3T1YC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3t1yC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3t1yC02
4MH4A 4NXNC 1N2FA 5LMUC 4BSZA 5IWAC 1KKGA 4LF5C 4LF7C 4JI4C 4DV4C 3CJEA 3AF6A 4DR7C 4DUYC 3OTOC 2D7VA 4LF9C 2UUBC 4DR5C 4YHHC 1HNZC 4DUZC 4DV5C 4LF6C 2VQFC 4DR6C 2CXCA 4DCTA 4DV3C 1IBMC 2YCBA 1K0RA 2OPLA 2HHHC 3R9XA 1XNQC 4X66C 4DCVA 2BJOA 1NYEA 3J81D 3LUSA 1EGAA 2KZFA 4JI6C 2UUAC 2PN2A 2E5LC 3T1HC 4LF8C 1N34C 1XMQC 4DCUA 1QWIA 4OX9C 4NXMC 1HH2P 4MTNA 1ZB9A 2E8CA 2QL8A 3EERA 2E7GA 4DCSA 1USPB 4DV7C 4DR1C 4AQYC 1I94C 4JI1C 2DYJA 3R9WA 5IT9D 4LFBC 1WH9A 2CY1A 2JMPA 4JI2C 4X62C 4LF4C 1J5EC 4GKKC 1XMOC 1IBLC 1ZB8A 5BR8C 5FLXD 2UXCC 2XR1A 4DR4C 4LFCC 1WF3A 3J80D 4DV1C 1PA4A 3AF5A 4B3TC 4JI3C 4B3MC 2PT7G 2HJGA 4JI5C 1VLAA 2EGTA 4YY3C 2ASBA 1N32C 4DR2C 4K0KC 1IBKC 1USPA 2UXDC 4JI8C 2E8EA 5LMNC 2UXBC 3GKUA 4GKJC 3J7AD 2F4VC 4NOZA 1XNRC 4DV2C 2ZM6C 2VQEC 4JV5C 3I07A 4JI7C 4XX2A 1N33C 1HNXC 1N36C 2UU9C 4X64C 2UUCC 3IEUA 4KHPC 4JYAC 1FJGC 3JAMD 4X65C 1JOSA 1LQLA 4JI0C 2ATWA 1MKYA 4DV6C 5A2QD 1HR0C 3IEVA 4DR3C 1HNWC 4LFAC 1L2FA 4B3RC 1UKKA 4DV0C 2ONFA 1ML8A 4B3SC 2E8FA 2OPLB 3T1YC
chains in the Genus database with same CATH superfamily
4NXNC 3UX2A 3H2TA 3PESA 2D1RA 4RVOA 4DUZC 4DV5C 2QVZX 2WD9A 4DR6C 2OO4A 2YCBA 4JM1A 3FCEA 3UEBA 5BURA 1XNQC 3LGXA 1FUGA 2MM9A 4WV3A 4DCVA 1IB8A 5T8SA 2M5HA 2QW0X 2UUAC 2PN2A 3TDEA 4NDNA 1MDFA 4NXMC 4PUHA 1ZB9A 4DCSA 4FTFA 4AQYC 4PZPA 1I94C 4LFBC 1VEHA 2CY1A 2D1SA 1V60A 3DHVA 5AE3A 5KYTA 4ODJA 2NCLA 5FLXD 2MMAB 1PA4A 4L4QA 2PG1E 4JI3C 2HJGA 5ADZA 1VLAA 3S82A 2P02A 3A26A 1IBKC 4K0KC 2UXDC 5LMNC 1M6XC 1WCJA 5A1GA 2D27A 1PG4A 3RG2A 3K6RA 4GXQA 4DV2C 4KTVA 4XX2A 3GR0A 3DLPX 1HNXC 2P2QA 2UU9C 1TH5A 2AYAA 4G1IA 2UUCC 4RM2A 3IEUA 4KHPC 2Z51A 4JYAC 2KZ0A 3A9UA 1XRCA 5CZVA 3A4IA 4X65C 4RLQA 5CZXA 3AY0A 1YJ7A 5A2QD 1HR0C 1HNWC 2PROA 1UKKA 4DV0C 3VNRA 1RY2A 2V7BA 4MH4A 1N2FA 4I9FA 5LMUC 4BSZA 1KKGA 3N54B 4JI4C 3LNVA 4DR5C 4YHHC 3E7WA 1M6XA 2VQFC 1ULTA 4G37A 1MXAA 2CXCA 1XDXA 2ZZMA 1IBMC 4U5YD 2D28C 2BJOA 1NYEA 3J81D 3EQ6A 4BCAA 2E5LC 4LF8C 3FM7A 1XMQC 1PU1A 2E7GA 4DR1C 4HPVA 2P2BA 3NPDA 3R9WA 4JI1C 2DYJA 4PROC 5JRHA 1XHJA 3VNQA 1IBLC 2P2JA 2XR1A 5DV9A 1WF3A 4DV1C 3NYQA 1O92A 3UZ0A 2CU6A 1P4EC 5BSVA 4JI5C 2ASBA 3A9VA 3VNSA 1P7LA 1UWDA 4PUGA 4JI8C 2P2FA 2YWCA 5T8TA 2P20A 3J7AD 1YGTA 2VQEC 1N33C 3TQIA 4I9GA 3NYRA 3IPLA 2BH1X 3SO4A 5KEIA 3R44A 4D57A 4X64C 1PG3A 4B3SC 3ETCA 4GXRA 4OYCA 2KDNA 5A19A 1FJGC 4GS5A 2MCQA 5BSRA 4DG8A 3JAMD 1JOSA 1LQLA 4DG9A 4IZ6A 1O9TA 3IEVA 1L2FA 2ZTBA 3TR3A 2WP0C 2E8FA 3T1YC 3GR1A 5IWAC 4LF5C 4EATA 3I08A 4LF7C 1XRBA 4DV4C 1P4EA 3CJEA 3PBKA 4DR7C 4RLFA 3N2QA 4LF9C 3E7XA 4D4IA 2UUBC 1NY8A 2Y4NA 4L7IA 4LE5A 1MD9A 1K0RA 2OPLA 3R9XA 2E0GA 4X66C 4BBYA 4ZJZA 1FLOA 3LUSA 5A1IA 1EGAA 4JI6C 1O93A 3TUFA 4RMNA 1N34C 1QWIA 4OX9C 1HH2P 4MTNA 2QL8A 5IT9D 1QM4A 4FUQA 1WH9A 2JMPA 4JI2C 4WS9A 4X62C 4LF4C 1J5EC 4GKKC 3A25A 5BR8C 2QVXX 3L8CA 1XRAA 1LCIA 3NI2A 3AF5A 4BC7A 4B3TC 3KXWA 4YY3C 3C5EA 4DR2C 1USPA 3DAYA 2D1TA 2UXBC 3GKUA 4RM3A 4IR7A 2F4VC 1T5HX 5E7QA 4JI7C 1MXCA 3GPCA 5BSWA 1N36C 3RV2A 4KTTA 5IFIA 2YWBA 5BUSA 2YX1A 4JI0C 2ATWA 3UX3A 1MKYA 5H9UA 4DV6C 2ZZNA 4ISBA 4BC9A 3CQ1A 3B7WA 2P2MA 1AMUA 5LCIA 4B3RC 4OXIA 3G7SA 1ML8A 2OPLB 3FCCA 3AF6A 4R1MA 2Y27A 4DUYC 3OTOC 2D7VA 3CQ3A 1MXBA 3LAXA 1GPMA 5AE1A 1HNZC 3L95X 1T5DX 5BSTA 2DPLA 4LF6C 2JNVA 4DCTA 4DV3C 4PUIA 2HHHC 5AE2A 2OBVA 3O2EA 1BA3A 4D4GA 2QVYX 2KZFA 1MDBA 3CQ2A 2DHMA 1RG9A 3T1HC 2M5OA 4DCUA 2E8CA 4DV7C 3EERA 1USPB 1O90A 4D56A 1XS3A 1V26A 1XMOC 1ZB8A 2UXCC 4K0BA 3CW8X 4DR4C 5BSUA 3J80D 4LFCC 4TPSB 2D1QA 4B3MC 2PT7G 2EGTA 1N32C 4L2ZA 2E8EA 4R1LA 3IMLA 5K85A 4GKJC 3ETOA 5BUQA 4NOZA 1XNRC 1V25A 2ZM6C 4JV5C 3I07A 4G36A 3CW9A 4FUTA 3LNOA 4ZLPA 4R0MA 5K8FA 3UOWA 5KYVA 5BSMA 4DR3C 2VZEA 4LFAC 4PHTA 2ONFA 2Y4OA 2VSQA 5GTDA 4RVNA 3PROC
chains in the Genus database with same CATH topology
4NXNC 3H2TA 3PESA 2D1RA 4RVOA 4DUZC 4DV5C 2QVZX 2WD9A 4DR6C 2OO4A 2YCBA 4JM1A 3FCEA 5BURA 1XNQC 3LGXA 1FUGA 4WV3A 4DCVA 5T8SA 2QW0X 2UUAC 2PN2A 3TDEA 4NDNA 1MDFA 4NXMC 1ZB9A 4DCSA 4FTFA 4AQYC 4PZPA 1I94C 4LFBC 2CY1A 2D1SA 3DHVA 5AE3A 5KYTA 4ODJA 5FLXD 1PA4A 4L4QA 4JI3C 2HJGA 5ADZA 1VLAA 3S82A 2P02A 4K0KC 1IBKC 2UXDC 5LMNC 5A1GA 2D27A 1PG4A 3RG2A 4DV2C 4GXQA 4KTVA 4XX2A 3GR0A 3DLPX 1HNXC 2P2QA 2UU9C 2AYAA 4G1IA 2UUCC 4RM2A 3IEUA 4KHPC 4JYAC 3A9UA 1XRCA 5CZVA 3A4IA 4X65C 4RLQA 5CZXA 1YJ7A 5A2QD 1HR0C 1HNWC 2PROA 1UKKA 4DV0C 3VNRA 1RY2A 2V7BA 4MH4A 1N2FA 4I9FA 5LMUC 4BSZA 1KKGA 3N54B 4JI4C 3LNVA 4DR5C 4YHHC 3E7WA 2VQFC 1ULTA 4G37A 1MXAA 2CXCA 1IBMC 4U5YD 2D28C 2BJOA 1NYEA 3J81D 3EQ6A 4BCAA 2E5LC 4LF8C 1XMQC 2E7GA 4DR1C 4HPVA 2P2BA 3NPDA 3R9WA 4JI1C 2DYJA 4PROC 5JRHA 3VNQA 1IBLC 2P2JA 2XR1A 5DV9A 1WF3A 4DV1C 3NYQA 1O92A 3UZ0A 5BSVA 4JI5C 2ASBA 3A9VA 3VNSA 1P7LA 4JI8C 2P2FA 2YWCA 5T8TA 2P20A 3J7AD 2VQEC 1N33C 3TQIA 4I9GA 3NYRA 3IPLA 2BH1X 3SO4A 5KEIA 3R44A 4D57A 4X64C 1PG3A 4B3SC 3ETCA 4GXRA 4OYCA 5A19A 1FJGC 4GS5A 5BSRA 3JAMD 4DG8A 1JOSA 1LQLA 4DG9A 4IZ6A 1O9TA 3IEVA 1L2FA 2WP0C 2E8FA 3T1YC 3GR1A 5IWAC 4LF5C 4EATA 3I08A 4LF7C 1XRBA 4DV4C 3CJEA 3PBKA 4DR7C 4RLFA 3N2QA 4LF9C 3E7XA 4D4IA 2UUBC 2Y4NA 4L7IA 4LE5A 1MD9A 1K0RA 2OPLA 3R9XA 2E0GA 4X66C 4BBYA 4ZJZA 3LUSA 5A1IA 1EGAA 4JI6C 1O93A 3TUFA 4RMNA 1N34C 1QWIA 4OX9C 1HH2P 4MTNA 2QL8A 5IT9D 1QM4A 4FUQA 1WH9A 2JMPA 4JI2C 4WS9A 4X62C 4LF4C 1J5EC 4GKKC 5BR8C 2QVXX 3L8CA 1XRAA 1LCIA 3NI2A 3AF5A 4BC7A 4B3TC 3KXWA 4YY3C 3C5EA 4DR2C 1USPA 3DAYA 2D1TA 2UXBC 3GKUA 4RM3A 4IR7A 2F4VC 1T5HX 5E7QA 4JI7C 1MXCA 3GPCA 5BSWA 1N36C 3RV2A 4KTTA 5IFIA 2YWBA 5BUSA 4JI0C 2ATWA 1MKYA 5H9UA 4DV6C 4ISBA 4BC9A 3B7WA 2P2MA 1AMUA 4B3RC 4OXIA 3G7SA 1ML8A 2OPLB 3FCCA 3AF6A 4R1MA 2Y27A 4DUYC 3OTOC 2D7VA 1MXBA 3LAXA 1GPMA 5AE1A 1HNZC 3L95X 1T5DX 5BSTA 2DPLA 4LF6C 4DCTA 4DV3C 2HHHC 5AE2A 2OBVA 1BA3A 4D4GA 2QVYX 2KZFA 1MDBA 1RG9A 3T1HC 4DCUA 2E8CA 4DV7C 3EERA 1USPB 1O90A 4D56A 1V26A 1XMOC 1ZB8A 2UXCC 4K0BA 3CW8X 4DR4C 5BSUA 3J80D 4LFCC 4TPSB 2D1QA 4B3MC 2PT7G 2EGTA 1N32C 4L2ZA 2E8EA 4R1LA 3IMLA 5K85A 4GKJC 3ETOA 5BUQA 4NOZA 1XNRC 1V25A 2ZM6C 4JV5C 3I07A 4G36A 3CW9A 4FUTA 4ZLPA 4R0MA 5K8FA 3UOWA 5KYVA 5BSMA 4DR3C 2VZEA 4LFAC 4PHTA 2ONFA 2Y4OA 2VSQA 4RVNA 5GTDA 3PROC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MH4 A;  4NXN C;  1N2F A;  5LMU C;  4BSZ A;  5IWA C;  1KKG A;  4LF5 C;  4LF7 C;  4JI4 C;  4DV4 C;  3CJE A;  3AF6 A;  4DR7 C;  4DUY C;  3OTO C;  2D7V A;  4LF9 C;  2UUB C;  4DR5 C;  4YHH C;  1HNZ C;  4DUZ C;  4DV5 C;  4LF6 C;  2VQF C;  4DR6 C;  2CXC A;  4DCT A;  4DV3 C;  1IBM C;  2YCB A;  1K0R A;  2OPL A;  2HHH C;  3R9X A;  1XNQ C;  4X66 C;  4DCV A;  2BJO A;  1NYE A;  3J81 D;  3LUS A;  1EGA A;  2KZF A;  4JI6 C;  2UUA C;  2PN2 A;  2E5L C;  3T1H C;  4LF8 C;  1N34 C;  1XMQ C;  4DCU A;  1QWI A;  4OX9 C;  4NXM C;  1HH2 P;  4MTN A;  1ZB9 A;  2E8C A;  2QL8 A;  3EER A;  2E7G A;  4DCS A;  1USP B;  4DV7 C;  4DR1 C;  4AQY C;  1I94 C;  4JI1 C;  2DYJ A;  3R9W A;  5IT9 D;  4LFB C;  1WH9 A;  2CY1 A;  2JMP A;  4JI2 C;  4X62 C;  4LF4 C;  1J5E C;  4GKK C;  1XMO C;  1IBL C;  1ZB8 A;  5BR8 C;  5FLX D;  2UXC C;  2XR1 A;  4DR4 C;  4LFC C;  1WF3 A;  3J80 D;  4DV1 C;  1PA4 A;  3AF5 A;  4B3T C;  4JI3 C;  4B3M C;  2PT7 G;  2HJG A;  4JI5 C;  1VLA A;  2EGT A;  4YY3 C;  2ASB A;  1N32 C;  4DR2 C;  4K0K C;  1IBK C;  1USP A;  2UXD C;  4JI8 C;  2E8E A;  5LMN C;  2UXB C;  3GKU A;  4GKJ C;  3J7A D;  2F4V C;  4NOZ A;  1XNR C;  4DV2 C;  2ZM6 C;  2VQE C;  4JV5 C;  3I07 A;  4JI7 C;  4XX2 A;  1N33 C;  1HNX C;  1N36 C;  2UU9 C;  4X64 C;  2UUC C;  3IEU A;  4KHP C;  4JYA C;  1FJG C;  3JAM D;  4X65 C;  1JOS A;  1LQL A;  4JI0 C;  2ATW A;  1MKY A;  4DV6 C;  5A2Q D;  1HR0 C;  3IEV A;  4DR3 C;  1HNW C;  4LFA C;  1L2F A;  4B3R C;  1UKK A;  4DV0 C;  2ONF A;  1ML8 A;  4B3S C;  2E8F A;  2OPL B;  3T1Y C; 
#chains in the Genus database with same CATH topology
 4NXN C;  3UX2 A;  3H2T A;  3PES A;  2D1R A;  4RVO A;  4DUZ C;  4DV5 C;  2QVZ X;  2WD9 A;  4DR6 C;  2OO4 A;  2YCB A;  4JM1 A;  3FCE A;  3UEB A;  5BUR A;  1XNQ C;  3LGX A;  1FUG A;  2MM9 A;  4WV3 A;  4DCV A;  1IB8 A;  5T8S A;  2M5H A;  2QW0 X;  2UUA C;  2PN2 A;  3TDE A;  4NDN A;  1MDF A;  4NXM C;  4PUH A;  1ZB9 A;  4DCS A;  4FTF A;  4AQY C;  4PZP A;  1I94 C;  4LFB C;  1VEH A;  2CY1 A;  2D1S A;  1V60 A;  3DHV A;  5AE3 A;  5KYT A;  4ODJ A;  2NCL A;  5FLX D;  2MMA B;  1PA4 A;  4L4Q A;  2PG1 E;  4JI3 C;  2HJG A;  5ADZ A;  1VLA A;  3S82 A;  2P02 A;  3A26 A;  1IBK C;  4K0K C;  2UXD C;  5LMN C;  1M6X C;  1WCJ A;  5A1G A;  2D27 A;  1PG4 A;  3RG2 A;  3K6R A;  4GXQ A;  4DV2 C;  4KTV A;  4XX2 A;  3GR0 A;  3DLP X;  1HNX C;  2P2Q A;  2UU9 C;  1TH5 A;  2AYA A;  4G1I A;  2UUC C;  4RM2 A;  3IEU A;  4KHP C;  2Z51 A;  4JYA C;  2KZ0 A;  3A9U A;  1XRC A;  5CZV A;  3A4I A;  4X65 C;  4RLQ A;  5CZX A;  3AY0 A;  1YJ7 A;  5A2Q D;  1HR0 C;  1HNW C;  2PRO A;  1UKK A;  4DV0 C;  3VNR A;  1RY2 A;  2V7B A;  4MH4 A;  1N2F A;  4I9F A;  5LMU C;  4BSZ A;  1KKG A;  3N54 B;  4JI4 C;  3LNV A;  4DR5 C;  4YHH C;  3E7W A;  1M6X A;  2VQF C;  1ULT A;  4G37 A;  1MXA A;  2CXC A;  1XDX A;  2ZZM A;  1IBM C;  4U5Y D;  2D28 C;  2BJO A;  1NYE A;  3J81 D;  3EQ6 A;  4BCA A;  2E5L C;  4LF8 C;  3FM7 A;  1XMQ C;  1PU1 A;  2E7G A;  4DR1 C;  4HPV A;  2P2B A;  3NPD A;  3R9W A;  4JI1 C;  2DYJ A;  4PRO C;  5JRH A;  1XHJ A;  3VNQ A;  1IBL C;  2P2J A;  2XR1 A;  5DV9 A;  1WF3 A;  4DV1 C;  3NYQ A;  1O92 A;  3UZ0 A;  2CU6 A;  1P4E C;  5BSV A;  4JI5 C;  2ASB A;  3A9V A;  3VNS A;  1P7L A;  1UWD A;  4PUG A;  4JI8 C;  2P2F A;  2YWC A;  5T8T A;  2P20 A;  3J7A D;  1YGT A;  2VQE C;  1N33 C;  3TQI A;  4I9G A;  3NYR A;  3IPL A;  2BH1 X;  3SO4 A;  5KEI A;  3R44 A;  4D57 A;  4X64 C;  1PG3 A;  4B3S C;  3ETC A;  4GXR A;  4OYC A;  2KDN A;  5A19 A;  1FJG C;  4GS5 A;  2MCQ A;  5BSR A;  4DG8 A;  3JAM D;  1JOS A;  1LQL A;  4DG9 A;  4IZ6 A;  1O9T A;  3IEV A;  1L2F A;  2ZTB A;  3TR3 A;  2WP0 C;  2E8F A;  3T1Y C;  3GR1 A;  5IWA C;  4LF5 C;  4EAT A;  3I08 A;  4LF7 C;  1XRB A;  4DV4 C;  1P4E A;  3CJE A;  3PBK A;  4DR7 C;  4RLF A;  3N2Q A;  4LF9 C;  3E7X A;  4D4I A;  2UUB C;  1NY8 A;  2Y4N A;  4L7I A;  4LE5 A;  1MD9 A;  1K0R A;  2OPL A;  3R9X A;  2E0G A;  4X66 C;  4BBY A;  4ZJZ A;  1FLO A;  3LUS A;  5A1I A;  1EGA A;  4JI6 C;  1O93 A;  3TUF A;  4RMN A;  1N34 C;  1QWI A;  4OX9 C;  1HH2 P;  4MTN A;  2QL8 A;  5IT9 D;  1QM4 A;  4FUQ A;  1WH9 A;  2JMP A;  4JI2 C;  4WS9 A;  4X62 C;  4LF4 C;  1J5E C;  4GKK C;  3A25 A;  5BR8 C;  2QVX X;  3L8C A;  1XRA A;  1LCI A;  3NI2 A;  3AF5 A;  4BC7 A;  4B3T C;  3KXW A;  4YY3 C;  3C5E A;  4DR2 C;  1USP A;  3DAY A;  2D1T A;  2UXB C;  3GKU A;  4RM3 A;  4IR7 A;  2F4V C;  1T5H X;  5E7Q A;  4JI7 C;  1MXC A;  3GPC A;  5BSW A;  1N36 C;  3RV2 A;  4KTT A;  5IFI A;  2YWB A;  5BUS A;  2YX1 A;  4JI0 C;  2ATW A;  3UX3 A;  1MKY A;  5H9U A;  4DV6 C;  2ZZN A;  4ISB A;  4BC9 A;  3CQ1 A;  3B7W A;  2P2M A;  1AMU A;  5LCI A;  4B3R C;  4OXI A;  3G7S A;  1ML8 A;  2OPL B;  3FCC A;  3AF6 A;  4R1M A;  2Y27 A;  4DUY C;  3OTO C;  2D7V A;  3CQ3 A;  1MXB A;  3LAX A;  1GPM A;  5AE1 A;  1HNZ C;  3L95 X;  1T5D X;  5BST A;  2DPL A;  4LF6 C;  2JNV A;  4DCT A;  4DV3 C;  4PUI A;  2HHH C;  5AE2 A;  2OBV A;  3O2E A;  1BA3 A;  4D4G A;  2QVY X;  2KZF A;  1MDB A;  3CQ2 A;  2DHM A;  1RG9 A;  3T1H C;  2M5O A;  4DCU A;  2E8C A;  4DV7 C;  3EER A;  1USP B;  1O90 A;  4D56 A;  1XS3 A;  1V26 A;  1XMO C;  1ZB8 A;  2UXC C;  4K0B A;  3CW8 X;  4DR4 C;  5BSU A;  3J80 D;  4LFC C;  4TPS B;  2D1Q A;  4B3M C;  2PT7 G;  2EGT A;  1N32 C;  4L2Z A;  2E8E A;  4R1L A;  3IML A;  5K85 A;  4GKJ C;  3ETO A;  5BUQ A;  4NOZ A;  1XNR C;  1V25 A;  2ZM6 C;  4JV5 C;  3I07 A;  4G36 A;  3CW9 A;  4FUT A;  3LNO A;  4ZLP A;  4R0M A;  5K8F A;  3UOW A;  5KYV A;  5BSM A;  4DR3 C;  2VZE A;  4LFA C;  4PHT A;  2ONF A;  2Y4O A;  2VSQ A;  5GTD A;  4RVN A;  3PRO C; 
#chains in the Genus database with same CATH homology
 4NXN C;  3H2T A;  3PES A;  2D1R A;  4RVO A;  4DUZ C;  4DV5 C;  2QVZ X;  2WD9 A;  4DR6 C;  2OO4 A;  2YCB A;  4JM1 A;  3FCE A;  5BUR A;  1XNQ C;  3LGX A;  1FUG A;  4WV3 A;  4DCV A;  5T8S A;  2QW0 X;  2UUA C;  2PN2 A;  3TDE A;  4NDN A;  1MDF A;  4NXM C;  1ZB9 A;  4DCS A;  4FTF A;  4AQY C;  4PZP A;  1I94 C;  4LFB C;  2CY1 A;  2D1S A;  3DHV A;  5AE3 A;  5KYT A;  4ODJ A;  5FLX D;  1PA4 A;  4L4Q A;  4JI3 C;  2HJG A;  5ADZ A;  1VLA A;  3S82 A;  2P02 A;  4K0K C;  1IBK C;  2UXD C;  5LMN C;  5A1G A;  2D27 A;  1PG4 A;  3RG2 A;  4DV2 C;  4GXQ A;  4KTV A;  4XX2 A;  3GR0 A;  3DLP X;  1HNX C;  2P2Q A;  2UU9 C;  2AYA A;  4G1I A;  2UUC C;  4RM2 A;  3IEU A;  4KHP C;  4JYA C;  3A9U A;  1XRC A;  5CZV A;  3A4I A;  4X65 C;  4RLQ A;  5CZX A;  1YJ7 A;  5A2Q D;  1HR0 C;  1HNW C;  2PRO A;  1UKK A;  4DV0 C;  3VNR A;  1RY2 A;  2V7B A;  4MH4 A;  1N2F A;  4I9F A;  5LMU C;  4BSZ A;  1KKG A;  3N54 B;  4JI4 C;  3LNV A;  4DR5 C;  4YHH C;  3E7W A;  2VQF C;  1ULT A;  4G37 A;  1MXA A;  2CXC A;  1IBM C;  4U5Y D;  2D28 C;  2BJO A;  1NYE A;  3J81 D;  3EQ6 A;  4BCA A;  2E5L C;  4LF8 C;  1XMQ C;  2E7G A;  4DR1 C;  4HPV A;  2P2B A;  3NPD A;  3R9W A;  4JI1 C;  2DYJ A;  4PRO C;  5JRH A;  3VNQ A;  1IBL C;  2P2J A;  2XR1 A;  5DV9 A;  1WF3 A;  4DV1 C;  3NYQ A;  1O92 A;  3UZ0 A;  5BSV A;  4JI5 C;  2ASB A;  3A9V A;  3VNS A;  1P7L A;  4JI8 C;  2P2F A;  2YWC A;  5T8T A;  2P20 A;  3J7A D;  2VQE C;  1N33 C;  3TQI A;  4I9G A;  3NYR A;  3IPL A;  2BH1 X;  3SO4 A;  5KEI A;  3R44 A;  4D57 A;  4X64 C;  1PG3 A;  4B3S C;  3ETC A;  4GXR A;  4OYC A;  5A19 A;  1FJG C;  4GS5 A;  5BSR A;  3JAM D;  4DG8 A;  1JOS A;  1LQL A;  4DG9 A;  4IZ6 A;  1O9T A;  3IEV A;  1L2F A;  2WP0 C;  2E8F A;  3T1Y C;  3GR1 A;  5IWA C;  4LF5 C;  4EAT A;  3I08 A;  4LF7 C;  1XRB A;  4DV4 C;  3CJE A;  3PBK A;  4DR7 C;  4RLF A;  3N2Q A;  4LF9 C;  3E7X A;  4D4I A;  2UUB C;  2Y4N A;  4L7I A;  4LE5 A;  1MD9 A;  1K0R A;  2OPL A;  3R9X A;  2E0G A;  4X66 C;  4BBY A;  4ZJZ A;  3LUS A;  5A1I A;  1EGA A;  4JI6 C;  1O93 A;  3TUF A;  4RMN A;  1N34 C;  1QWI A;  4OX9 C;  1HH2 P;  4MTN A;  2QL8 A;  5IT9 D;  1QM4 A;  4FUQ A;  1WH9 A;  2JMP A;  4JI2 C;  4WS9 A;  4X62 C;  4LF4 C;  1J5E C;  4GKK C;  5BR8 C;  2QVX X;  3L8C A;  1XRA A;  1LCI A;  3NI2 A;  3AF5 A;  4BC7 A;  4B3T C;  3KXW A;  4YY3 C;  3C5E A;  4DR2 C;  1USP A;  3DAY A;  2D1T A;  2UXB C;  3GKU A;  4RM3 A;  4IR7 A;  2F4V C;  1T5H X;  5E7Q A;  4JI7 C;  1MXC A;  3GPC A;  5BSW A;  1N36 C;  3RV2 A;  4KTT A;  5IFI A;  2YWB A;  5BUS A;  4JI0 C;  2ATW A;  1MKY A;  5H9U A;  4DV6 C;  4ISB A;  4BC9 A;  3B7W A;  2P2M A;  1AMU A;  4B3R C;  4OXI A;  3G7S A;  1ML8 A;  2OPL B;  3FCC A;  3AF6 A;  4R1M A;  2Y27 A;  4DUY C;  3OTO C;  2D7V A;  1MXB A;  3LAX A;  1GPM A;  5AE1 A;  1HNZ C;  3L95 X;  1T5D X;  5BST A;  2DPL A;  4LF6 C;  4DCT A;  4DV3 C;  2HHH C;  5AE2 A;  2OBV A;  1BA3 A;  4D4G A;  2QVY X;  2KZF A;  1MDB A;  1RG9 A;  3T1H C;  4DCU A;  2E8C A;  4DV7 C;  3EER A;  1USP B;  1O90 A;  4D56 A;  1V26 A;  1XMO C;  1ZB8 A;  2UXC C;  4K0B A;  3CW8 X;  4DR4 C;  5BSU A;  3J80 D;  4LFC C;  4TPS B;  2D1Q A;  4B3M C;  2PT7 G;  2EGT A;  1N32 C;  4L2Z A;  2E8E A;  4R1L A;  3IML A;  5K85 A;  4GKJ C;  3ETO A;  5BUQ A;  4NOZ A;  1XNR C;  1V25 A;  2ZM6 C;  4JV5 C;  3I07 A;  4G36 A;  3CW9 A;  4FUT A;  4ZLP A;  4R0M A;  5K8F A;  3UOW A;  5KYV A;  5BSM A;  4DR3 C;  2VZE A;  4LFA C;  4PHT A;  2ONF A;  2Y4O A;  2VSQ A;  4RVN A;  5GTD A;  3PRO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...