1XNQC

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xnqC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1xnqC02
2UUCC 4DV5C 1IBMC 1MKYA 4JYAC 4LFAC 4DCUA 1KKGA 3R9WA 4LF4C 1XNQC 2HJGA 1IBLC 2CXCA 1XMQC 4NXMC 3CJEA 5LMNC 2VQEC 5LMUC 2UUAC 1ZB9A 4DR3C 4K0KC 3AF5A 1FJGC 4B3SC 1VLAA 4LFBC 4JI3C 1USPA 3GKUA 4LF8C 1XMOC 4DV3C 1N36C 1JOSA 2ASBA 4DR1C 4DR2C 2UXBC 5IWAC 4YY3C 1K0RA 4DV6C 4GKKC 4JV5C 4B3RC 2CY1A 2D7VA 1N2FA 2KZFA 2ATWA 4JI8C 2UU9C 2XR1A 2E8FA 3J80D 2ONFA 1UKKA 1EGAA 2OPLA 1NYEA 4MTNA 4LFCC 4JI0C 1PA4A 4JI6C 2UUBC 4NXNC 4JI1C 4LF7C 2ZM6C 4JI2C 4DR7C 1HNXC 4B3TC 4JI5C 2F4VC 3IEUA 1I94C 1ZB8A 2PT7G 2QL8A 2EGTA 3I07A 4KHPC 1USPB 2OPLB 1WF3A 4OX9C 4DCTA 4MH4A 1N34C 3J7AD 1HH2P 4DCSA 2JMPA 1XNRC 4B3MC 5A2QD 3JAMD 1N32C 5FLXD 4X64C 1WH9A 4LF5C 1ML8A 2E8EA 2E8CA 3LUSA 3T1HC 4DV2C 1HNZC 4NOZA 3OTOC 1HR0C 3IEVA 3J81D 4DUYC 4JI4C 1QWIA 2HHHC 3T1YC 2E5LC 2E7GA 4AQYC 5IT9D 4DR4C 3R9XA 4DR6C 4X66C 3EERA 5BR8C 1LQLA 4DV0C 2DYJA 4DCVA 2UXCC 1L2FA 4YHHC 2UXDC 4DV1C 2YCBA 4LF6C 1N33C 1IBKC 4BSZA 1J5EC 4X65C 4XX2A 4DV7C 2VQFC 4X62C 4DUZC 4DV4C 1HNWC 4GKJC 2PN2A 4LF9C 3AF6A 4JI7C 4DR5C 2BJOA
chains in the Genus database with same CATH superfamily
2P20A 5T8TA 2ZTBA 5KYTA 3R9WA 3CW9A 4BC9A 2HJGA 2P2JA 4K0KC 4ODJA 3AF5A 4IR7A 1M6XA 4L2ZA 4LE5A 3VNRA 5IFIA 1T5DX 5K8FA 2AYAA 1M6XC 1XDXA 2D7VA 1N2FA 5KYVA 2KZ0A 4RM3A 3A25A 2ZZMA 2E8FA 2YX1A 1UKKA 1NYEA 3VNQA 5JRHA 4JI0C 4JI6C 2QVXX 2ZM6C 3TQIA 3N2QA 1MXCA 3I08A 2F4VC 2Z51A 5AE1A 5K85A 1MDFA 5A1GA 1USPB 2OPLB 4GXRA 2KDNA 4DCTA 5A19A 1P4EA 4MH4A 1HH2P 2VZEA 1XNRC 4RLFA 3UX2A 3CW8X 2OO4A 2MCQA 3KXWA 5ADZA 4G36A 1ML8A 4RM2A 2E8CA 4RVNA 1O92A 3T1HC 3UOWA 2CU6A 4DV2C 1P4EC 4NOZA 3OTOC 2P02A 3GR0A 4R1MA 2HHHC 5LCIA 4AQYC 5IT9D 5BR8C 2D27A 2E0GA 1L2FA 2YCBA 3R44A 1N33C 4L7IA 1J5EC 2P2QA 4RMNA 4DR5C 2BJOA 2UUCC 1MKYA 4DG8A 1AMUA 1XNQC 3FCEA 5AE2A 2D1QA 2CXCA 3CQ2A 4PZPA 4NDNA 2UUAC 2V7BA 1TH5A 1ZB9A 1MDBA 4BCAA 4IZ6A 4LFBC 1USPA 3DAYA 3E7XA 2Y4NA 5BSWA 1IB8A 4D57A 3G7SA 4DR1C 3A9UA 4DR2C 3L95X 1XS3A 5BURA 5IWAC 1K0RA 4DV6C 4GKKC 1XHJA 5BUSA 4B3RC 2KZFA 2ATWA 4JI8C 5BUQA 2Y4OA 3DLPX 4DG9A 2UU9C 2YWBA 4GXQA 2ONFA 4I9FA 4MTNA 3TUFA 3FM7A 4NXNC 4JI1C 3NYRA 4B3TC 4WV3A 4KHPC 1N34C 1P7LA 5GTDA 3K6RA 3TR3A 1WH9A 4X64C 3O2EA 3LUSA 3IPLA 5A1IA 1HNZC 1UWDA 3SO4A 1PG3A 4HPVA 1VEHA 1XRBA 3PESA 2YWCA 5CZVA 3LNVA 3EERA 4RVOA 5T8SA 4DV0C 2DHMA 2UXCC 2UXDC 3E7WA 2OBVA 1XRAA 4R1LA 1NY8A 4BSZA 1T5HX 3ETCA 4XX2A 2VQFC 3CQ1A 4DUZC 1FLOA 3AF6A 5BSRA 4DV5C 3H2TA 4LFAC 4DCUA 5H9UA 1IBLC 1YJ7A 3CJEA 1RG9A 3LNOA 1MXBA 4JM1A 5DV9A 4JI3C 3GKUA 1V26A 1QM4A 1PG4A 1N36C 2ASBA 3NI2A 4OXIA 2UXBC 3VNSA 4JV5C 2CY1A 3LAXA 5BSVA 4OYCA 2XR1A 3J80D 4L4QA 1EGAA 2OPLA 4BBYA 1PA4A 2UUBC 2QVZX 3A26A 3A9VA 5E7QA 4PUIA 4DR7C 1HNXC 4JI5C 3IEUA 1YGTA 1I94C 1ZB8A 2PT7G 2EGTA 3I07A 3CQ3A 5AE3A 3NYQA 4TPSB 2JMPA 4B3MC 3AY0A 5A2QD 1N32C 3NPDA 2D1SA 4K0BA 3PBKA 2E8EA 4G1IA 1RY2A 3L8CA 4G37A 4GS5A 3TDEA 1MD9A 4KTTA 1HR0C 3J81D 4DUYC 1QWIA 2QVYX 3N54B 2E5LC 2E7GA 4EATA 4X66C 1MXAA 1LQLA 2DYJA 3EQ6A 1O90A 4DCVA 4YHHC 2WP0C 2Y27A 4DV7C 1LCIA 4X62C 1HNWC 1XRCA 4GKJC 2PN2A 5KEIA 1PU1A 4PROC 4LF9C 4KTVA 4JI7C 1IBMC 4JYAC 1KKGA 3IMLA 4FUTA 4LF4C 2P2BA 1XMQC 4NXMC 5LMNC 2VQEC 5LMUC 4DR3C 5CZXA 2PROA 3UZ0A 1FJGC 3FCCA 1ULTA 4B3SC 3GPCA 1VLAA 4ISBA 4LF8C 1XMOC 4DV3C 1JOSA 4D4IA 1V25A 4YY3C 2D1TA 5BSTA 3GR1A 2MM9A 4D4GA 4PUGA 1O93A 2M5HA 3DHVA 3RV2A 1BA3A 2WD9A 4D56A 4LFCC 2M5OA 3PROC 4PUHA 4LF7C 1GPMA 3A4IA 4JI2C 1O9TA 2P2MA 2QL8A 1WF3A 4OX9C 4U5YD 2VSQA 4ZJZA 1WCJA 3J7AD 1V60A 4R0MA 2ZZNA 4DCSA 5BSMA 2QW0X 4FTFA 3JAMD 1FUGA 4WS9A 5BSUA 5FLXD 4LF5C 2DPLA 3RG2A 4I9GA 3C5EA 3UEBA 4BC7A 2JNVA 3IEVA 4PHTA 2PG1E 4JI4C 4RLQA 3T1YC 4DR4C 3R9XA 4DR6C 2D28C 2NCLA 3B7WA 2MMAB 4DV1C 3S82A 4LF6C 3ETOA 1IBKC 2D1RA 4X65C 4FUQA 4DV4C 4ZLPA 3UX3A 2BH1X 2P2FA 3LGXA
chains in the Genus database with same CATH topology
2P20A 5T8TA 5KYTA 3R9WA 3CW9A 4BC9A 2HJGA 2P2JA 4K0KC 4ODJA 3AF5A 4IR7A 4L2ZA 4LE5A 3VNRA 5IFIA 1T5DX 5K8FA 2AYAA 2D7VA 1N2FA 5KYVA 4RM3A 2E8FA 1UKKA 1NYEA 3VNQA 5JRHA 4JI0C 4JI6C 2QVXX 2ZM6C 3TQIA 3N2QA 1MXCA 3I08A 2F4VC 5AE1A 5K85A 1MDFA 5A1GA 1USPB 2OPLB 4GXRA 4DCTA 5A19A 4MH4A 1HH2P 2VZEA 1XNRC 4RLFA 3CW8X 2OO4A 3KXWA 5ADZA 4G36A 1ML8A 4RM2A 2E8CA 4RVNA 1O92A 3T1HC 3UOWA 4DV2C 4NOZA 3OTOC 2P02A 3GR0A 4R1MA 2HHHC 4AQYC 5IT9D 5BR8C 2D27A 2E0GA 1L2FA 2YCBA 3R44A 1N33C 4L7IA 1J5EC 2P2QA 4RMNA 4DR5C 2BJOA 2UUCC 1MKYA 4DG8A 1AMUA 1XNQC 3FCEA 5AE2A 2D1QA 2CXCA 4PZPA 4NDNA 2UUAC 2V7BA 1ZB9A 1MDBA 4BCAA 4IZ6A 4LFBC 1USPA 3DAYA 3E7XA 2Y4NA 5BSWA 4D57A 3G7SA 4DR1C 3A9UA 4DR2C 3L95X 5BURA 5IWAC 1K0RA 4DV6C 4GKKC 5BUSA 4B3RC 2KZFA 2ATWA 4JI8C 5BUQA 2Y4OA 3DLPX 4DG9A 2UU9C 2YWBA 4GXQA 2ONFA 4I9FA 4MTNA 3TUFA 4NXNC 4JI1C 3NYRA 4B3TC 4WV3A 4KHPC 1N34C 1P7LA 5GTDA 4X64C 1WH9A 3LUSA 3IPLA 5A1IA 1HNZC 3SO4A 1PG3A 4HPVA 1XRBA 3PESA 2YWCA 5CZVA 3LNVA 3EERA 4RVOA 5T8SA 4DV0C 2UXCC 2UXDC 3E7WA 2OBVA 1XRAA 4R1LA 4BSZA 1T5HX 3ETCA 4XX2A 2VQFC 4DUZC 3AF6A 5BSRA 4DV5C 3H2TA 4LFAC 4DCUA 5H9UA 1IBLC 1YJ7A 3CJEA 1RG9A 1MXBA 4JM1A 5DV9A 4JI3C 3GKUA 1V26A 1QM4A 1PG4A 1N36C 2ASBA 3NI2A 4OXIA 2UXBC 3VNSA 4JV5C 2CY1A 3LAXA 5BSVA 4OYCA 2XR1A 3J80D 4L4QA 1EGAA 2OPLA 4BBYA 1PA4A 2UUBC 2QVZX 3A9VA 5E7QA 4DR7C 1HNXC 4JI5C 3IEUA 1I94C 1ZB8A 2PT7G 2EGTA 3I07A 5AE3A 3NYQA 4TPSB 2JMPA 4B3MC 5A2QD 1N32C 3NPDA 2D1SA 4K0BA 3PBKA 2E8EA 4G1IA 1RY2A 3L8CA 4G37A 4GS5A 3TDEA 1MD9A 4KTTA 1HR0C 3J81D 4DUYC 1QWIA 2QVYX 3N54B 2E5LC 2E7GA 4EATA 4X66C 1MXAA 1LQLA 2DYJA 3EQ6A 1O90A 4DCVA 4YHHC 2WP0C 2Y27A 4DV7C 1LCIA 4X62C 1HNWC 1XRCA 4GKJC 2PN2A 5KEIA 4PROC 4LF9C 4KTVA 4JI7C 1IBMC 4JYAC 1KKGA 3IMLA 4FUTA 4LF4C 2P2BA 1XMQC 4NXMC 5LMNC 2VQEC 5LMUC 4DR3C 5CZXA 2PROA 3UZ0A 1FJGC 3FCCA 1ULTA 4B3SC 3GPCA 1VLAA 4ISBA 4LF8C 1XMOC 4DV3C 1JOSA 4D4IA 1V25A 4YY3C 2D1TA 5BSTA 3GR1A 4D4GA 1O93A 3DHVA 3RV2A 1BA3A 2WD9A 4D56A 4LFCC 3PROC 4LF7C 1GPMA 3A4IA 4JI2C 1O9TA 2P2MA 2QL8A 1WF3A 4OX9C 4U5YD 2VSQA 4ZJZA 3J7AD 4R0MA 4DCSA 5BSMA 2QW0X 4FTFA 3JAMD 1FUGA 4WS9A 5BSUA 5FLXD 4LF5C 2DPLA 3RG2A 4I9GA 3C5EA 4BC7A 3IEVA 4PHTA 4JI4C 4RLQA 3T1YC 4DR4C 3R9XA 4DR6C 2D28C 3B7WA 4DV1C 3S82A 4LF6C 3ETOA 1IBKC 2D1RA 4X65C 4FUQA 4DV4C 4ZLPA 2BH1X 2P2FA 3LGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC C;  4DV5 C;  1IBM C;  1MKY A;  4JYA C;  4LFA C;  4DCU A;  1KKG A;  3R9W A;  4LF4 C;  1XNQ C;  2HJG A;  1IBL C;  2CXC A;  1XMQ C;  4NXM C;  3CJE A;  5LMN C;  2VQE C;  5LMU C;  2UUA C;  1ZB9 A;  4DR3 C;  4K0K C;  3AF5 A;  1FJG C;  4B3S C;  1VLA A;  4LFB C;  4JI3 C;  1USP A;  3GKU A;  4LF8 C;  1XMO C;  4DV3 C;  1N36 C;  1JOS A;  2ASB A;  4DR1 C;  4DR2 C;  2UXB C;  5IWA C;  4YY3 C;  1K0R A;  4DV6 C;  4GKK C;  4JV5 C;  4B3R C;  2CY1 A;  2D7V A;  1N2F A;  2KZF A;  2ATW A;  4JI8 C;  2UU9 C;  2XR1 A;  2E8F A;  3J80 D;  2ONF A;  1UKK A;  1EGA A;  2OPL A;  1NYE A;  4MTN A;  4LFC C;  4JI0 C;  1PA4 A;  4JI6 C;  2UUB C;  4NXN C;  4JI1 C;  4LF7 C;  2ZM6 C;  4JI2 C;  4DR7 C;  1HNX C;  4B3T C;  4JI5 C;  2F4V C;  3IEU A;  1I94 C;  1ZB8 A;  2PT7 G;  2QL8 A;  2EGT A;  3I07 A;  4KHP C;  1USP B;  2OPL B;  1WF3 A;  4OX9 C;  4DCT A;  4MH4 A;  1N34 C;  3J7A D;  1HH2 P;  4DCS A;  2JMP A;  1XNR C;  4B3M C;  5A2Q D;  3JAM D;  1N32 C;  5FLX D;  4X64 C;  1WH9 A;  4LF5 C;  1ML8 A;  2E8E A;  2E8C A;  3LUS A;  3T1H C;  4DV2 C;  1HNZ C;  4NOZ A;  3OTO C;  1HR0 C;  3IEV A;  3J81 D;  4DUY C;  4JI4 C;  1QWI A;  2HHH C;  3T1Y C;  2E5L C;  2E7G A;  4AQY C;  5IT9 D;  4DR4 C;  3R9X A;  4DR6 C;  4X66 C;  3EER A;  5BR8 C;  1LQL A;  4DV0 C;  2DYJ A;  4DCV A;  2UXC C;  1L2F A;  4YHH C;  2UXD C;  4DV1 C;  2YCB A;  4LF6 C;  1N33 C;  1IBK C;  4BSZ A;  1J5E C;  4X65 C;  4XX2 A;  4DV7 C;  2VQF C;  4X62 C;  4DUZ C;  4DV4 C;  1HNW C;  4GKJ C;  2PN2 A;  4LF9 C;  3AF6 A;  4JI7 C;  4DR5 C;  2BJO A; 
#chains in the Genus database with same CATH topology
 2P20 A;  5T8T A;  2ZTB A;  5KYT A;  3R9W A;  3CW9 A;  4BC9 A;  2HJG A;  2P2J A;  4K0K C;  4ODJ A;  3AF5 A;  4IR7 A;  1M6X A;  4L2Z A;  4LE5 A;  3VNR A;  5IFI A;  1T5D X;  5K8F A;  2AYA A;  1M6X C;  1XDX A;  2D7V A;  1N2F A;  5KYV A;  2KZ0 A;  4RM3 A;  3A25 A;  2ZZM A;  2E8F A;  2YX1 A;  1UKK A;  1NYE A;  3VNQ A;  5JRH A;  4JI0 C;  4JI6 C;  2QVX X;  2ZM6 C;  3TQI A;  3N2Q A;  1MXC A;  3I08 A;  2F4V C;  2Z51 A;  5AE1 A;  5K85 A;  1MDF A;  5A1G A;  1USP B;  2OPL B;  4GXR A;  2KDN A;  4DCT A;  5A19 A;  1P4E A;  4MH4 A;  1HH2 P;  2VZE A;  1XNR C;  4RLF A;  3UX2 A;  3CW8 X;  2OO4 A;  2MCQ A;  3KXW A;  5ADZ A;  4G36 A;  1ML8 A;  4RM2 A;  2E8C A;  4RVN A;  1O92 A;  3T1H C;  3UOW A;  2CU6 A;  4DV2 C;  1P4E C;  4NOZ A;  3OTO C;  2P02 A;  3GR0 A;  4R1M A;  2HHH C;  5LCI A;  4AQY C;  5IT9 D;  5BR8 C;  2D27 A;  2E0G A;  1L2F A;  2YCB A;  3R44 A;  1N33 C;  4L7I A;  1J5E C;  2P2Q A;  4RMN A;  4DR5 C;  2BJO A;  2UUC C;  1MKY A;  4DG8 A;  1AMU A;  1XNQ C;  3FCE A;  5AE2 A;  2D1Q A;  2CXC A;  3CQ2 A;  4PZP A;  4NDN A;  2UUA C;  2V7B A;  1TH5 A;  1ZB9 A;  1MDB A;  4BCA A;  4IZ6 A;  4LFB C;  1USP A;  3DAY A;  3E7X A;  2Y4N A;  5BSW A;  1IB8 A;  4D57 A;  3G7S A;  4DR1 C;  3A9U A;  4DR2 C;  3L95 X;  1XS3 A;  5BUR A;  5IWA C;  1K0R A;  4DV6 C;  4GKK C;  1XHJ A;  5BUS A;  4B3R C;  2KZF A;  2ATW A;  4JI8 C;  5BUQ A;  2Y4O A;  3DLP X;  4DG9 A;  2UU9 C;  2YWB A;  4GXQ A;  2ONF A;  4I9F A;  4MTN A;  3TUF A;  3FM7 A;  4NXN C;  4JI1 C;  3NYR A;  4B3T C;  4WV3 A;  4KHP C;  1N34 C;  1P7L A;  5GTD A;  3K6R A;  3TR3 A;  1WH9 A;  4X64 C;  3O2E A;  3LUS A;  3IPL A;  5A1I A;  1HNZ C;  1UWD A;  3SO4 A;  1PG3 A;  4HPV A;  1VEH A;  1XRB A;  3PES A;  2YWC A;  5CZV A;  3LNV A;  3EER A;  4RVO A;  5T8S A;  4DV0 C;  2DHM A;  2UXC C;  2UXD C;  3E7W A;  2OBV A;  1XRA A;  4R1L A;  1NY8 A;  4BSZ A;  1T5H X;  3ETC A;  4XX2 A;  2VQF C;  3CQ1 A;  4DUZ C;  1FLO A;  3AF6 A;  5BSR A;  4DV5 C;  3H2T A;  4LFA C;  4DCU A;  5H9U A;  1IBL C;  1YJ7 A;  3CJE A;  1RG9 A;  3LNO A;  1MXB A;  4JM1 A;  5DV9 A;  4JI3 C;  3GKU A;  1V26 A;  1QM4 A;  1PG4 A;  1N36 C;  2ASB A;  3NI2 A;  4OXI A;  2UXB C;  3VNS A;  4JV5 C;  2CY1 A;  3LAX A;  5BSV A;  4OYC A;  2XR1 A;  3J80 D;  4L4Q A;  1EGA A;  2OPL A;  4BBY A;  1PA4 A;  2UUB C;  2QVZ X;  3A26 A;  3A9V A;  5E7Q A;  4PUI A;  4DR7 C;  1HNX C;  4JI5 C;  3IEU A;  1YGT A;  1I94 C;  1ZB8 A;  2PT7 G;  2EGT A;  3I07 A;  3CQ3 A;  5AE3 A;  3NYQ A;  4TPS B;  2JMP A;  4B3M C;  3AY0 A;  5A2Q D;  1N32 C;  3NPD A;  2D1S A;  4K0B A;  3PBK A;  2E8E A;  4G1I A;  1RY2 A;  3L8C A;  4G37 A;  4GS5 A;  3TDE A;  1MD9 A;  4KTT A;  1HR0 C;  3J81 D;  4DUY C;  1QWI A;  2QVY X;  3N54 B;  2E5L C;  2E7G A;  4EAT A;  4X66 C;  1MXA A;  1LQL A;  2DYJ A;  3EQ6 A;  1O90 A;  4DCV A;  4YHH C;  2WP0 C;  2Y27 A;  4DV7 C;  1LCI A;  4X62 C;  1HNW C;  1XRC A;  4GKJ C;  2PN2 A;  5KEI A;  1PU1 A;  4PRO C;  4LF9 C;  4KTV A;  4JI7 C;  1IBM C;  4JYA C;  1KKG A;  3IML A;  4FUT A;  4LF4 C;  2P2B A;  1XMQ C;  4NXM C;  5LMN C;  2VQE C;  5LMU C;  4DR3 C;  5CZX A;  2PRO A;  3UZ0 A;  1FJG C;  3FCC A;  1ULT A;  4B3S C;  3GPC A;  1VLA A;  4ISB A;  4LF8 C;  1XMO C;  4DV3 C;  1JOS A;  4D4I A;  1V25 A;  4YY3 C;  2D1T A;  5BST A;  3GR1 A;  2MM9 A;  4D4G A;  4PUG A;  1O93 A;  2M5H A;  3DHV A;  3RV2 A;  1BA3 A;  2WD9 A;  4D56 A;  4LFC C;  2M5O A;  3PRO C;  4PUH A;  4LF7 C;  1GPM A;  3A4I A;  4JI2 C;  1O9T A;  2P2M A;  2QL8 A;  1WF3 A;  4OX9 C;  4U5Y D;  2VSQ A;  4ZJZ A;  1WCJ A;  3J7A D;  1V60 A;  4R0M A;  2ZZN A;  4DCS A;  5BSM A;  2QW0 X;  4FTF A;  3JAM D;  1FUG A;  4WS9 A;  5BSU A;  5FLX D;  4LF5 C;  2DPL A;  3RG2 A;  4I9G A;  3C5E A;  3UEB A;  4BC7 A;  2JNV A;  3IEV A;  4PHT A;  2PG1 E;  4JI4 C;  4RLQ A;  3T1Y C;  4DR4 C;  3R9X A;  4DR6 C;  2D28 C;  2NCL A;  3B7W A;  2MMA B;  4DV1 C;  3S82 A;  4LF6 C;  3ETO A;  1IBK C;  2D1R A;  4X65 C;  4FUQ A;  4DV4 C;  4ZLP A;  3UX3 A;  2BH1 X;  2P2F A;  3LGX A; 
#chains in the Genus database with same CATH homology
 2P20 A;  5T8T A;  5KYT A;  3R9W A;  3CW9 A;  4BC9 A;  2HJG A;  2P2J A;  4K0K C;  4ODJ A;  3AF5 A;  4IR7 A;  4L2Z A;  4LE5 A;  3VNR A;  5IFI A;  1T5D X;  5K8F A;  2AYA A;  2D7V A;  1N2F A;  5KYV A;  4RM3 A;  2E8F A;  1UKK A;  1NYE A;  3VNQ A;  5JRH A;  4JI0 C;  4JI6 C;  2QVX X;  2ZM6 C;  3TQI A;  3N2Q A;  1MXC A;  3I08 A;  2F4V C;  5AE1 A;  5K85 A;  1MDF A;  5A1G A;  1USP B;  2OPL B;  4GXR A;  4DCT A;  5A19 A;  4MH4 A;  1HH2 P;  2VZE A;  1XNR C;  4RLF A;  3CW8 X;  2OO4 A;  3KXW A;  5ADZ A;  4G36 A;  1ML8 A;  4RM2 A;  2E8C A;  4RVN A;  1O92 A;  3T1H C;  3UOW A;  4DV2 C;  4NOZ A;  3OTO C;  2P02 A;  3GR0 A;  4R1M A;  2HHH C;  4AQY C;  5IT9 D;  5BR8 C;  2D27 A;  2E0G A;  1L2F A;  2YCB A;  3R44 A;  1N33 C;  4L7I A;  1J5E C;  2P2Q A;  4RMN A;  4DR5 C;  2BJO A;  2UUC C;  1MKY A;  4DG8 A;  1AMU A;  1XNQ C;  3FCE A;  5AE2 A;  2D1Q A;  2CXC A;  4PZP A;  4NDN A;  2UUA C;  2V7B A;  1ZB9 A;  1MDB A;  4BCA A;  4IZ6 A;  4LFB C;  1USP A;  3DAY A;  3E7X A;  2Y4N A;  5BSW A;  4D57 A;  3G7S A;  4DR1 C;  3A9U A;  4DR2 C;  3L95 X;  5BUR A;  5IWA C;  1K0R A;  4DV6 C;  4GKK C;  5BUS A;  4B3R C;  2KZF A;  2ATW A;  4JI8 C;  5BUQ A;  2Y4O A;  3DLP X;  4DG9 A;  2UU9 C;  2YWB A;  4GXQ A;  2ONF A;  4I9F A;  4MTN A;  3TUF A;  4NXN C;  4JI1 C;  3NYR A;  4B3T C;  4WV3 A;  4KHP C;  1N34 C;  1P7L A;  5GTD A;  4X64 C;  1WH9 A;  3LUS A;  3IPL A;  5A1I A;  1HNZ C;  3SO4 A;  1PG3 A;  4HPV A;  1XRB A;  3PES A;  2YWC A;  5CZV A;  3LNV A;  3EER A;  4RVO A;  5T8S A;  4DV0 C;  2UXC C;  2UXD C;  3E7W A;  2OBV A;  1XRA A;  4R1L A;  4BSZ A;  1T5H X;  3ETC A;  4XX2 A;  2VQF C;  4DUZ C;  3AF6 A;  5BSR A;  4DV5 C;  3H2T A;  4LFA C;  4DCU A;  5H9U A;  1IBL C;  1YJ7 A;  3CJE A;  1RG9 A;  1MXB A;  4JM1 A;  5DV9 A;  4JI3 C;  3GKU A;  1V26 A;  1QM4 A;  1PG4 A;  1N36 C;  2ASB A;  3NI2 A;  4OXI A;  2UXB C;  3VNS A;  4JV5 C;  2CY1 A;  3LAX A;  5BSV A;  4OYC A;  2XR1 A;  3J80 D;  4L4Q A;  1EGA A;  2OPL A;  4BBY A;  1PA4 A;  2UUB C;  2QVZ X;  3A9V A;  5E7Q A;  4DR7 C;  1HNX C;  4JI5 C;  3IEU A;  1I94 C;  1ZB8 A;  2PT7 G;  2EGT A;  3I07 A;  5AE3 A;  3NYQ A;  4TPS B;  2JMP A;  4B3M C;  5A2Q D;  1N32 C;  3NPD A;  2D1S A;  4K0B A;  3PBK A;  2E8E A;  4G1I A;  1RY2 A;  3L8C A;  4G37 A;  4GS5 A;  3TDE A;  1MD9 A;  4KTT A;  1HR0 C;  3J81 D;  4DUY C;  1QWI A;  2QVY X;  3N54 B;  2E5L C;  2E7G A;  4EAT A;  4X66 C;  1MXA A;  1LQL A;  2DYJ A;  3EQ6 A;  1O90 A;  4DCV A;  4YHH C;  2WP0 C;  2Y27 A;  4DV7 C;  1LCI A;  4X62 C;  1HNW C;  1XRC A;  4GKJ C;  2PN2 A;  5KEI A;  4PRO C;  4LF9 C;  4KTV A;  4JI7 C;  1IBM C;  4JYA C;  1KKG A;  3IML A;  4FUT A;  4LF4 C;  2P2B A;  1XMQ C;  4NXM C;  5LMN C;  2VQE C;  5LMU C;  4DR3 C;  5CZX A;  2PRO A;  3UZ0 A;  1FJG C;  3FCC A;  1ULT A;  4B3S C;  3GPC A;  1VLA A;  4ISB A;  4LF8 C;  1XMO C;  4DV3 C;  1JOS A;  4D4I A;  1V25 A;  4YY3 C;  2D1T A;  5BST A;  3GR1 A;  4D4G A;  1O93 A;  3DHV A;  3RV2 A;  1BA3 A;  2WD9 A;  4D56 A;  4LFC C;  3PRO C;  4LF7 C;  1GPM A;  3A4I A;  4JI2 C;  1O9T A;  2P2M A;  2QL8 A;  1WF3 A;  4OX9 C;  4U5Y D;  2VSQ A;  4ZJZ A;  3J7A D;  4R0M A;  4DCS A;  5BSM A;  2QW0 X;  4FTF A;  3JAM D;  1FUG A;  4WS9 A;  5BSU A;  5FLX D;  4LF5 C;  2DPL A;  3RG2 A;  4I9G A;  3C5E A;  4BC7 A;  3IEV A;  4PHT A;  4JI4 C;  4RLQ A;  3T1Y C;  4DR4 C;  3R9X A;  4DR6 C;  2D28 C;  3B7W A;  4DV1 C;  3S82 A;  4LF6 C;  3ETO A;  1IBK C;  2D1R A;  4X65 C;  4FUQ A;  4DV4 C;  4ZLP A;  2BH1 X;  2P2F A;  3LGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...