1XNQC

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xnqC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1xnqC02
1PA4A 4LF8C 3J80D 3AF6A 1K0RA 2ATWA 3T1YC 3J7AD 4XX2A 3R9XA 1NYEA 1I94C 4JI2C 1UKKA 2D7VA 2ZM6C 3OTOC 3JAMD 4OX9C 1ZB9A 4DCSA 2VQEC 1N32C 1WF3A 4LF6C 1N33C 1XNQC 2ONFA 3CJEA 1HNZC 4DR4C 4AQYC 1XMQC 4X66C 4GKKC 2E7GA 4JV5C 1N36C 4X65C 1HNWC 3I07A 1XNRC 4YY3C 5LMUC 3AF5A 4JI6C 4MH4A 4DV4C 2E5LC 4JI7C 4LF9C 5BR8C 1USPB 4DR1C 1MKYA 1EGAA 4DCUA 4B3TC 4LFAC 4DR2C 4JI4C 4LF4C 4GKJC 1N2FA 4LF7C 2VQFC 1HNXC 4X62C 4DUZC 1N34C 1HH2P 2CY1A 2DYJA 1VLAA 3IEUA 4MTNA 4DR5C 4DV0C 1USPA 4DR7C 3J81D 4LFCC 2HJGA 4DR3C 4B3MC 1L2FA 2KZFA 1KKGA 5LMNC 2F4VC 4JI3C 4JI8C 1ML8A 4NXNC 2UUBC 1J5EC 1ZB8A 4K0KC 1IBLC 4DV2C 4BSZA 3IEVA 3EERA 4DUYC 2YCBA 2UUCC 4DV1C 2BJOA 4JI0C 4DV6C 1XMOC 1IBMC 5IT9D 4DV3C 4YHHC 2HHHC 2UXBC 4NOZA 5A2QD 2CXCA 1HR0C 2OPLB 4KHPC 1FJGC 1LQLA 4B3SC 4NXMC 2E8FA 4DV7C 2UXCC 1JOSA 3GKUA 2QL8A 1IBKC 2UXDC 1WH9A 5FLXD 3T1HC 4DCVA 1QWIA 2JMPA 4JYAC 4DR6C 4JI1C 4JI5C 2EGTA 2OPLA 4B3RC 5IWAC 2XR1A 2E8EA 4X64C 2E8CA 4DCTA 2UUAC 2ASBA 4LFBC 3R9WA 2UU9C 2PN2A 4LF5C 2PT7G 4DV5C 3LUSA
chains in the Genus database with same CATH superfamily
3NPDA 4LF8C 1WCJA 1XDXA 1MXBA 1NYEA 4JI2C 3GR1A 2D1QA 3OTOC 1ZB9A 4DCSA 2OBVA 2VQEC 3GPCA 3LNVA 3B7WA 5GTDA 4AQYC 3VNQA 1N36C 3EQ6A 1MXAA 5LMUC 3NYQA 1XRBA 3DLPX 4DG9A 4MH4A 5BR8C 4B3TC 3C5EA 4DG8A 3A9VA 1UWDA 4FTFA 4X62C 4RMNA 3O2EA 2QVYX 2P20A 1ULTA 4MTNA 4DR5C 4DR7C 1XS3A 4LFCC 1QM4A 3DAYA 5T8TA 1P4EA 2QW0X 4B3MC 3L8CA 1L2FA 2YX1A 1T5DX 1FLOA 2UUBC 2D1SA 1ZB8A 2YWBA 5BSTA 2OO4A 3EERA 4DUYC 1M6XA 2UUCC 1P4EC 3A9UA 2BH1X 2CXCA 2V7BA 3K6RA 3UX3A 3VNRA 3E7WA 1LQLA 5AE2A 4B3SC 4RM3A 2QVZX 4G1IA 4RM2A 1M6XC 5CZXA 3GR0A 2D27A 5FLXD 1AMUA 1QWIA 3E7XA 3CW9A 5BSVA 4DR6C 4LE5A 2AYAA 3KXWA 3LNOA 4X64C 2D1RA 2ASBA 3ETOA 5AE3A 3N2QA 4G37A 4LF5C 2PT7G 1FUGA 3J80D 3T1YC 2PROA 5LCIA 2M5OA 1UKKA 4PZPA 3UOWA 2D7VA 2P2MA 2KDNA 4I9FA 1N32C 4LF6C 1XNQC 1HNZC 1RG9A 1XMQC 4GKKC 1PG3A 1HNWC 4FUQA 1XNRC 4FUTA 1MDBA 1T5HX 3R44A 5BURA 1V26A 1O9TA 2Y4OA 4DCUA 4D4GA 5CZVA 5BSWA 4LF4C 4GKJC 1N2FA 3I08A 4LF7C 1HNXC 1N34C 1VLAA 1BA3A 3IPLA 3J81D 2HJGA 4DR3C 4RLQA 2P2JA 4HPVA 2F4VC 3A26A 4K0BA 3FCCA 4ISBA 1RY2A 4NXNC 1J5EC 5ADZA 4DV2C 4OXIA 3PROC 2YCBA 3LGXA 1O93A 4JI0C 3N54B 1IBMC 4TPSB 4NOZA 2MCQA 2P2FA 2OPLB 1FJGC 2D28C 4OYCA 1XRCA 1WH9A 4DCVA 5E7QA 5KEIA 3FM7A 2JMPA 4JYAC 4JI1C 4JI5C 2OPLA 4B3RC 5IWAC 3H2TA 2P2QA 2E8CA 3FCEA 3LAXA 2UUAC 3A25A 1YGTA 4RVOA 3G7SA 4R1LA 3R9WA 4PUIA 4G36A 4DV5C 3PBKA 2CU6A 5AE1A 1K0RA 3AF6A 4KTVA 3J7AD 4L2ZA 4I9GA 1I94C 4ZJZA 2ZM6C 4OX9C 1O90A 3IMLA 4BCAA 2ZZNA 1YJ7A 1N33C 2ONFA 4PROC 3UZ0A 4X66C 2E7GA 4X65C 2NCLA 4D56A 4YY3C 4JI6C 4LF9C 1IB8A 4GXRA 5BSMA 1USPB 4DR1C 1MKYA 1EGAA 4IZ6A 4DR2C 4JI4C 5KYTA 5A1IA 2Z51A 2CY1A 3L95X 3IEUA 4DV0C 1USPA 1PG4A 3CQ1A 2KZ0A 1KKGA 4JI3C 1ML8A 2WP0C 4GS5A 4K0KC 4BSZA 2BJOA 2ZTBA 4KTTA 1XMOC 4RLFA 1V25A 4D57A 3DHVA 5IT9D 3CW8X 5BSUA 2HHHC 2UXBC 2Y4NA 1HR0C 4ZLPA 2D1TA 2JNVA 4KHPC 3CQ2A 4NXMC 4WS9A 1JOSA 3GKUA 2QL8A 5A1GA 1IBKC 5DV9A 3T1HC 2E0GA 2P02A 2QVXX 4R1MA 5BUQA 4DCTA 4L4QA 5BUSA 4BC9A 2UU9C 3VNSA 3TR3A 1LCIA 4IR7A 3LUSA 4LFBC 4JM1A 4R0MA 1PA4A 3RV2A 2PG1E 3CQ3A 2ATWA 1P7LA 3RG2A 4D4IA 4XX2A 3R9XA 4L7IA 2Y27A 4RVNA 3JAMD 2P2BA 1MDFA 1WF3A 2VZEA 3NI2A 3CJEA 5T8SA 2ZZMA 4DR4C 3A4IA 4JV5C 4ODJA 1O92A 5K85A 3I07A 3PESA 1PU1A 2YWCA 5H9UA 1MXCA 3AF5A 2MM9A 4BBYA 3NYRA 5IFIA 4DV4C 2E5LC 4JI7C 2DPLA 4LFAC 1NY8A 2VQFC 4DUZC 3TQIA 1HH2P 1V60A 2DYJA 5K8FA 3ETCA 3AY0A 4GXQA 3UX2A 4EATA 4PUHA 2KZFA 2VSQA 5LMNC 2MMAB 4NDNA 4JI8C 1GPMA 1IBLC 3IEVA 1XRAA 3SO4A 4DV1C 4DV6C 4BC7A 5KYVA 3UEBA 1VEHA 4DV3C 4YHHC 5A2QD 4WV3A 3TDEA 2M5HA 1TH5A 2E8FA 4DV7C 2UXCC 2WD9A 2UXDC 2DHMA 5JRHA 1MD9A 4PHTA 5A19A 1XHJA 4U5YD 2EGTA 5BSRA 3S82A 2XR1A 2E8EA 3TUFA 2PN2A 4PUGA
chains in the Genus database with same CATH topology
3NPDA 4LF8C 1MXBA 1NYEA 4JI2C 3GR1A 3OTOC 2D1QA 1ZB9A 4DCSA 2OBVA 2VQEC 3GPCA 3LNVA 3B7WA 5GTDA 4AQYC 3VNQA 1N36C 3EQ6A 1MXAA 5LMUC 3NYQA 1XRBA 3DLPX 4DG9A 4MH4A 5BR8C 4B3TC 3C5EA 4DG8A 3A9VA 4FTFA 4X62C 4RMNA 2QVYX 2P20A 1ULTA 4MTNA 4DR5C 4DR7C 4LFCC 1QM4A 3DAYA 5T8TA 2QW0X 4B3MC 3L8CA 1L2FA 1T5DX 2UUBC 2D1SA 1ZB8A 2YWBA 5BSTA 2OO4A 3EERA 4DUYC 2UUCC 3A9UA 2BH1X 2CXCA 2V7BA 3VNRA 3E7WA 1LQLA 5AE2A 4B3SC 4RM3A 2QVZX 4G1IA 4RM2A 5CZXA 3GR0A 2D27A 5FLXD 1AMUA 1QWIA 3E7XA 3CW9A 5BSVA 4DR6C 4LE5A 2AYAA 3KXWA 4X64C 2D1RA 2ASBA 3ETOA 5AE3A 3N2QA 4G37A 4LF5C 2PT7G 1FUGA 3J80D 3T1YC 2PROA 1UKKA 4PZPA 3UOWA 2D7VA 2P2MA 4I9FA 1N32C 4LF6C 1XNQC 1HNZC 1RG9A 1XMQC 4GKKC 1PG3A 1HNWC 4FUQA 1XNRC 4FUTA 1MDBA 1T5HX 3R44A 5BURA 1V26A 1O9TA 2Y4OA 4DCUA 4D4GA 5CZVA 5BSWA 4LF4C 4GKJC 1N2FA 3I08A 4LF7C 1HNXC 1N34C 1VLAA 1BA3A 3IPLA 3J81D 2HJGA 4DR3C 4RLQA 2P2JA 4HPVA 2F4VC 4K0BA 3FCCA 4ISBA 1RY2A 4NXNC 1J5EC 5ADZA 4DV2C 4OXIA 3PROC 2YCBA 3LGXA 1O93A 4JI0C 3N54B 1IBMC 4TPSB 4NOZA 2P2FA 2OPLB 1FJGC 2D28C 4OYCA 1XRCA 1WH9A 4DCVA 5E7QA 5KEIA 2JMPA 4JYAC 4JI1C 4JI5C 2OPLA 4B3RC 5IWAC 3H2TA 2P2QA 2E8CA 3FCEA 3LAXA 2UUAC 4RVOA 3G7SA 4R1LA 3R9WA 4G36A 4DV5C 3PBKA 5AE1A 3AF6A 1K0RA 4KTVA 3J7AD 4L2ZA 4I9GA 1I94C 4ZJZA 2ZM6C 4OX9C 1O90A 3IMLA 4BCAA 1YJ7A 1N33C 2ONFA 4PROC 3UZ0A 4X66C 2E7GA 4X65C 4D56A 4YY3C 4JI6C 4LF9C 4GXRA 5BSMA 1USPB 4DR1C 1MKYA 1EGAA 4IZ6A 4DR2C 4JI4C 5KYTA 5A1IA 2CY1A 3L95X 3IEUA 4DV0C 1USPA 1PG4A 1KKGA 4JI3C 1ML8A 2WP0C 4GS5A 4K0KC 4BSZA 2BJOA 4KTTA 1XMOC 4RLFA 1V25A 4D57A 3DHVA 5IT9D 3CW8X 5BSUA 2HHHC 2UXBC 2Y4NA 1HR0C 4ZLPA 2D1TA 4KHPC 4NXMC 4WS9A 1JOSA 3GKUA 2QL8A 5A1GA 1IBKC 5DV9A 3T1HC 2E0GA 2P02A 2QVXX 4R1MA 5BUQA 4DCTA 4L4QA 5BUSA 4BC9A 2UU9C 3VNSA 1LCIA 4IR7A 3LUSA 4LFBC 4JM1A 4R0MA 1PA4A 3RV2A 2ATWA 1P7LA 3RG2A 4D4IA 4XX2A 3R9XA 4L7IA 2Y27A 4RVNA 3JAMD 2P2BA 1MDFA 1WF3A 2VZEA 3NI2A 3CJEA 5T8SA 4DR4C 3A4IA 4JV5C 4ODJA 1O92A 5K85A 3I07A 3PESA 2YWCA 5H9UA 1MXCA 3AF5A 4BBYA 3NYRA 5IFIA 4DV4C 2E5LC 4JI7C 2DPLA 4LFAC 2VQFC 4DUZC 3TQIA 1HH2P 2DYJA 5K8FA 3ETCA 4GXQA 4EATA 2KZFA 2VSQA 5LMNC 4NDNA 4JI8C 1GPMA 1IBLC 3IEVA 1XRAA 3SO4A 4DV1C 4DV6C 4BC7A 5KYVA 4DV3C 4YHHC 5A2QD 4WV3A 3TDEA 2E8FA 4DV7C 2UXCC 2WD9A 2UXDC 5JRHA 1MD9A 4PHTA 5A19A 4U5YD 2EGTA 5BSRA 3S82A 2XR1A 2E8EA 3TUFA 2PN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PA4 A;  4LF8 C;  3J80 D;  3AF6 A;  1K0R A;  2ATW A;  3T1Y C;  3J7A D;  4XX2 A;  3R9X A;  1NYE A;  1I94 C;  4JI2 C;  1UKK A;  2D7V A;  2ZM6 C;  3OTO C;  3JAM D;  4OX9 C;  1ZB9 A;  4DCS A;  2VQE C;  1N32 C;  1WF3 A;  4LF6 C;  1N33 C;  1XNQ C;  2ONF A;  3CJE A;  1HNZ C;  4DR4 C;  4AQY C;  1XMQ C;  4X66 C;  4GKK C;  2E7G A;  4JV5 C;  1N36 C;  4X65 C;  1HNW C;  3I07 A;  1XNR C;  4YY3 C;  5LMU C;  3AF5 A;  4JI6 C;  4MH4 A;  4DV4 C;  2E5L C;  4JI7 C;  4LF9 C;  5BR8 C;  1USP B;  4DR1 C;  1MKY A;  1EGA A;  4DCU A;  4B3T C;  4LFA C;  4DR2 C;  4JI4 C;  4LF4 C;  4GKJ C;  1N2F A;  4LF7 C;  2VQF C;  1HNX C;  4X62 C;  4DUZ C;  1N34 C;  1HH2 P;  2CY1 A;  2DYJ A;  1VLA A;  3IEU A;  4MTN A;  4DR5 C;  4DV0 C;  1USP A;  4DR7 C;  3J81 D;  4LFC C;  2HJG A;  4DR3 C;  4B3M C;  1L2F A;  2KZF A;  1KKG A;  5LMN C;  2F4V C;  4JI3 C;  4JI8 C;  1ML8 A;  4NXN C;  2UUB C;  1J5E C;  1ZB8 A;  4K0K C;  1IBL C;  4DV2 C;  4BSZ A;  3IEV A;  3EER A;  4DUY C;  2YCB A;  2UUC C;  4DV1 C;  2BJO A;  4JI0 C;  4DV6 C;  1XMO C;  1IBM C;  5IT9 D;  4DV3 C;  4YHH C;  2HHH C;  2UXB C;  4NOZ A;  5A2Q D;  2CXC A;  1HR0 C;  2OPL B;  4KHP C;  1FJG C;  1LQL A;  4B3S C;  4NXM C;  2E8F A;  4DV7 C;  2UXC C;  1JOS A;  3GKU A;  2QL8 A;  1IBK C;  2UXD C;  1WH9 A;  5FLX D;  3T1H C;  4DCV A;  1QWI A;  2JMP A;  4JYA C;  4DR6 C;  4JI1 C;  4JI5 C;  2EGT A;  2OPL A;  4B3R C;  5IWA C;  2XR1 A;  2E8E A;  4X64 C;  2E8C A;  4DCT A;  2UUA C;  2ASB A;  4LFB C;  3R9W A;  2UU9 C;  2PN2 A;  4LF5 C;  2PT7 G;  4DV5 C;  3LUS A; 
#chains in the Genus database with same CATH topology
 3NPD A;  4LF8 C;  1WCJ A;  1XDX A;  1MXB A;  1NYE A;  4JI2 C;  3GR1 A;  2D1Q A;  3OTO C;  1ZB9 A;  4DCS A;  2OBV A;  2VQE C;  3GPC A;  3LNV A;  3B7W A;  5GTD A;  4AQY C;  3VNQ A;  1N36 C;  3EQ6 A;  1MXA A;  5LMU C;  3NYQ A;  1XRB A;  3DLP X;  4DG9 A;  4MH4 A;  5BR8 C;  4B3T C;  3C5E A;  4DG8 A;  3A9V A;  1UWD A;  4FTF A;  4X62 C;  4RMN A;  3O2E A;  2QVY X;  2P20 A;  1ULT A;  4MTN A;  4DR5 C;  4DR7 C;  1XS3 A;  4LFC C;  1QM4 A;  3DAY A;  5T8T A;  1P4E A;  2QW0 X;  4B3M C;  3L8C A;  1L2F A;  2YX1 A;  1T5D X;  1FLO A;  2UUB C;  2D1S A;  1ZB8 A;  2YWB A;  5BST A;  2OO4 A;  3EER A;  4DUY C;  1M6X A;  2UUC C;  1P4E C;  3A9U A;  2BH1 X;  2CXC A;  2V7B A;  3K6R A;  3UX3 A;  3VNR A;  3E7W A;  1LQL A;  5AE2 A;  4B3S C;  4RM3 A;  2QVZ X;  4G1I A;  4RM2 A;  1M6X C;  5CZX A;  3GR0 A;  2D27 A;  5FLX D;  1AMU A;  1QWI A;  3E7X A;  3CW9 A;  5BSV A;  4DR6 C;  4LE5 A;  2AYA A;  3KXW A;  3LNO A;  4X64 C;  2D1R A;  2ASB A;  3ETO A;  5AE3 A;  3N2Q A;  4G37 A;  4LF5 C;  2PT7 G;  1FUG A;  3J80 D;  3T1Y C;  2PRO A;  5LCI A;  2M5O A;  1UKK A;  4PZP A;  3UOW A;  2D7V A;  2P2M A;  2KDN A;  4I9F A;  1N32 C;  4LF6 C;  1XNQ C;  1HNZ C;  1RG9 A;  1XMQ C;  4GKK C;  1PG3 A;  1HNW C;  4FUQ A;  1XNR C;  4FUT A;  1MDB A;  1T5H X;  3R44 A;  5BUR A;  1V26 A;  1O9T A;  2Y4O A;  4DCU A;  4D4G A;  5CZV A;  5BSW A;  4LF4 C;  4GKJ C;  1N2F A;  3I08 A;  4LF7 C;  1HNX C;  1N34 C;  1VLA A;  1BA3 A;  3IPL A;  3J81 D;  2HJG A;  4DR3 C;  4RLQ A;  2P2J A;  4HPV A;  2F4V C;  3A26 A;  4K0B A;  3FCC A;  4ISB A;  1RY2 A;  4NXN C;  1J5E C;  5ADZ A;  4DV2 C;  4OXI A;  3PRO C;  2YCB A;  3LGX A;  1O93 A;  4JI0 C;  3N54 B;  1IBM C;  4TPS B;  4NOZ A;  2MCQ A;  2P2F A;  2OPL B;  1FJG C;  2D28 C;  4OYC A;  1XRC A;  1WH9 A;  4DCV A;  5E7Q A;  5KEI A;  3FM7 A;  2JMP A;  4JYA C;  4JI1 C;  4JI5 C;  2OPL A;  4B3R C;  5IWA C;  3H2T A;  2P2Q A;  2E8C A;  3FCE A;  3LAX A;  2UUA C;  3A25 A;  1YGT A;  4RVO A;  3G7S A;  4R1L A;  3R9W A;  4PUI A;  4G36 A;  4DV5 C;  3PBK A;  2CU6 A;  5AE1 A;  1K0R A;  3AF6 A;  4KTV A;  3J7A D;  4L2Z A;  4I9G A;  1I94 C;  4ZJZ A;  2ZM6 C;  4OX9 C;  1O90 A;  3IML A;  4BCA A;  2ZZN A;  1YJ7 A;  1N33 C;  2ONF A;  4PRO C;  3UZ0 A;  4X66 C;  2E7G A;  4X65 C;  2NCL A;  4D56 A;  4YY3 C;  4JI6 C;  4LF9 C;  1IB8 A;  4GXR A;  5BSM A;  1USP B;  4DR1 C;  1MKY A;  1EGA A;  4IZ6 A;  4DR2 C;  4JI4 C;  5KYT A;  5A1I A;  2Z51 A;  2CY1 A;  3L95 X;  3IEU A;  4DV0 C;  1USP A;  1PG4 A;  3CQ1 A;  2KZ0 A;  1KKG A;  4JI3 C;  1ML8 A;  2WP0 C;  4GS5 A;  4K0K C;  4BSZ A;  2BJO A;  2ZTB A;  4KTT A;  1XMO C;  4RLF A;  1V25 A;  4D57 A;  3DHV A;  5IT9 D;  3CW8 X;  5BSU A;  2HHH C;  2UXB C;  2Y4N A;  1HR0 C;  4ZLP A;  2D1T A;  2JNV A;  4KHP C;  3CQ2 A;  4NXM C;  4WS9 A;  1JOS A;  3GKU A;  2QL8 A;  5A1G A;  1IBK C;  5DV9 A;  3T1H C;  2E0G A;  2P02 A;  2QVX X;  4R1M A;  5BUQ A;  4DCT A;  4L4Q A;  5BUS A;  4BC9 A;  2UU9 C;  3VNS A;  3TR3 A;  1LCI A;  4IR7 A;  3LUS A;  4LFB C;  4JM1 A;  4R0M A;  1PA4 A;  3RV2 A;  2PG1 E;  3CQ3 A;  2ATW A;  1P7L A;  3RG2 A;  4D4I A;  4XX2 A;  3R9X A;  4L7I A;  2Y27 A;  4RVN A;  3JAM D;  2P2B A;  1MDF A;  1WF3 A;  2VZE A;  3NI2 A;  3CJE A;  5T8S A;  2ZZM A;  4DR4 C;  3A4I A;  4JV5 C;  4ODJ A;  1O92 A;  5K85 A;  3I07 A;  3PES A;  1PU1 A;  2YWC A;  5H9U A;  1MXC A;  3AF5 A;  2MM9 A;  4BBY A;  3NYR A;  5IFI A;  4DV4 C;  2E5L C;  4JI7 C;  2DPL A;  4LFA C;  1NY8 A;  2VQF C;  4DUZ C;  3TQI A;  1HH2 P;  1V60 A;  2DYJ A;  5K8F A;  3ETC A;  3AY0 A;  4GXQ A;  3UX2 A;  4EAT A;  4PUH A;  2KZF A;  2VSQ A;  5LMN C;  2MMA B;  4NDN A;  4JI8 C;  1GPM A;  1IBL C;  3IEV A;  1XRA A;  3SO4 A;  4DV1 C;  4DV6 C;  4BC7 A;  5KYV A;  3UEB A;  1VEH A;  4DV3 C;  4YHH C;  5A2Q D;  4WV3 A;  3TDE A;  2M5H A;  1TH5 A;  2E8F A;  4DV7 C;  2UXC C;  2WD9 A;  2UXD C;  2DHM A;  5JRH A;  1MD9 A;  4PHT A;  5A19 A;  1XHJ A;  4U5Y D;  2EGT A;  5BSR A;  3S82 A;  2XR1 A;  2E8E A;  3TUF A;  2PN2 A;  4PUG A; 
#chains in the Genus database with same CATH homology
 3NPD A;  4LF8 C;  1MXB A;  1NYE A;  4JI2 C;  3GR1 A;  3OTO C;  2D1Q A;  1ZB9 A;  4DCS A;  2OBV A;  2VQE C;  3GPC A;  3LNV A;  3B7W A;  5GTD A;  4AQY C;  3VNQ A;  1N36 C;  3EQ6 A;  1MXA A;  5LMU C;  3NYQ A;  1XRB A;  3DLP X;  4DG9 A;  4MH4 A;  5BR8 C;  4B3T C;  3C5E A;  4DG8 A;  3A9V A;  4FTF A;  4X62 C;  4RMN A;  2QVY X;  2P20 A;  1ULT A;  4MTN A;  4DR5 C;  4DR7 C;  4LFC C;  1QM4 A;  3DAY A;  5T8T A;  2QW0 X;  4B3M C;  3L8C A;  1L2F A;  1T5D X;  2UUB C;  2D1S A;  1ZB8 A;  2YWB A;  5BST A;  2OO4 A;  3EER A;  4DUY C;  2UUC C;  3A9U A;  2BH1 X;  2CXC A;  2V7B A;  3VNR A;  3E7W A;  1LQL A;  5AE2 A;  4B3S C;  4RM3 A;  2QVZ X;  4G1I A;  4RM2 A;  5CZX A;  3GR0 A;  2D27 A;  5FLX D;  1AMU A;  1QWI A;  3E7X A;  3CW9 A;  5BSV A;  4DR6 C;  4LE5 A;  2AYA A;  3KXW A;  4X64 C;  2D1R A;  2ASB A;  3ETO A;  5AE3 A;  3N2Q A;  4G37 A;  4LF5 C;  2PT7 G;  1FUG A;  3J80 D;  3T1Y C;  2PRO A;  1UKK A;  4PZP A;  3UOW A;  2D7V A;  2P2M A;  4I9F A;  1N32 C;  4LF6 C;  1XNQ C;  1HNZ C;  1RG9 A;  1XMQ C;  4GKK C;  1PG3 A;  1HNW C;  4FUQ A;  1XNR C;  4FUT A;  1MDB A;  1T5H X;  3R44 A;  5BUR A;  1V26 A;  1O9T A;  2Y4O A;  4DCU A;  4D4G A;  5CZV A;  5BSW A;  4LF4 C;  4GKJ C;  1N2F A;  3I08 A;  4LF7 C;  1HNX C;  1N34 C;  1VLA A;  1BA3 A;  3IPL A;  3J81 D;  2HJG A;  4DR3 C;  4RLQ A;  2P2J A;  4HPV A;  2F4V C;  4K0B A;  3FCC A;  4ISB A;  1RY2 A;  4NXN C;  1J5E C;  5ADZ A;  4DV2 C;  4OXI A;  3PRO C;  2YCB A;  3LGX A;  1O93 A;  4JI0 C;  3N54 B;  1IBM C;  4TPS B;  4NOZ A;  2P2F A;  2OPL B;  1FJG C;  2D28 C;  4OYC A;  1XRC A;  1WH9 A;  4DCV A;  5E7Q A;  5KEI A;  2JMP A;  4JYA C;  4JI1 C;  4JI5 C;  2OPL A;  4B3R C;  5IWA C;  3H2T A;  2P2Q A;  2E8C A;  3FCE A;  3LAX A;  2UUA C;  4RVO A;  3G7S A;  4R1L A;  3R9W A;  4G36 A;  4DV5 C;  3PBK A;  5AE1 A;  3AF6 A;  1K0R A;  4KTV A;  3J7A D;  4L2Z A;  4I9G A;  1I94 C;  4ZJZ A;  2ZM6 C;  4OX9 C;  1O90 A;  3IML A;  4BCA A;  1YJ7 A;  1N33 C;  2ONF A;  4PRO C;  3UZ0 A;  4X66 C;  2E7G A;  4X65 C;  4D56 A;  4YY3 C;  4JI6 C;  4LF9 C;  4GXR A;  5BSM A;  1USP B;  4DR1 C;  1MKY A;  1EGA A;  4IZ6 A;  4DR2 C;  4JI4 C;  5KYT A;  5A1I A;  2CY1 A;  3L95 X;  3IEU A;  4DV0 C;  1USP A;  1PG4 A;  1KKG A;  4JI3 C;  1ML8 A;  2WP0 C;  4GS5 A;  4K0K C;  4BSZ A;  2BJO A;  4KTT A;  1XMO C;  4RLF A;  1V25 A;  4D57 A;  3DHV A;  5IT9 D;  3CW8 X;  5BSU A;  2HHH C;  2UXB C;  2Y4N A;  1HR0 C;  4ZLP A;  2D1T A;  4KHP C;  4NXM C;  4WS9 A;  1JOS A;  3GKU A;  2QL8 A;  5A1G A;  1IBK C;  5DV9 A;  3T1H C;  2E0G A;  2P02 A;  2QVX X;  4R1M A;  5BUQ A;  4DCT A;  4L4Q A;  5BUS A;  4BC9 A;  2UU9 C;  3VNS A;  1LCI A;  4IR7 A;  3LUS A;  4LFB C;  4JM1 A;  4R0M A;  1PA4 A;  3RV2 A;  2ATW A;  1P7L A;  3RG2 A;  4D4I A;  4XX2 A;  3R9X A;  4L7I A;  2Y27 A;  4RVN A;  3JAM D;  2P2B A;  1MDF A;  1WF3 A;  2VZE A;  3NI2 A;  3CJE A;  5T8S A;  4DR4 C;  3A4I A;  4JV5 C;  4ODJ A;  1O92 A;  5K85 A;  3I07 A;  3PES A;  2YWC A;  5H9U A;  1MXC A;  3AF5 A;  4BBY A;  3NYR A;  5IFI A;  4DV4 C;  2E5L C;  4JI7 C;  2DPL A;  4LFA C;  2VQF C;  4DUZ C;  3TQI A;  1HH2 P;  2DYJ A;  5K8F A;  3ETC A;  4GXQ A;  4EAT A;  2KZF A;  2VSQ A;  5LMN C;  4NDN A;  4JI8 C;  1GPM A;  1IBL C;  3IEV A;  1XRA A;  3SO4 A;  4DV1 C;  4DV6 C;  4BC7 A;  5KYV A;  4DV3 C;  4YHH C;  5A2Q D;  4WV3 A;  3TDE A;  2E8F A;  4DV7 C;  2UXC C;  2WD9 A;  2UXD C;  5JRH A;  1MD9 A;  4PHT A;  5A19 A;  4U5Y D;  2EGT A;  5BSR A;  3S82 A;  2XR1 A;  2E8E A;  3TUF A;  2PN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...