A9U A;  3TUF A;  1N36 C;  4GXQ A;  1IBK C;  1N2F A;  3LGX A;  1XDX A;  4WS9 A;  2UU9 C;  1T5H X;  5ADZ A;  3CJE A;  4D4G A;  4DUY C;  1P4E A;  1YJ7 A;  4NXN C;  4LFC C;  4RVN A;  2ZM6 C;  2BH1 X;  4IR7 A;  3T1H C;  4DR1 C;  4I9G A;  3GPC A;  1JOS A;  1TH5 A;  2P02 A;  4FUT A;  4YY3 C;  2PG1 E;  3JAM D;  5BST A;  2DPL A;  4PHT A;  3UX2 A;  3LUS A;  4JI7 C;  1MKY A;  3EER A;  2QL8 A;  1RY2 A;  1XRA A;  4KTT A;  4DR6 C;  3B7W A;  4TPS B;  4LFB C;  1FJG C;  4G37 A;  5BSM A;  2UUA C;  1N33 C;  4HPV A;  3FCE A;  2VZE A;  1XHJ A;  4X64 C;  4OYC A;  2P2J A;  2QW0 X;  1XRB A;  1N32 C;  4DR3 C;  2HHH C;  3CQ1 A;  4EAT A;  1PG4 A;  3VNS A;  4JI4 C;  2CY1 A;  1ULT A;  2VSQ A;  4MH4 A;  1XNQ C;  4OX9 C;  2BJO A;  1M6X C;  4L7I A;  4RLF A;  1XRC A;  5K8F A;  4JI8 C;  5T8T A;  5BSW A;  4DV1 C;  1VEH A;  3CQ2 A;  1IB8 A;  3LNO A;  3KXW A;  5BSR A;  3NYQ A;  1USP A;  5A1G A;  3L95 X;  4G1I A;  4ZLP A;  1PG3 A;  4LF7 C;  3IEU A;  2P20 A;  3E7X A;  1LQL A;  2MM9 A;  3R9X A;  4YHH C;  4DCV A;  5GTD A;  2E8E A;  4RM3 A;  2UXD C;  3IEV A;  4DV4 C;  5KYV A;  1K0R A;  2HJG A;  2D28 C;  4NXM C;  4BSZ A;  2OPL A;  3NPD A;  4B3S C;  3TDE A;  3IPL A;  3I08 A;  1USP B;  3EQ6 A;  2MMA B;  1P7L A;  2ONF A;  4JI1 C;  2NCL A;  4DR4 C;  4DR7 C;  2D7V A;  3E7W A;  5A19 A;  2AYA A;  1M6X A;  1HH2 P;  3GR0 A;  5IWA C;  4JYA C;  5BSU A;  1BA3 A;  1O9T A;  3VNQ A;  5AE2 A;  4PUI A;  2QVZ X;  3PRO C;  2ATW A;  1LCI A;  1FUG A;  1ZB9 A;  1O93 A;  4WV3 A;  2Z51 A;  2PN2 A;  3TR3 A;  1UKK A;  4OXI A;  2WP0 C;  4LF6 C;  4RMN A;  3G7S A;  5IFI A;  3AF5 A;  4G36 A;  4LF4 C;  1O92 A;  2D1T A;  5JRH A;  2OPL B;  1N34 C;  4FUQ A;  1O90 A;  4K0K C;  2XR1 A;  3DAY A;  3TQI A;  1HNW C;  2UUC C;  3CW9 A;  2P2M A;  4GS5 A;  2D27 A;  4PUH A;  2Y27 A;  5K85 A;  1HR0 C;  5BSV A;  1MXB A;  1IBM C;  4X62 C;  4DV6 C;  4K0B A;  2DYJ A;  4BCA A;  3O2E A;  1UWD A;  3A26 A;  2WD9 A;  4KTV A;  1WH9 A;  4D56 A;  1HNX C;  4DV2 C;  1V26 A;  2M5H A;  3FCC A;  4FTF A;  3LNV A;  1V25 A;  4XX2 A;  4R0M A;  2QVY X;  4JI2 C;  5AE1 A;  1XMO C;  3NI2 A;  3IML A;  2UXC C;  2KDN A;  1MDF A;  4JI5 C;  2VQE C;  2OBV A;  5LMN C;  5E7Q A;  2UXB C;  2D1R A;  4R1M A;  4BBY A;  2YCB A;  2YWC A;  2ASB A;  3UX3 A;  2P2Q A;  4LFA C;  3NYR A;  1WCJ A;  5BUS A;  5H9U A;  1XMQ C;  3UEB A;  2QVX X;  1WF3 A;  2P2B A;  4DG8 A;  4BC7 A;  3LAX A;  1J5E C;  2E8F A;  4DV7 C;  2YWB A;  1XS3 A;  3GR1 A;  4B3M C;  1QWI A;  1PA4 A;  2P2F A;  3H2T A;  5CZX A;  2E0G A;  4PUG A;  4ZJZ A;  1L2F A;  4GKJ C;  2D1S A;  1MDB A;  4I9F A;  4U5Y D;  3J81 D;  1KKG A;  2DHM A;  4X66 C;  2F4V C;  4RM2 A;  4DV3 C;  1MXC A;  4X65 C;  2E7G A;  5BUQ A;  3I07 A;  3AY0 A;  4PZP A;  1T5D X;  3CQ3 A;  4MTN A; 
#chains in the Genus database with same CATH homology
 2KZF A;  4R1L A;  3R9W A;  4LF9 C;  4B3R C;  4NOZ A;  4GXR A;  4KHP C;  4JI6 C;  2JMP A;  1ZB8 A;  4DCU A;  1ML8 A;  4JI3 C;  3A9V A;  1MD9 A;  4DV0 C;  3PBK A;  2Y4N A;  2V7B A;  4BC9 A;  3OTO C;  2VQF C;  3DLP X;  3R44 A;  3UOW A;  1IBL C;  5BUR A;  5DV9 A;  3L8C A;  2CXC A;  4L2Z A;  1AMU A;  4RLQ A;  5KEI A;  5IT9 D;  5BR8 C;  3C5E A;  5LMU C;  4LF8 C;  3SO4 A;  4DR5 C;  4DV5 C;  3N54 B;  1VLA A;  4IZ6 A;  3PES A;  2E5L C;  1GPM A;  4GKK C;  5FLX D;  5KYT A;  4DG9 A;  1HNZ C;  2UUB C;  4D4I A;  4DCS A;  1QM4 A;  1EGA A;  3N2Q A;  4D57 A;  4JI0 C;  2PT7 G;  3RV2 A;  4JM1 A;  2PRO A;  1RG9 A;  4ODJ A;  5CZV A;  3DHV A;  4B3T C;  2D1Q A;  5AE3 A;  1NYE A;  4JV5 C;  3CW8 X;  3AF6 A;  4L4Q A;  3GKU A;  4LE5 A;  3J80 D;  5A2Q D;  3S82 A;  3ETO A;  3J7A D;  4LF5 C;  1I94 C;  4ISB A;  4RVO A;  2EGT A;  2Y4O A;  3UZ0 A;  5T8S A;  1XNR C;  4PRO C;  3T1Y C;  2OO4 A;  4AQY C;  1MXA A;  3ETC A;  4NDN A;  4DCT A;  3A4I A;  5A1I A;  3RG2 A;  4DUZ C;  2E8C A;  3VNR A;  4DR2 C;  3A9U A;  3TUF A;  1N36 C;  4GXQ A;  1IBK C;  1N2F A;  3LGX A;  4WS9 A;  2UU9 C;  1T5H X;  5ADZ A;  3CJE A;  4D4G A;  4DUY C;  1YJ7 A;  4NXN C;  4LFC C;  4RVN A;  2ZM6 C;  2BH1 X;  4IR7 A;  3T1H C;  4DR1 C;  4I9G A;  3GPC A;  1JOS A;  2P02 A;  4FUT A;  4YY3 C;  3JAM D;  5BST A;  2DPL A;  4PHT A;  4JI7 C;  3LUS A;  1MKY A;  3EER A;  2QL8 A;  1RY2 A;  1XRA A;  4KTT A;  4DR6 C;  3B7W A;  4TPS B;  4LFB C;  1FJG C;  4G37 A;  5BSM A;  2UUA C;  1N33 C;  4HPV A;  3FCE A;  2VZE A;  4X64 C;  4OYC A;  2P2J A;  2QW0 X;  1XRB A;  1N32 C;  4DR3 C;  2HHH C;  4EAT A;  1PG4 A;  3VNS A;  4JI4 C;  2CY1 A;  1ULT A;  2VSQ A;  4MH4 A;  1XNQ C;  4OX9 C;  2BJO A;  4L7I A;  4RLF A;  1XRC A;  5K8F A;  4JI8 C;  5T8T A;  5BSW A;  4DV1 C;  3KXW A;  5BSR A;  3NYQ A;  1USP A;  5A1G A;  3L95 X;  4G1I A;  4ZLP A;  1PG3 A;  4LF7 C;  3IEU A;  2P20 A;  3E7X A;  1LQL A;  3R9X A;  4YHH C;  4DCV A;  5GTD A;  2E8E A;  4RM3 A;  2UXD C;  3IEV A;  4DV4 C;  5KYV A;  1K0R A;  2HJG A;  2D28 C;  4NXM C;  4BSZ A;  2OPL A;  3NPD A;  4B3S C;  3TDE A;  3IPL A;  3I08 A;  1USP B;  3EQ6 A;  1P7L A;  2ONF A;  4JI1 C;  4DR4 C;  4DR7 C;  2D7V A;  3E7W A;  5A19 A;  2AYA A;  1HH2 P;  3GR0 A;  5IWA C;  4JYA C;  5BSU A;  1BA3 A;  1O9T A;  3VNQ A;  5AE2 A;  2QVZ X;  3PRO C;  2ATW A;  1LCI A;  1FUG A;  1ZB9 A;  1O93 A;  4WV3 A;  2PN2 A;  1UKK A;  4OXI A;  2WP0 C;  4LF6 C;  4RMN A;  3G7S A;  5IFI A;  3AF5 A;  4G36 A;  4LF4 C;  1O92 A;  2D1T A;  5JRH A;  2OPL B;  1N34 C;  4FUQ A;  1O90 A;  4K0K C;  2XR1 A;  3DAY A;  3TQI A;  1HNW C;  2UUC C;  3CW9 A;  2P2M A;  4GS5 A;  2D27 A;  2Y27 A;  5K85 A;  1HR0 C;  5BSV A;  1MXB A;  1IBM C;  4X62 C;  4DV6 C;  4K0B A;  2DYJ A;  4BCA A;  2WD9 A;  4KTV A;  1WH9 A;  4D56 A;  1HNX C;  4DV2 C;  1V26 A;  3FCC A;  4FTF A;  3LNV A;  1V25 A;  4XX2 A;  4R0M A;  2QVY X;  4JI2 C;  5AE1 A;  1XMO C;  3NI2 A;  3IML A;  2UXC C;  1MDF A;  4JI5 C;  2VQE C;  2OBV A;  5LMN C;  5E7Q A;  2UXB C;  2D1R A;  4R1M A;  4BBY A;  2YCB A;  2YWC A;  2ASB A;  2P2Q A;  4LFA C;  3NYR A;  5BUS A;  5H9U A;  1XMQ C;  2QVX X;  1WF3 A;  2P2B A;  4DG8 A;  4BC7 A;  3LAX A;  1J5E C;  2E8F A;  4DV7 C;  2YWB A;  4B3M C;  3GR1 A;  1QWI A;  1PA4 A;  2P2F A;  3H2T A;  5CZX A;  2E0G A;  4ZJZ A;  1L2F A;  4GKJ C;  2D1S A;  1MDB A;  4I9F A;  4U5Y D;  3J81 D;  1KKG A;  4X66 C;  2F4V C;  4RM2 A;  4DV3 C;  1MXC A;  4X65 C;  2E7G A;  5BUQ A;  3I07 A;  4PZP A;  1T5D X;  4MTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...