3T1YC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3t1yC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3t1yC02
1N34C 1N2FA 4DCTA 5LMNC 4DR5C 4LF6C 2PN2A 3T1HC 1N33C 5BR8C 2VQFC 5IT9D 1JOSA 4LF4C 4KHPC 1KKGA 2UUBC 1XMOC 4DV7C 2UUAC 4JI8C 4DCVA 2BJOA 1WF3A 1ZB8A 4JI4C 2JMPA 5FLXD 3T1YC 4DV4C 4DV2C 4LF5C 1WH9A 4DR7C 1NYEA 2UXDC 4K0KC 2ONFA 4LF7C 4OX9C 3I07A 2UU9C 4LF9C 3IEUA 4JI2C 4X65C 4X64C 1XMQC 4DUZC 2HHHC 1VLAA 2E8EA 4JV5C 2CXCA 4DR4C 4GKKC 3GKUA 4LFBC 1PA4A 2UUCC 3AF5A 4NXMC 4X66C 5LMUC 3J7AD 1QWIA 2CY1A 2YCBA 4B3SC 3IEVA 1XNRC 4JI5C 1N36C 4DR6C 5IWAC 3CJEA 1IBKC 1I94C 2OPLA 1HNWC 3J80D 4DR3C 4JI7C 3R9XA 3EERA 1J5EC 1USPA 3OTOC 4DV0C 4LF8C 1K0RA 4MH4A 2XR1A 2VQEC 4JI1C 1EGAA 4DV5C 2KZFA 1HNXC 1HH2P 4B3MC 1LQLA 2PT7G 3J81D 4JI0C 2EGTA 4GKJC 3AF6A 1XNQC 1ZB9A 2ATWA 3R9WA 2DYJA 1USPB 1ML8A 2ZM6C 3LUSA 2UXBC 4DCUA 4JYAC 4YHHC 1HNZC 1IBLC 4NOZA 1MKYA 5A2QD 4DV1C 4JI6C 2UXCC 2ASBA 2E8FA 4B3TC 4DCSA 2F4VC 4LFCC 2E8CA 1FJGC 4AQYC 4DUYC 2E5LC 2E7GA 4DR1C 4NXNC 4XX2A 4DV6C 2QL8A 2OPLB 2D7VA 2HJGA 1N32C 4YY3C 4MTNA 1UKKA 4BSZA 4DV3C 1IBMC 1L2FA 3JAMD 4DR2C 4LFAC 4JI3C 4X62C 1HR0C 4B3RC
chains in the Genus database with same CATH superfamily
4WV3A 4WS9A 3IMLA 1JOSA 1NY8A 1KKGA 4JI8C 1P7LA 1XRCA 3A9VA 2BJOA 2WP0C 4L4QA 2JMPA 3RV2A 4DV4C 5CZXA 4DV2C 4LF5C 1WH9A 3L95X 4GXQA 5BSWA 1XS3A 3I07A 5BSRA 5JRHA 4DG8A 5BSVA 2HHHC 4PUGA 3A25A 4JV5C 3I08A 5T8SA 3NYQA 4GS5A 4GKKC 3GKUA 5BSMA 3AY0A 1PA4A 1MDFA 2UUCC 2OBVA 3J7AD 2YCBA 1O92A 3IEVA 1XNRC 2AYAA 1N36C 2OO4A 4DR6C 5IWAC 1IBKC 1J5EC 5AE2A 3N2QA 2VQEC 1EGAA 4PZPA 4DG9A 1M6XC 4ODJA 1LQLA 5K8FA 1PG4A 4JI0C 3LAXA 5KYTA 3DHVA 2WD9A 3LUSA 3VNSA 5A2QD 4D4GA 3NI2A 2ASBA 4B3TC 2D28C 2E0GA 4AQYC 2Y4NA 5AE3A 4ZLPA 2P02A 2Z51A 2QL8A 2D1SA 4MTNA 2D1RA 3NPDA 5KEIA 2P2JA 4I9FA 4D56A 3JAMD 2QVXX 5K85A 2P2BA 4TPSB 1XDXA 2NCLA 2QW0X 4RLFA 2BH1X 2MCQA 1N34C 5LMNC 4DR5C 5A1GA 5IT9D 1RY2A 4LF4C 3CW8X 4JM1A 2PG1E 1PU1A 1GPMA 4FTFA 2KZ0A 1WF3A 4JI4C 5DV9A 3TR3A 4EATA 1NYEA 4IR7A 2ONFA 4LE5A 5BUQA 2D27A 3IEUA 2DHMA 3N54B 1XMQC 5BSUA 3NYRA 3FCEA 2QVZX 3UZ0A 3A9UA 3AF5A 4G1IA 5LMUC 4JI5C 3A26A 3CQ3A 2Y4OA 2P2FA 4D4IA 3CW9A 4PROC 2CU6A 1HNWC 1MXCA 4JI7C 3GR1A 4I9GA 3VNQA 3PROC 4DV5C 3ETOA 1HH2P 2P2MA 1TH5A 3UEBA 4GKJC 3GPCA 1XNQC 3R9WA 3IPLA 1P4EA 1O90A 1USPB 2ZM6C 2Y27A 4PUHA 1FUGA 2YWBA 3E7WA 4ZJZA 2P20A 4NOZA 3RG2A 1YJ7A 3GR0A 3VNRA 3PBKA 1IB8A 4DCSA 2E8CA 2P2QA 3SO4A 4DUYC 1UWDA 4KTTA 1N32C 4YY3C 1UKKA 4DV3C 5E7QA 1XHJA 5CZVA 1AMUA 4LFAC 4JI3C 3PESA 4RLQA 2MMAB 4RVNA 4BC9A 2PN2A 1N33C 3FM7A 3LNOA 4R0MA 2UUBC 1LCIA 1XMOC 4DV7C 2UUAC 1WCJA 3CQ1A 5BURA 2PROA 4DCVA 4NDNA 5FLXD 3T1YC 3UX3A 4D57A 4K0KC 3C5EA 2MM9A 4LF7C 5BSTA 4OX9C 4LF9C 3TQIA 2M5OA 4G37A 3G7SA 4IZ6A 1MXAA 1O93A 2E8EA 2CXCA 1YGTA 4LFBC 4X66C 3R44A 1QWIA 2CY1A 4RM2A 3CJEA 4PUIA 3EQ6A 4FUTA 4DR3C 3R9XA 4RVOA 3OTOC 1T5DX 4DV0C 4LF8C 5LCIA 2XR1A 4KTVA 4JI1C 5H9UA 3E7XA 1HNXC 4HPVA 4L2ZA 4B3MC 2ZTBA 3K6RA 2PT7G 2EGTA 1ZB9A 5T8TA 4RMNA 4RM3A 1QM4A 1XRAA 2DYJA 2YX1A 4DCUA 4JYAC 2VZEA 3DLPX 4DV1C 4JI6C 2UXCC 2E8FA 2VSQA 3CQ2A 3DAYA 5GTDA 2JNVA 3UX2A 2E5LC 2E7GA 4DR1C 1V25A 4XX2A 2OPLB 2D7VA 2HJGA 3A4IA 5KYVA 2ZZMA 1RG9A 4PHTA 4DR2C 4X62C 1T5HX 2D1TA 3FCCA 1N2FA 4DCTA 2M5HA 2DPLA 4LF6C 3T1HC 4ISBA 5BR8C 2VQFC 4KHPC 2QVYX 3UOWA 4GXRA 4U5YD 2ZZNA 4K0BA 1ZB8A 4L7IA 3LNVA 3TDEA 4DR7C 3S82A 4BCAA 2UXDC 1MDBA 2UU9C 3B7WA 2YWCA 4JI2C 4X65C 4X64C 1FLOA 4DUZC 4OYCA 1VLAA 5BUSA 4FUQA 4BC7A 4DR4C 2KDNA 1ULTA 4NXMC 4B3SC 3O2EA 1I94C 2OPLA 3J80D 3LGXA 1V60A 3EERA 1USPA 1K0RA 4MH4A 3ETCA 2KZFA 4R1MA 3J81D 4OXIA 1M6XA 4R1LA 3AF6A 5AE1A 2ATWA 1XRBA 1ML8A 5A19A 1O9TA 3KXWA 2UXBC 4YHHC 3H2TA 1HNZC 1IBLC 1MXBA 4BBYA 1MKYA 5A1IA 1VEHA 1PG3A 3TUFA 1BA3A 4LFCC 2F4VC 1MD9A 1FJGC 1P4EC 2V7BA 1V26A 4NXNC 4DV6C 5ADZA 2D1QA 4BSZA 5IFIA 1IBMC 1L2FA 3L8CA 1HR0C 4G36A 4B3RC
chains in the Genus database with same CATH topology
4WV3A 4WS9A 3IMLA 1JOSA 1KKGA 4JI8C 1P7LA 1XRCA 3A9VA 2BJOA 2WP0C 4L4QA 2JMPA 3RV2A 4DV4C 5CZXA 4DV2C 4LF5C 1WH9A 3L95X 4GXQA 5BSWA 3I07A 5BSRA 5JRHA 4DG8A 5BSVA 2HHHC 4JV5C 3I08A 5T8SA 3NYQA 4GS5A 4GKKC 3GKUA 5BSMA 1PA4A 1MDFA 2UUCC 2OBVA 3J7AD 2YCBA 1O92A 3IEVA 1XNRC 2AYAA 1N36C 2OO4A 4DR6C 5IWAC 1IBKC 1J5EC 5AE2A 3N2QA 2VQEC 1EGAA 4PZPA 4DG9A 4ODJA 1LQLA 5K8FA 1PG4A 4JI0C 3LAXA 5KYTA 3DHVA 2WD9A 3LUSA 3VNSA 5A2QD 4D4GA 3NI2A 2ASBA 4B3TC 2D28C 2E0GA 4AQYC 2Y4NA 5AE3A 4ZLPA 2P02A 2QL8A 2D1SA 4MTNA 2D1RA 3NPDA 5KEIA 2P2JA 4I9FA 4D56A 3JAMD 2QVXX 5K85A 2P2BA 4TPSB 2QW0X 4RLFA 2BH1X 1N34C 5LMNC 4DR5C 5A1GA 5IT9D 1RY2A 4LF4C 3CW8X 4JM1A 1GPMA 4FTFA 1WF3A 4JI4C 5DV9A 4EATA 1NYEA 4IR7A 2ONFA 4LE5A 5BUQA 2D27A 3IEUA 3N54B 1XMQC 5BSUA 3NYRA 3FCEA 2QVZX 3UZ0A 3A9UA 3AF5A 4G1IA 5LMUC 4JI5C 2Y4OA 2P2FA 4D4IA 3CW9A 4PROC 1HNWC 1MXCA 4JI7C 3GR1A 4I9GA 3VNQA 3PROC 4DV5C 3ETOA 1HH2P 2P2MA 4GKJC 3GPCA 1XNQC 3R9WA 3IPLA 1O90A 1USPB 2ZM6C 2Y27A 1FUGA 2YWBA 3E7WA 4ZJZA 2P20A 4NOZA 3RG2A 1YJ7A 3GR0A 3VNRA 3PBKA 4DCSA 2E8CA 2P2QA 3SO4A 4DUYC 4KTTA 1N32C 4YY3C 1UKKA 4DV3C 5E7QA 5CZVA 1AMUA 4LFAC 4JI3C 3PESA 4RLQA 4RVNA 4BC9A 2PN2A 1N33C 4R0MA 2UUBC 1LCIA 1XMOC 4DV7C 2UUAC 5BURA 2PROA 4DCVA 4NDNA 5FLXD 3T1YC 4D57A 4K0KC 3C5EA 4LF7C 5BSTA 4OX9C 4LF9C 3TQIA 4G37A 3G7SA 4IZ6A 1MXAA 1O93A 2E8EA 2CXCA 4LFBC 4X66C 3R44A 1QWIA 2CY1A 4RM2A 3CJEA 3EQ6A 4FUTA 4DR3C 3R9XA 4RVOA 3OTOC 1T5DX 4DV0C 4LF8C 2XR1A 4KTVA 4JI1C 5H9UA 3E7XA 1HNXC 4HPVA 4L2ZA 4B3MC 2PT7G 2EGTA 1ZB9A 5T8TA 4RMNA 4RM3A 1QM4A 1XRAA 2DYJA 4DCUA 4JYAC 2VZEA 3DLPX 4DV1C 4JI6C 2UXCC 2E8FA 2VSQA 3DAYA 5GTDA 2E5LC 2E7GA 4DR1C 1V25A 4XX2A 2OPLB 2D7VA 2HJGA 3A4IA 5KYVA 1RG9A 4PHTA 4DR2C 4X62C 1T5HX 2D1TA 3FCCA 1N2FA 4DCTA 2DPLA 4LF6C 3T1HC 4ISBA 5BR8C 2VQFC 4KHPC 2QVYX 3UOWA 4GXRA 4U5YD 4K0BA 1ZB8A 4L7IA 3LNVA 3TDEA 4DR7C 3S82A 4BCAA 2UXDC 1MDBA 2UU9C 3B7WA 2YWCA 4JI2C 4X65C 4X64C 4DUZC 4OYCA 1VLAA 5BUSA 4FUQA 4BC7A 4DR4C 1ULTA 4NXMC 4B3SC 1I94C 2OPLA 3J80D 3LGXA 3EERA 1USPA 1K0RA 4MH4A 3ETCA 2KZFA 4R1MA 3J81D 4OXIA 4R1LA 3AF6A 5AE1A 2ATWA 1XRBA 1ML8A 5A19A 1O9TA 3KXWA 2UXBC 4YHHC 3H2TA 1HNZC 1IBLC 1MXBA 4BBYA 1MKYA 5A1IA 1PG3A 3TUFA 1BA3A 4LFCC 2F4VC 1MD9A 1FJGC 2V7BA 1V26A 4NXNC 4DV6C 5ADZA 2D1QA 4BSZA 5IFIA 1IBMC 1L2FA 3L8CA 1HR0C 4G36A 4B3RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 C;  1N2F A;  4DCT A;  5LMN C;  4DR5 C;  4LF6 C;  2PN2 A;  3T1H C;  1N33 C;  5BR8 C;  2VQF C;  5IT9 D;  1JOS A;  4LF4 C;  4KHP C;  1KKG A;  2UUB C;  1XMO C;  4DV7 C;  2UUA C;  4JI8 C;  4DCV A;  2BJO A;  1WF3 A;  1ZB8 A;  4JI4 C;  2JMP A;  5FLX D;  3T1Y C;  4DV4 C;  4DV2 C;  4LF5 C;  1WH9 A;  4DR7 C;  1NYE A;  2UXD C;  4K0K C;  2ONF A;  4LF7 C;  4OX9 C;  3I07 A;  2UU9 C;  4LF9 C;  3IEU A;  4JI2 C;  4X65 C;  4X64 C;  1XMQ C;  4DUZ C;  2HHH C;  1VLA A;  2E8E A;  4JV5 C;  2CXC A;  4DR4 C;  4GKK C;  3GKU A;  4LFB C;  1PA4 A;  2UUC C;  3AF5 A;  4NXM C;  4X66 C;  5LMU C;  3J7A D;  1QWI A;  2CY1 A;  2YCB A;  4B3S C;  3IEV A;  1XNR C;  4JI5 C;  1N36 C;  4DR6 C;  5IWA C;  3CJE A;  1IBK C;  1I94 C;  2OPL A;  1HNW C;  3J80 D;  4DR3 C;  4JI7 C;  3R9X A;  3EER A;  1J5E C;  1USP A;  3OTO C;  4DV0 C;  4LF8 C;  1K0R A;  4MH4 A;  2XR1 A;  2VQE C;  4JI1 C;  1EGA A;  4DV5 C;  2KZF A;  1HNX C;  1HH2 P;  4B3M C;  1LQL A;  2PT7 G;  3J81 D;  4JI0 C;  2EGT A;  4GKJ C;  3AF6 A;  1XNQ C;  1ZB9 A;  2ATW A;  3R9W A;  2DYJ A;  1USP B;  1ML8 A;  2ZM6 C;  3LUS A;  2UXB C;  4DCU A;  4JYA C;  4YHH C;  1HNZ C;  1IBL C;  4NOZ A;  1MKY A;  5A2Q D;  4DV1 C;  4JI6 C;  2UXC C;  2ASB A;  2E8F A;  4B3T C;  4DCS A;  2F4V C;  4LFC C;  2E8C A;  1FJG C;  4AQY C;  4DUY C;  2E5L C;  2E7G A;  4DR1 C;  4NXN C;  4XX2 A;  4DV6 C;  2QL8 A;  2OPL B;  2D7V A;  2HJG A;  1N32 C;  4YY3 C;  4MTN A;  1UKK A;  4BSZ A;  4DV3 C;  1IBM C;  1L2F A;  3JAM D;  4DR2 C;  4LFA C;  4JI3 C;  4X62 C;  1HR0 C;  4B3R C; 
#chains in the Genus database with same CATH topology
 4WV3 A;  4WS9 A;  3IML A;  1JOS A;  1NY8 A;  1KKG A;  4JI8 C;  1P7L A;  1XRC A;  3A9V A;  2BJO A;  2WP0 C;  4L4Q A;  2JMP A;  3RV2 A;  4DV4 C;  5CZX A;  4DV2 C;  4LF5 C;  1WH9 A;  3L95 X;  4GXQ A;  5BSW A;  1XS3 A;  3I07 A;  5BSR A;  5JRH A;  4DG8 A;  5BSV A;  2HHH C;  4PUG A;  3A25 A;  4JV5 C;  3I08 A;  5T8S A;  3NYQ A;  4GS5 A;  4GKK C;  3GKU A;  5BSM A;  3AY0 A;  1PA4 A;  1MDF A;  2UUC C;  2OBV A;  3J7A D;  2YCB A;  1O92 A;  3IEV A;  1XNR C;  2AYA A;  1N36 C;  2OO4 A;  4DR6 C;  5IWA C;  1IBK C;  1J5E C;  5AE2 A;  3N2Q A;  2VQE C;  1EGA A;  4PZP A;  4DG9 A;  1M6X C;  4ODJ A;  1LQL A;  5K8F A;  1PG4 A;  4JI0 C;  3LAX A;  5KYT A;  3DHV A;  2WD9 A;  3LUS A;  3VNS A;  5A2Q D;  4D4G A;  3NI2 A;  2ASB A;  4B3T C;  2D28 C;  2E0G A;  4AQY C;  2Y4N A;  5AE3 A;  4ZLP A;  2P02 A;  2Z51 A;  2QL8 A;  2D1S A;  4MTN A;  2D1R A;  3NPD A;  5KEI A;  2P2J A;  4I9F A;  4D56 A;  3JAM D;  2QVX X;  5K85 A;  2P2B A;  4TPS B;  1XDX A;  2NCL A;  2QW0 X;  4RLF A;  2BH1 X;  2MCQ A;  1N34 C;  5LMN C;  4DR5 C;  5A1G A;  5IT9 D;  1RY2 A;  4LF4 C;  3CW8 X;  4JM1 A;  2PG1 E;  1PU1 A;  1GPM A;  4FTF A;  2KZ0 A;  1WF3 A;  4JI4 C;  5DV9 A;  3TR3 A;  4EAT A;  1NYE A;  4IR7 A;  2ONF A;  4LE5 A;  5BUQ A;  2D27 A;  3IEU A;  2DHM A;  3N54 B;  1XMQ C;  5BSU A;  3NYR A;  3FCE A;  2QVZ X;  3UZ0 A;  3A9U A;  3AF5 A;  4G1I A;  5LMU C;  4JI5 C;  3A26 A;  3CQ3 A;  2Y4O A;  2P2F A;  4D4I A;  3CW9 A;  4PRO C;  2CU6 A;  1HNW C;  1MXC A;  4JI7 C;  3GR1 A;  4I9G A;  3VNQ A;  3PRO C;  4DV5 C;  3ETO A;  1HH2 P;  2P2M A;  1TH5 A;  3UEB A;  4GKJ C;  3GPC A;  1XNQ C;  3R9W A;  3IPL A;  1P4E A;  1O90 A;  1USP B;  2ZM6 C;  2Y27 A;  4PUH A;  1FUG A;  2YWB A;  3E7W A;  4ZJZ A;  2P20 A;  4NOZ A;  3RG2 A;  1YJ7 A;  3GR0 A;  3VNR A;  3PBK A;  1IB8 A;  4DCS A;  2E8C A;  2P2Q A;  3SO4 A;  4DUY C;  1UWD A;  4KTT A;  1N32 C;  4YY3 C;  1UKK A;  4DV3 C;  5E7Q A;  1XHJ A;  5CZV A;  1AMU A;  4LFA C;  4JI3 C;  3PES A;  4RLQ A;  2MMA B;  4RVN A;  4BC9 A;  2PN2 A;  1N33 C;  3FM7 A;  3LNO A;  4R0M A;  2UUB C;  1LCI A;  1XMO C;  4DV7 C;  2UUA C;  1WCJ A;  3CQ1 A;  5BUR A;  2PRO A;  4DCV A;  4NDN A;  5FLX D;  3T1Y C;  3UX3 A;  4D57 A;  4K0K C;  3C5E A;  2MM9 A;  4LF7 C;  5BST A;  4OX9 C;  4LF9 C;  3TQI A;  2M5O A;  4G37 A;  3G7S A;  4IZ6 A;  1MXA A;  1O93 A;  2E8E A;  2CXC A;  1YGT A;  4LFB C;  4X66 C;  3R44 A;  1QWI A;  2CY1 A;  4RM2 A;  3CJE A;  4PUI A;  3EQ6 A;  4FUT A;  4DR3 C;  3R9X A;  4RVO A;  3OTO C;  1T5D X;  4DV0 C;  4LF8 C;  5LCI A;  2XR1 A;  4KTV A;  4JI1 C;  5H9U A;  3E7X A;  1HNX C;  4HPV A;  4L2Z A;  4B3M C;  2ZTB A;  3K6R A;  2PT7 G;  2EGT A;  1ZB9 A;  5T8T A;  4RMN A;  4RM3 A;  1QM4 A;  1XRA A;  2DYJ A;  2YX1 A;  4DCU A;  4JYA C;  2VZE A;  3DLP X;  4DV1 C;  4JI6 C;  2UXC C;  2E8F A;  2VSQ A;  3CQ2 A;  3DAY A;  5GTD A;  2JNV A;  3UX2 A;  2E5L C;  2E7G A;  4DR1 C;  1V25 A;  4XX2 A;  2OPL B;  2D7V A;  2HJG A;  3A4I A;  5KYV A;  2ZZM A;  1RG9 A;  4PHT A;  4DR2 C;  4X62 C;  1T5H X;  2D1T A;  3FCC A;  1N2F A;  4DCT A;  2M5H A;  2DPL A;  4LF6 C;  3T1H C;  4ISB A;  5BR8 C;  2VQF C;  4KHP C;  2QVY X;  3UOW A;  4GXR A;  4U5Y D;  2ZZN A;  4K0B A;  1ZB8 A;  4L7I A;  3LNV A;  3TDE A;  4DR7 C;  3S82 A;  4BCA A;  2UXD C;  1MDB A;  2UU9 C;  3B7W A;  2YWC A;  4JI2 C;  4X65 C;  4X64 C;  1FLO A;  4DUZ C;  4OYC A;  1VLA A;  5BUS A;  4FUQ A;  4BC7 A;  4DR4 C;  2KDN A;  1ULT A;  4NXM C;  4B3S C;  3O2E A;  1I94 C;  2OPL A;  3J80 D;  3LGX A;  1V60 A;  3EER A;  1USP A;  1K0R A;  4MH4 A;  3ETC A;  2KZF A;  4R1M A;  3J81 D;  4OXI A;  1M6X A;  4R1L A;  3AF6 A;  5AE1 A;  2ATW A;  1XRB A;  1ML8 A;  5A19 A;  1O9T A;  3KXW A;  2UXB C;  4YHH C;  3H2T A;  1HNZ C;  1IBL C;  1MXB A;  4BBY A;  1MKY A;  5A1I A;  1VEH A;  1PG3 A;  3TUF A;  1BA3 A;  4LFC C;  2F4V C;  1MD9 A;  1FJG C;  1P4E C;  2V7B A;  1V26 A;  4NXN C;  4DV6 C;  5ADZ A;  2D1Q A;  4BSZ A;  5IFI A;  1IBM C;  1L2F A;  3L8C A;  1HR0 C;  4G36 A;  4B3R C; 
#chains in the Genus database with same CATH homology
 4WV3 A;  4WS9 A;  3IML A;  1JOS A;  1KKG A;  4JI8 C;  1P7L A;  1XRC A;  3A9V A;  2BJO A;  2WP0 C;  4L4Q A;  2JMP A;  3RV2 A;  4DV4 C;  5CZX A;  4DV2 C;  4LF5 C;  1WH9 A;  3L95 X;  4GXQ A;  5BSW A;  3I07 A;  5BSR A;  5JRH A;  4DG8 A;  5BSV A;  2HHH C;  4JV5 C;  3I08 A;  5T8S A;  3NYQ A;  4GS5 A;  4GKK C;  3GKU A;  5BSM A;  1PA4 A;  1MDF A;  2UUC C;  2OBV A;  3J7A D;  2YCB A;  1O92 A;  3IEV A;  1XNR C;  2AYA A;  1N36 C;  2OO4 A;  4DR6 C;  5IWA C;  1IBK C;  1J5E C;  5AE2 A;  3N2Q A;  2VQE C;  1EGA A;  4PZP A;  4DG9 A;  4ODJ A;  1LQL A;  5K8F A;  1PG4 A;  4JI0 C;  3LAX A;  5KYT A;  3DHV A;  2WD9 A;  3LUS A;  3VNS A;  5A2Q D;  4D4G A;  3NI2 A;  2ASB A;  4B3T C;  2D28 C;  2E0G A;  4AQY C;  2Y4N A;  5AE3 A;  4ZLP A;  2P02 A;  2QL8 A;  2D1S A;  4MTN A;  2D1R A;  3NPD A;  5KEI A;  2P2J A;  4I9F A;  4D56 A;  3JAM D;  2QVX X;  5K85 A;  2P2B A;  4TPS B;  2QW0 X;  4RLF A;  2BH1 X;  1N34 C;  5LMN C;  4DR5 C;  5A1G A;  5IT9 D;  1RY2 A;  4LF4 C;  3CW8 X;  4JM1 A;  1GPM A;  4FTF A;  1WF3 A;  4JI4 C;  5DV9 A;  4EAT A;  1NYE A;  4IR7 A;  2ONF A;  4LE5 A;  5BUQ A;  2D27 A;  3IEU A;  3N54 B;  1XMQ C;  5BSU A;  3NYR A;  3FCE A;  2QVZ X;  3UZ0 A;  3A9U A;  3AF5 A;  4G1I A;  5LMU C;  4JI5 C;  2Y4O A;  2P2F A;  4D4I A;  3CW9 A;  4PRO C;  1HNW C;  1MXC A;  4JI7 C;  3GR1 A;  4I9G A;  3VNQ A;  3PRO C;  4DV5 C;  3ETO A;  1HH2 P;  2P2M A;  4GKJ C;  3GPC A;  1XNQ C;  3R9W A;  3IPL A;  1O90 A;  1USP B;  2ZM6 C;  2Y27 A;  1FUG A;  2YWB A;  3E7W A;  4ZJZ A;  2P20 A;  4NOZ A;  3RG2 A;  1YJ7 A;  3GR0 A;  3VNR A;  3PBK A;  4DCS A;  2E8C A;  2P2Q A;  3SO4 A;  4DUY C;  4KTT A;  1N32 C;  4YY3 C;  1UKK A;  4DV3 C;  5E7Q A;  5CZV A;  1AMU A;  4LFA C;  4JI3 C;  3PES A;  4RLQ A;  4RVN A;  4BC9 A;  2PN2 A;  1N33 C;  4R0M A;  2UUB C;  1LCI A;  1XMO C;  4DV7 C;  2UUA C;  5BUR A;  2PRO A;  4DCV A;  4NDN A;  5FLX D;  3T1Y C;  4D57 A;  4K0K C;  3C5E A;  4LF7 C;  5BST A;  4OX9 C;  4LF9 C;  3TQI A;  4G37 A;  3G7S A;  4IZ6 A;  1MXA A;  1O93 A;  2E8E A;  2CXC A;  4LFB C;  4X66 C;  3R44 A;  1QWI A;  2CY1 A;  4RM2 A;  3CJE A;  3EQ6 A;  4FUT A;  4DR3 C;  3R9X A;  4RVO A;  3OTO C;  1T5D X;  4DV0 C;  4LF8 C;  2XR1 A;  4KTV A;  4JI1 C;  5H9U A;  3E7X A;  1HNX C;  4HPV A;  4L2Z A;  4B3M C;  2PT7 G;  2EGT A;  1ZB9 A;  5T8T A;  4RMN A;  4RM3 A;  1QM4 A;  1XRA A;  2DYJ A;  4DCU A;  4JYA C;  2VZE A;  3DLP X;  4DV1 C;  4JI6 C;  2UXC C;  2E8F A;  2VSQ A;  3DAY A;  5GTD A;  2E5L C;  2E7G A;  4DR1 C;  1V25 A;  4XX2 A;  2OPL B;  2D7V A;  2HJG A;  3A4I A;  5KYV A;  1RG9 A;  4PHT A;  4DR2 C;  4X62 C;  1T5H X;  2D1T A;  3FCC A;  1N2F A;  4DCT A;  2DPL A;  4LF6 C;  3T1H C;  4ISB A;  5BR8 C;  2VQF C;  4KHP C;  2QVY X;  3UOW A;  4GXR A;  4U5Y D;  4K0B A;  1ZB8 A;  4L7I A;  3LNV A;  3TDE A;  4DR7 C;  3S82 A;  4BCA A;  2UXD C;  1MDB A;  2UU9 C;  3B7W A;  2YWC A;  4JI2 C;  4X65 C;  4X64 C;  4DUZ C;  4OYC A;  1VLA A;  5BUS A;  4FUQ A;  4BC7 A;  4DR4 C;  1ULT A;  4NXM C;  4B3S C;  1I94 C;  2OPL A;  3J80 D;  3LGX A;  3EER A;  1USP A;  1K0R A;  4MH4 A;  3ETC A;  2KZF A;  4R1M A;  3J81 D;  4OXI A;  4R1L A;  3AF6 A;  5AE1 A;  2ATW A;  1XRB A;  1ML8 A;  5A19 A;  1O9T A;  3KXW A;  2UXB C;  4YHH C;  3H2T A;  1HNZ C;  1IBL C;  1MXB A;  4BBY A;  1MKY A;  5A1I A;  1PG3 A;  3TUF A;  1BA3 A;  4LFC C;  2F4V C;  1MD9 A;  1FJG C;  2V7B A;  1V26 A;  4NXN C;  4DV6 C;  5ADZ A;  2D1Q A;  4BSZ A;  5IFI A;  1IBM C;  1L2F A;  3L8C A;  1HR0 C;  4G36 A;  4B3R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...