2UXBC

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 30
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uxbC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uxbC02
1VLAA 1J5EC 4XX2A 1HNWC 4YHHC 4JI7C 1KKGA 2E8CA 4JI1C 4MTNA 4DUYC 4X65C 3AF5A 2BJOA 4JI5C 4B3SC 2KZFA 2UU9C 1ML8A 1WF3A 1IBLC 4LF6C 4LF7C 1N34C 4LF9C 2UXBC 4DR2C 3I07A 5FLXD 1HR0C 2UXDC 2JMPA 2OPLA 4AQYC 1ZB9A 3IEUA 4X66C 1XMOC 4JI2C 1IBMC 4DR4C 3JAMD 2VQFC 3LUSA 4DR5C 4LFAC 2ZM6C 2ATWA 3T1YC 4DCVA 1NYEA 2UUBC 1EGAA 4DUZC 4DV0C 1HNXC 4JI6C 1UKKA 4JI8C 2HJGA 5LMUC 2EGTA 1XMQC 4GKJC 1JOSA 2E5LC 3IEVA 3OTOC 3R9XA 2HHHC 2CXCA 3EERA 3J7AD 3J80D 4MH4A 5LMNC 4DV7C 4OX9C 2OPLB 4DCUA 2UUCC 4LFCC 1K0RA 4X64C 4LF8C 4DV3C 3J81D 4JI3C 5IT9D 4YY3C 3T1HC 5BR8C 5A2QD 1WH9A 4DV4C 4LF5C 4NXMC 2UXCC 2PN2A 2UUAC 5IWAC 2DYJA 2QL8A 1MKYA 4B3MC 4NXNC 1QWIA 4NOZA 2F4VC 4DR1C 3CJEA 4B3RC 2E7GA 1N2FA 4DR3C 4DV5C 1FJGC 1N33C 1HH2P 4KHPC 4X62C 4DV1C 4GKKC 1ZB8A 3GKUA 1USPB 4B3TC 2YCBA 4DCSA 4JI0C 1N32C 3R9WA 2CY1A 4DV2C 1N36C 4JI4C 1HNZC 4DV6C 4BSZA 1L2FA 2E8EA 1I94C 1IBKC 1USPA 2D7VA 2ONFA 4DR6C 4JV5C 2E8FA 4K0KC 4LF4C 2XR1A 4JYAC 4DCTA 3AF6A 1PA4A 2VQEC 1XNQC 4LFBC 2PT7G 1XNRC 1LQLA 2ASBA 4DR7C
chains in the Genus database with same CATH superfamily
1J5EC 1HNWC 4YHHC 1KKGA 3A4IA 2YWBA 3AF5A 3IPLA 2KZFA 1P4EC 1ML8A 4FUQA 2WD9A 4LF6C 1N34C 3H2TA 5BSVA 3K6RA 2JMPA 2OPLA 4AQYC 1ZB9A 3IEUA 1V26A 2D1QA 4DR4C 2VQFC 2ATWA 2ZM6C 2AYAA 1PG3A 2D27A 2DHMA 4G37A 5BUSA 4GKJC 1JOSA 5BSWA 2E5LC 2VSQA 3OTOC 2HHHC 3J7AD 4HPVA 4MH4A 5LMNC 2QW0X 3C5EA 2UUCC 1K0RA 1MDFA 4LF8C 4DV3C 3T1HC 3A9VA 3IMLA 3NYRA 4DG9A 4DV4C 4FTFA 3R44A 5LCIA 3N2QA 1O93A 3G7SA 4D4GA 1M6XA 4L7IA 2QL8A 1MKYA 4PUGA 4KHPC 5K85A 4X62C 4GKKC 4PHTA 3E7XA 4NDNA 2YCBA 3CQ1A 1AMUA 3NPDA 4JI0C 1N32C 2CY1A 3CW9A 3CW8X 4JI4C 1N36C 4DV6C 1HNZC 4JV5C 2M5OA 3CQ3A 5CZVA 4K0KC 3KXWA 3PROC 4JYAC 3A25A 4I9GA 1RG9A 4DCTA 5KYVA 3AF6A 4WS9A 2PT7G 4GS5A 3E7WA 1XNRC 3FCCA 1VLAA 2KZ0A 3FCEA 2Y27A 2E8CA 5A1IA 1TH5A 1MD9A 4MTNA 4RLQA 4U5YD 2P2JA 4RLFA 4X65C 4DG8A 4B3SC 5H9UA 2M5HA 3I08A 2ZZNA 5AE3A 2UXBC 4DR2C 1HR0C 3UZ0A 3TR3A 4X66C 1XMOC 3GPCA 1IBMC 3LUSA 4DR5C 4LFAC 1PU1A 4D4IA 4DCVA 1EGAA 2MCQA 1UKKA 4JI8C 2HJGA 5BUQA 2MM9A 1XMQC 3A26A 3EERA 4ZJZA 1M6XC 3DLPX 4OX9C 1P4EA 2OPLB 4DCUA 4LFCC 4X64C 4PUIA 2P20A 5IFIA 5A2QD 3UX2A 3A9UA 2PROA 2NCLA 3O2EA 4ODJA 3LGXA 4OXIA 2UXCC 2PN2A 2UUAC 4PUHA 1UWDA 2D1RA 3B7WA 4NXNC 1NY8A 3CJEA 4B3RC 4DR3C 2Y4NA 5AE1A 5GTDA 1O9TA 1MXBA 5BSMA 3LNOA 3NI2A 5A1GA 4B3TC 1USPB 3RG2A 1XRBA 4DCSA 3R9WA 1T5HX 3TUFA 1IBKC 4R1LA 4L2ZA 3UX3A 4K0BA 1RY2A 5E7QA 4KTTA 1XNQC 2ZTBA 5KEIA 4DR7C 2PG1E 4D56A 3N54B 3RV2A 2BJOA 2JNVA 1YJ7A 1V60A 2VZEA 2P02A 4LF9C 1XRCA 4L4QA 3I07A 5KYTA 2UXDC 3UOWA 5AE2A 2ZZMA 4JI2C 3LNVA 3JAMD 3PESA 1NYEA 1HNXC 4RVOA 4JI6C 4IR7A 2EGTA 4OYCA 3R9XA 3TDEA 5T8TA 4IZ6A 1FLOA 3J80D 4BC7A 4DV7C 4RM2A 2YX1A 3EQ6A 5BSTA 3CQ2A 3J81D 4JI3C 5IT9D 4YY3C 3TQIA 5A19A 1T5DX 4RM3A 1XHJA 1FUGA 3PBKA 2P2FA 5IWAC 1MDBA 4BBYA 4B3MC 4RMNA 1QWIA 3GR0A 2E7GA 1N2FA 1V25A 4I9FA 4DV5C 1N33C 1XRAA 2D1SA 4DV1C 1QM4A 2P2MA 1P7LA 1MXCA 3GKUA 2OO4A 4TPSB 4WV3A 4BSZA 1L2FA 2E8EA 1I94C 4DR6C 2E8FA 2BH1X 2KDNA 1PG4A 4R0MA 3ETOA 4LFBC 5K8FA 2QVXX 3AY0A 4XX2A 1MXAA 4G36A 4JI7C 5BSUA 4JI1C 3LAXA 4DUYC 4JI5C 2UU9C 2Z51A 1WF3A 1IBLC 3ETCA 4LF7C 1O92A 2DPLA 2P2QA 2E0GA 4GXQA 5JRHA 5FLXD 4FUTA 4BC9A 4EATA 3S82A 3UEBA 3NYQA 3SO4A 4LE5A 3L8CA 4RVNA 3T1YC 2UUBC 2QVYX 4ZLPA 4DUZC 1VEHA 4DV0C 4PROC 5LMUC 4D57A 4BCAA 1XS3A 3IEVA 2QVZX 2YWCA 2CXCA 1XDXA 2CU6A 4PZPA 2P2BA 5DV9A 4G1IA 4R1MA 5BR8C 1WH9A 4LF5C 3DHVA 1GPMA 3L95X 4NXMC 1BA3A 3VNQA 3FM7A 4GXRA 2DYJA 1IB8A 5BURA 5BSRA 2F4VC 4NOZA 4DR1C 1ULTA 3VNSA 1FJGC 1HH2P 2Y4OA 4KTVA 1ZB8A 2D28C 2WP0C 3VNRA 3DAYA 4DV2C 5T8SA 2D1TA 1WCJA 2V7BA 1USPA 2D7VA 2ONFA 1LCIA 5CZXA 4LF4C 2XR1A 3GR1A 1O90A 2MMAB 5ADZA 2OBVA 1PA4A 2VQEC 1LQLA 2ASBA 4JM1A 1YGTA 4ISBA
chains in the Genus database with same CATH topology
1J5EC 1HNWC 4YHHC 1KKGA 3A4IA 2YWBA 3AF5A 3IPLA 2KZFA 1ML8A 4FUQA 2WD9A 4LF6C 1N34C 3H2TA 5BSVA 2JMPA 2OPLA 4AQYC 1ZB9A 3IEUA 1V26A 2D1QA 4DR4C 2VQFC 2ATWA 2ZM6C 2AYAA 1PG3A 2D27A 4G37A 5BUSA 4GKJC 1JOSA 5BSWA 2E5LC 2VSQA 3OTOC 2HHHC 3J7AD 4HPVA 4MH4A 5LMNC 2QW0X 3C5EA 2UUCC 1K0RA 1MDFA 4LF8C 4DV3C 3T1HC 3A9VA 3IMLA 3NYRA 4DG9A 4DV4C 4FTFA 3R44A 3N2QA 1O93A 3G7SA 4D4GA 4L7IA 2QL8A 1MKYA 4KHPC 5K85A 4X62C 4GKKC 4PHTA 3E7XA 4NDNA 2YCBA 1AMUA 3NPDA 4JI0C 1N32C 2CY1A 3CW9A 3CW8X 1HNZC 4JI4C 4DV6C 1N36C 4JV5C 5CZVA 4K0KC 3KXWA 3PROC 4JYAC 4I9GA 1RG9A 4DCTA 5KYVA 3AF6A 4WS9A 2PT7G 4GS5A 3E7WA 1XNRC 3FCCA 1VLAA 3FCEA 2Y27A 2E8CA 5A1IA 4U5YD 1MD9A 4MTNA 4RLQA 4DG8A 2P2JA 4RLFA 4X65C 4B3SC 5H9UA 3I08A 5AE3A 2UXBC 4DR2C 1HR0C 3UZ0A 4X66C 1XMOC 3GPCA 1IBMC 3LUSA 4DR5C 4LFAC 4D4IA 4DCVA 1EGAA 1UKKA 4JI8C 2HJGA 5BUQA 1XMQC 3EERA 4ZJZA 3DLPX 4OX9C 2OPLB 4DCUA 4LFCC 4X64C 2P20A 5IFIA 5A2QD 3A9UA 2PROA 4ODJA 3LGXA 4OXIA 2UXCC 2PN2A 2UUAC 2D1RA 3B7WA 4NXNC 3CJEA 4B3RC 4DR3C 2Y4NA 5AE1A 5GTDA 1O9TA 1MXBA 5BSMA 3NI2A 5A1GA 4B3TC 1USPB 3RG2A 1XRBA 4DCSA 3R9WA 1T5HX 3TUFA 1IBKC 4R1LA 4L2ZA 4K0BA 1RY2A 5E7QA 4KTTA 1XNQC 5KEIA 4DR7C 4D56A 3N54B 3RV2A 2BJOA 1YJ7A 2VZEA 2P02A 4LF9C 1XRCA 4L4QA 3I07A 5KYTA 2UXDC 3UOWA 5AE2A 4JI2C 3LNVA 3JAMD 3PESA 1NYEA 1HNXC 4RVOA 4JI6C 4IR7A 2EGTA 4OYCA 3R9XA 3TDEA 5T8TA 4IZ6A 3J80D 4BC7A 4DV7C 4RM2A 3EQ6A 5BSTA 3J81D 4JI3C 5IT9D 4YY3C 3TQIA 5A19A 1T5DX 4RM3A 1FUGA 3PBKA 2P2FA 5IWAC 1MDBA 4BBYA 4B3MC 4RMNA 1QWIA 3GR0A 2E7GA 1N2FA 1V25A 4I9FA 4DV5C 1N33C 1XRAA 2D1SA 4DV1C 1QM4A 2P2MA 1P7LA 1MXCA 3GKUA 2OO4A 4TPSB 4WV3A 4BSZA 1L2FA 2E8EA 1I94C 4DR6C 2E8FA 2BH1X 1PG4A 4R0MA 3ETOA 4LFBC 5K8FA 2QVXX 4XX2A 1MXAA 4G36A 4JI7C 5BSUA 4JI1C 3LAXA 4DUYC 4JI5C 2UU9C 1WF3A 1IBLC 3ETCA 4LF7C 1O92A 2DPLA 2P2QA 2E0GA 4GXQA 5JRHA 5FLXD 4FUTA 4BC9A 4EATA 3S82A 3NYQA 3SO4A 4LE5A 3L8CA 4RVNA 3T1YC 2UUBC 2QVYX 4ZLPA 4DUZC 4DV0C 4PROC 5LMUC 4D57A 4BCAA 3IEVA 2QVZX 2YWCA 2CXCA 4PZPA 2P2BA 5DV9A 4G1IA 4R1MA 5BR8C 1WH9A 4LF5C 3DHVA 1GPMA 3L95X 4NXMC 1BA3A 3VNQA 4GXRA 2DYJA 5BURA 5BSRA 2F4VC 4NOZA 4DR1C 1ULTA 3VNSA 1FJGC 1HH2P 2Y4OA 4KTVA 1ZB8A 2D28C 2WP0C 3VNRA 3DAYA 4DV2C 5T8SA 2D1TA 2V7BA 1USPA 2D7VA 2ONFA 1LCIA 5CZXA 4LF4C 2XR1A 3GR1A 1O90A 5ADZA 2OBVA 1PA4A 2VQEC 1LQLA 2ASBA 4JM1A 4ISBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLA A;  1J5E C;  4XX2 A;  1HNW C;  4YHH C;  4JI7 C;  1KKG A;  2E8C A;  4JI1 C;  4MTN A;  4DUY C;  4X65 C;  3AF5 A;  2BJO A;  4JI5 C;  4B3S C;  2KZF A;  2UU9 C;  1ML8 A;  1WF3 A;  1IBL C;  4LF6 C;  4LF7 C;  1N34 C;  4LF9 C;  2UXB C;  4DR2 C;  3I07 A;  5FLX D;  1HR0 C;  2UXD C;  2JMP A;  2OPL A;  4AQY C;  1ZB9 A;  3IEU A;  4X66 C;  1XMO C;  4JI2 C;  1IBM C;  4DR4 C;  3JAM D;  2VQF C;  3LUS A;  4DR5 C;  4LFA C;  2ZM6 C;  2ATW A;  3T1Y C;  4DCV A;  1NYE A;  2UUB C;  1EGA A;  4DUZ C;  4DV0 C;  1HNX C;  4JI6 C;  1UKK A;  4JI8 C;  2HJG A;  5LMU C;  2EGT A;  1XMQ C;  4GKJ C;  1JOS A;  2E5L C;  3IEV A;  3OTO C;  3R9X A;  2HHH C;  2CXC A;  3EER A;  3J7A D;  3J80 D;  4MH4 A;  5LMN C;  4DV7 C;  4OX9 C;  2OPL B;  4DCU A;  2UUC C;  4LFC C;  1K0R A;  4X64 C;  4LF8 C;  4DV3 C;  3J81 D;  4JI3 C;  5IT9 D;  4YY3 C;  3T1H C;  5BR8 C;  5A2Q D;  1WH9 A;  4DV4 C;  4LF5 C;  4NXM C;  2UXC C;  2PN2 A;  2UUA C;  5IWA C;  2DYJ A;  2QL8 A;  1MKY A;  4B3M C;  4NXN C;  1QWI A;  4NOZ A;  2F4V C;  4DR1 C;  3CJE A;  4B3R C;  2E7G A;  1N2F A;  4DR3 C;  4DV5 C;  1FJG C;  1N33 C;  1HH2 P;  4KHP C;  4X62 C;  4DV1 C;  4GKK C;  1ZB8 A;  3GKU A;  1USP B;  4B3T C;  2YCB A;  4DCS A;  4JI0 C;  1N32 C;  3R9W A;  2CY1 A;  4DV2 C;  1N36 C;  4JI4 C;  1HNZ C;  4DV6 C;  4BSZ A;  1L2F A;  2E8E A;  1I94 C;  1IBK C;  1USP A;  2D7V A;  2ONF A;  4DR6 C;  4JV5 C;  2E8F A;  4K0K C;  4LF4 C;  2XR1 A;  4JYA C;  4DCT A;  3AF6 A;  1PA4 A;  2VQE C;  1XNQ C;  4LFB C;  2PT7 G;  1XNR C;  1LQL A;  2ASB A;  4DR7 C; 
#chains in the Genus database with same CATH topology
 1J5E C;  1HNW C;  4YHH C;  1KKG A;  3A4I A;  2YWB A;  3AF5 A;  3IPL A;  2KZF A;  1P4E C;  1ML8 A;  4FUQ A;  2WD9 A;  4LF6 C;  1N34 C;  3H2T A;  5BSV A;  3K6R A;  2JMP A;  2OPL A;  4AQY C;  1ZB9 A;  3IEU A;  1V26 A;  2D1Q A;  4DR4 C;  2VQF C;  2ATW A;  2ZM6 C;  2AYA A;  1PG3 A;  2D27 A;  2DHM A;  4G37 A;  5BUS A;  4GKJ C;  1JOS A;  5BSW A;  2E5L C;  2VSQ A;  3OTO C;  2HHH C;  3J7A D;  4HPV A;  4MH4 A;  5LMN C;  2QW0 X;  3C5E A;  2UUC C;  1K0R A;  1MDF A;  4LF8 C;  4DV3 C;  3T1H C;  3A9V A;  3IML A;  3NYR A;  4DG9 A;  4DV4 C;  4FTF A;  3R44 A;  5LCI A;  3N2Q A;  1O93 A;  3G7S A;  4D4G A;  1M6X A;  4L7I A;  2QL8 A;  1MKY A;  4PUG A;  4KHP C;  5K85 A;  4X62 C;  4GKK C;  4PHT A;  3E7X A;  4NDN A;  2YCB A;  3CQ1 A;  1AMU A;  3NPD A;  4JI0 C;  1N32 C;  2CY1 A;  3CW9 A;  3CW8 X;  4JI4 C;  1N36 C;  4DV6 C;  1HNZ C;  4JV5 C;  2M5O A;  3CQ3 A;  5CZV A;  4K0K C;  3KXW A;  3PRO C;  4JYA C;  3A25 A;  4I9G A;  1RG9 A;  4DCT A;  5KYV A;  3AF6 A;  4WS9 A;  2PT7 G;  4GS5 A;  3E7W A;  1XNR C;  3FCC A;  1VLA A;  2KZ0 A;  3FCE A;  2Y27 A;  2E8C A;  5A1I A;  1TH5 A;  1MD9 A;  4MTN A;  4RLQ A;  4U5Y D;  2P2J A;  4RLF A;  4X65 C;  4DG8 A;  4B3S C;  5H9U A;  2M5H A;  3I08 A;  2ZZN A;  5AE3 A;  2UXB C;  4DR2 C;  1HR0 C;  3UZ0 A;  3TR3 A;  4X66 C;  1XMO C;  3GPC A;  1IBM C;  3LUS A;  4DR5 C;  4LFA C;  1PU1 A;  4D4I A;  4DCV A;  1EGA A;  2MCQ A;  1UKK A;  4JI8 C;  2HJG A;  5BUQ A;  2MM9 A;  1XMQ C;  3A26 A;  3EER A;  4ZJZ A;  1M6X C;  3DLP X;  4OX9 C;  1P4E A;  2OPL B;  4DCU A;  4LFC C;  4X64 C;  4PUI A;  2P20 A;  5IFI A;  5A2Q D;  3UX2 A;  3A9U A;  2PRO A;  2NCL A;  3O2E A;  4ODJ A;  3LGX A;  4OXI A;  2UXC C;  2PN2 A;  2UUA C;  4PUH A;  1UWD A;  2D1R A;  3B7W A;  4NXN C;  1NY8 A;  3CJE A;  4B3R C;  4DR3 C;  2Y4N A;  5AE1 A;  5GTD A;  1O9T A;  1MXB A;  5BSM A;  3LNO A;  3NI2 A;  5A1G A;  4B3T C;  1USP B;  3RG2 A;  1XRB A;  4DCS A;  3R9W A;  1T5H X;  3TUF A;  1IBK C;  4R1L A;  4L2Z A;  3UX3 A;  4K0B A;  1RY2 A;  5E7Q A;  4KTT A;  1XNQ C;  2ZTB A;  5KEI A;  4DR7 C;  2PG1 E;  4D56 A;  3N54 B;  3RV2 A;  2BJO A;  2JNV A;  1YJ7 A;  1V60 A;  2VZE A;  2P02 A;  4LF9 C;  1XRC A;  4L4Q A;  3I07 A;  5KYT A;  2UXD C;  3UOW A;  5AE2 A;  2ZZM A;  4JI2 C;  3LNV A;  3JAM D;  3PES A;  1NYE A;  1HNX C;  4RVO A;  4JI6 C;  4IR7 A;  2EGT A;  4OYC A;  3R9X A;  3TDE A;  5T8T A;  4IZ6 A;  1FLO A;  3J80 D;  4BC7 A;  4DV7 C;  4RM2 A;  2YX1 A;  3EQ6 A;  5BST A;  3CQ2 A;  3J81 D;  4JI3 C;  5IT9 D;  4YY3 C;  3TQI A;  5A19 A;  1T5D X;  4RM3 A;  1XHJ A;  1FUG A;  3PBK A;  2P2F A;  5IWA C;  1MDB A;  4BBY A;  4B3M C;  4RMN A;  1QWI A;  3GR0 A;  2E7G A;  1N2F A;  1V25 A;  4I9F A;  4DV5 C;  1N33 C;  1XRA A;  2D1S A;  4DV1 C;  1QM4 A;  2P2M A;  1P7L A;  1MXC A;  3GKU A;  2OO4 A;  4TPS B;  4WV3 A;  4BSZ A;  1L2F A;  2E8E A;  1I94 C;  4DR6 C;  2E8F A;  2BH1 X;  2KDN A;  1PG4 A;  4R0M A;  3ETO A;  4LFB C;  5K8F A;  2QVX X;  3AY0 A;  4XX2 A;  1MXA A;  4G36 A;  4JI7 C;  5BSU A;  4JI1 C;  3LAX A;  4DUY C;  4JI5 C;  2UU9 C;  2Z51 A;  1WF3 A;  1IBL C;  3ETC A;  4LF7 C;  1O92 A;  2DPL A;  2P2Q A;  2E0G A;  4GXQ A;  5JRH A;  5FLX D;  4FUT A;  4BC9 A;  4EAT A;  3S82 A;  3UEB A;  3NYQ A;  3SO4 A;  4LE5 A;  3L8C A;  4RVN A;  3T1Y C;  2UUB C;  2QVY X;  4ZLP A;  4DUZ C;  1VEH A;  4DV0 C;  4PRO C;  5LMU C;  4D57 A;  4BCA A;  1XS3 A;  3IEV A;  2QVZ X;  2YWC A;  2CXC A;  1XDX A;  2CU6 A;  4PZP A;  2P2B A;  5DV9 A;  4G1I A;  4R1M A;  5BR8 C;  1WH9 A;  4LF5 C;  3DHV A;  1GPM A;  3L95 X;  4NXM C;  1BA3 A;  3VNQ A;  3FM7 A;  4GXR A;  2DYJ A;  1IB8 A;  5BUR A;  5BSR A;  2F4V C;  4NOZ A;  4DR1 C;  1ULT A;  3VNS A;  1FJG C;  1HH2 P;  2Y4O A;  4KTV A;  1ZB8 A;  2D28 C;  2WP0 C;  3VNR A;  3DAY A;  4DV2 C;  5T8S A;  2D1T A;  1WCJ A;  2V7B A;  1USP A;  2D7V A;  2ONF A;  1LCI A;  5CZX A;  4LF4 C;  2XR1 A;  3GR1 A;  1O90 A;  2MMA B;  5ADZ A;  2OBV A;  1PA4 A;  2VQE C;  1LQL A;  2ASB A;  4JM1 A;  1YGT A;  4ISB A; 
#chains in the Genus database with same CATH homology
 1J5E C;  1HNW C;  4YHH C;  1KKG A;  3A4I A;  2YWB A;  3AF5 A;  3IPL A;  2KZF A;  1ML8 A;  4FUQ A;  2WD9 A;  4LF6 C;  1N34 C;  3H2T A;  5BSV A;  2JMP A;  2OPL A;  4AQY C;  1ZB9 A;  3IEU A;  1V26 A;  2D1Q A;  4DR4 C;  2VQF C;  2ATW A;  2ZM6 C;  2AYA A;  1PG3 A;  2D27 A;  4G37 A;  5BUS A;  4GKJ C;  1JOS A;  5BSW A;  2E5L C;  2VSQ A;  3OTO C;  2HHH C;  3J7A D;  4HPV A;  4MH4 A;  5LMN C;  2QW0 X;  3C5E A;  2UUC C;  1K0R A;  1MDF A;  4LF8 C;  4DV3 C;  3T1H C;  3A9V A;  3IML A;  3NYR A;  4DG9 A;  4DV4 C;  4FTF A;  3R44 A;  3N2Q A;  1O93 A;  3G7S A;  4D4G A;  4L7I A;  2QL8 A;  1MKY A;  4KHP C;  5K85 A;  4X62 C;  4GKK C;  4PHT A;  3E7X A;  4NDN A;  2YCB A;  1AMU A;  3NPD A;  4JI0 C;  1N32 C;  2CY1 A;  3CW9 A;  3CW8 X;  1HNZ C;  4JI4 C;  4DV6 C;  1N36 C;  4JV5 C;  5CZV A;  4K0K C;  3KXW A;  3PRO C;  4JYA C;  4I9G A;  1RG9 A;  4DCT A;  5KYV A;  3AF6 A;  4WS9 A;  2PT7 G;  4GS5 A;  3E7W A;  1XNR C;  3FCC A;  1VLA A;  3FCE A;  2Y27 A;  2E8C A;  5A1I A;  4U5Y D;  1MD9 A;  4MTN A;  4RLQ A;  4DG8 A;  2P2J A;  4RLF A;  4X65 C;  4B3S C;  5H9U A;  3I08 A;  5AE3 A;  2UXB C;  4DR2 C;  1HR0 C;  3UZ0 A;  4X66 C;  1XMO C;  3GPC A;  1IBM C;  3LUS A;  4DR5 C;  4LFA C;  4D4I A;  4DCV A;  1EGA A;  1UKK A;  4JI8 C;  2HJG A;  5BUQ A;  1XMQ C;  3EER A;  4ZJZ A;  3DLP X;  4OX9 C;  2OPL B;  4DCU A;  4LFC C;  4X64 C;  2P20 A;  5IFI A;  5A2Q D;  3A9U A;  2PRO A;  4ODJ A;  3LGX A;  4OXI A;  2UXC C;  2PN2 A;  2UUA C;  2D1R A;  3B7W A;  4NXN C;  3CJE A;  4B3R C;  4DR3 C;  2Y4N A;  5AE1 A;  5GTD A;  1O9T A;  1MXB A;  5BSM A;  3NI2 A;  5A1G A;  4B3T C;  1USP B;  3RG2 A;  1XRB A;  4DCS A;  3R9W A;  1T5H X;  3TUF A;  1IBK C;  4R1L A;  4L2Z A;  4K0B A;  1RY2 A;  5E7Q A;  4KTT A;  1XNQ C;  5KEI A;  4DR7 C;  4D56 A;  3N54 B;  3RV2 A;  2BJO A;  1YJ7 A;  2VZE A;  2P02 A;  4LF9 C;  1XRC A;  4L4Q A;  3I07 A;  5KYT A;  2UXD C;  3UOW A;  5AE2 A;  4JI2 C;  3LNV A;  3JAM D;  3PES A;  1NYE A;  1HNX C;  4RVO A;  4JI6 C;  4IR7 A;  2EGT A;  4OYC A;  3R9X A;  3TDE A;  5T8T A;  4IZ6 A;  3J80 D;  4BC7 A;  4DV7 C;  4RM2 A;  3EQ6 A;  5BST A;  3J81 D;  4JI3 C;  5IT9 D;  4YY3 C;  3TQI A;  5A19 A;  1T5D X;  4RM3 A;  1FUG A;  3PBK A;  2P2F A;  5IWA C;  1MDB A;  4BBY A;  4B3M C;  4RMN A;  1QWI A;  3GR0 A;  2E7G A;  1N2F A;  1V25 A;  4I9F A;  4DV5 C;  1N33 C;  1XRA A;  2D1S A;  4DV1 C;  1QM4 A;  2P2M A;  1P7L A;  1MXC A;  3GKU A;  2OO4 A;  4TPS B;  4WV3 A;  4BSZ A;  1L2F A;  2E8E A;  1I94 C;  4DR6 C;  2E8F A;  2BH1 X;  1PG4 A;  4R0M A;  3ETO A;  4LFB C;  5K8F A;  2QVX X;  4XX2 A;  1MXA A;  4G36 A;  4JI7 C;  5BSU A;  4JI1 C;  3LAX A;  4DUY C;  4JI5 C;  2UU9 C;  1WF3 A;  1IBL C;  3ETC A;  4LF7 C;  1O92 A;  2DPL A;  2P2Q A;  2E0G A;  4GXQ A;  5JRH A;  5FLX D;  4FUT A;  4BC9 A;  4EAT A;  3S82 A;  3NYQ A;  3SO4 A;  4LE5 A;  3L8C A;  4RVN A;  3T1Y C;  2UUB C;  2QVY X;  4ZLP A;  4DUZ C;  4DV0 C;  4PRO C;  5LMU C;  4D57 A;  4BCA A;  3IEV A;  2QVZ X;  2YWC A;  2CXC A;  4PZP A;  2P2B A;  5DV9 A;  4G1I A;  4R1M A;  5BR8 C;  1WH9 A;  4LF5 C;  3DHV A;  1GPM A;  3L95 X;  4NXM C;  1BA3 A;  3VNQ A;  4GXR A;  2DYJ A;  5BUR A;  5BSR A;  2F4V C;  4NOZ A;  4DR1 C;  1ULT A;  3VNS A;  1FJG C;  1HH2 P;  2Y4O A;  4KTV A;  1ZB8 A;  2D28 C;  2WP0 C;  3VNR A;  3DAY A;  4DV2 C;  5T8S A;  2D1T A;  2V7B A;  1USP A;  2D7V A;  2ONF A;  1LCI A;  5CZX A;  4LF4 C;  2XR1 A;  3GR1 A;  1O90 A;  5ADZ A;  2OBV A;  1PA4 A;  2VQE C;  1LQL A;  2ASB A;  4JM1 A;  4ISB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...