1XNQC

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xnqC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1xnqC02
2XR1A 4DR1C 4DV5C 4DR6C 1IBMC 2YCBA 1HNWC 1WH9A 2E7GA 4B3RC 1ML8A 1FJGC 2HHHC 4YY3C 3OTOC 4LF6C 3J7AD 4JI0C 4YHHC 2UUBC 4DV1C 4DR7C 1LQLA 1XMQC 4NXNC 3IEUA 4LFBC 2VQEC 4LF5C 4XX2A 3T1HC 5IT9D 2OPLA 3EERA 4DR5C 2ASBA 4DUZC 5LMUC 3R9XA 1N33C 1XNQC 1UKKA 4DCSA 4JI7C 4LF8C 1USPB 3GKUA 2HJGA 4DV3C 4JI1C 4X65C 4DV0C 4LF9C 4DV4C 2ATWA 4B3TC 1J5EC 4X64C 5FLXD 2JMPA 4JI6C 2E8EA 4JI2C 2VQFC 2E8CA 1N2FA 4NXMC 1XNRC 1ZB8A 4JI5C 3J80D 3T1YC 1VLAA 1USPA 4JYAC 4BSZA 1HR0C 2E8FA 4DV6C 3AF6A 3JAMD 1IBLC 4B3SC 3CJEA 4LFAC 1HNXC 1HNZC 3I07A 3J81D 1PA4A 2E5LC 2D7VA 4JI4C 2PT7G 2PN2A 3IEVA 4DCVA 1NYEA 4GKKC 1L2FA 2DYJA 4DCTA 4OX9C 4GKJC 4X62C 1XMOC 1ZB9A 2UUCC 4KHPC 1K0RA 4X66C 4AQYC 1EGAA 3LUSA 2ZM6C 2F4VC 2CY1A 1QWIA 4DR2C 1N36C 3AF5A 4MH4A 1N32C 4DCUA 4DV7C 2UU9C 4JI3C 2OPLB 5A2QD 2BJOA 1IBKC 4K0KC 5LMNC 4B3MC 4DR4C 2KZFA 5BR8C 4DV2C 2QL8A 4MTNA 4NOZA 2ONFA 1I94C 4LF4C 1HH2P 2UUAC 4DR3C 1N34C 1KKGA 3R9WA 2UXBC 1WF3A 5IWAC 2EGTA 4JI8C 4LF7C 1MKYA 4JV5C 4LFCC 4DUYC 2UXDC 2CXCA 1JOSA 2UXCC
chains in the Genus database with same CATH superfamily
5ADZA 2Y27A 4DR6C 2MMAB 2NCLA 2YCBA 2DPLA 5KEIA 4ODJA 3CW8X 1WH9A 2WD9A 3TQIA 4B3RC 1FJGC 4JI0C 1XS3A 3DLPX 1M6XA 1XRAA 1GPMA 1TH5A 4LFBC 3T1HC 5BSTA 4KTTA 3R9XA 1XNQC 3A4IA 4IZ6A 4RLFA 1V25A 4JI1C 5AE3A 1MXBA 5IFIA 4DV0C 5H9UA 4B3TC 5FLXD 2JMPA 4JI6C 3CQ2A 2E8CA 1XNRC 1ZB8A 2ZTBA 3B7WA 3NYRA 3UX2A 3J80D 4WS9A 1VLAA 1HR0C 2M5HA 4LFAC 1HNZC 3A9UA 2D7VA 4JI4C 3E7XA 3IEVA 4DCVA 2Y4OA 2P20A 2ZZNA 2QW0X 2DYJA 4KHPC 1M6XC 3K6RA 4MH4A 3NYQA 1N32C 4DCUA 2UU9C 3O2EA 3ETCA 4D57A 4JI3C 4PUHA 2BJOA 1PG4A 3KXWA 5BR8C 3TUFA 2QVXX 4JM1A 5GTDA 1HH2P 2EGTA 4FUQA 1BA3A 3FCEA 2UXCC 2XR1A 4DR1C 5K8FA 2WP0C 1AMUA 4U5YD 2Y4NA 1NY8A 4GXQA 2D1TA 1ML8A 4ZLPA 1WCJA 2BH1X 2P2QA 4YY3C 3OTOC 4G36A 4YHHC 2UUBC 4DV1C 4D4GA 1UWDA 4NXNC 3IEUA 2ZZMA 4LF5C 1RY2A 4D4IA 2P2MA 2ASBA 2QVZX 4K0BA 4OYCA 3VNQA 4DCSA 4EATA 3PESA 4RMNA 4X65C 3ETOA 2ATWA 1LCIA 4X64C 1O90A 3PROC 2E8EA 2VQFC 4PUIA 4L4QA 1V60A 4I9GA 4JYAC 2MM9A 5CZXA 3S82A 3AF6A 4B3SC 3CJEA 1XRCA 4R1LA 3A9VA 1MDBA 3R44A 3J81D 1V26A 3RG2A 2E5LC 2PG1E 2PT7G 3RV2A 3UOWA 4DG9A 4PROC 4GKKC 2D28C 4DCTA 4OX9C 1ZB9A 4AQYC 5KYVA 3LNOA 1O92A 3PBKA 5CZVA 2CY1A 5BUQA 5KYTA 4DV7C 4PZPA 1IBKC 4DR4C 1QM4A 2D1SA 3UX3A 4DV2C 4GS5A 2ONFA 4FUTA 4G1IA 4LF4C 2E0GA 1XRBA 4KTVA 4BCAA 2KZ0A 4DR3C 4PHTA 4JV5C 1MKYA 1O9TA 2P2FA 2VZEA 4WV3A 4LFCC 3AY0A 2CXCA 1JOSA 3N2QA 3IPLA 4DV5C 4NDNA 1MXAA 4RM3A 1IBMC 1HNWC 3NI2A 4DG8A 2OO4A 3TDEA 3E7WA 5A1IA 2HHHC 5E7QA 3C5EA 4L2ZA 4DR7C 1LQLA 1XMQC 4ZJZA 3LGXA 2VQEC 4BBYA 4XX2A 2OPLA 1MDFA 2YX1A 5LMUC 5BURA 1N33C 4JI7C 3EQ6A 4LF8C 1USPB 4RVOA 1P4EC 3GKUA 2HJGA 3CW9A 1XHJA 3A25A 3G7SA 5BSUA 3LNVA 4G37A 2OBVA 3NPDA 4TPSB 4NXMC 4JI5C 3T1YC 4LE5A 2MCQA 2P02A 1PG3A 3DAYA 2P2BA 4BSZA 4DV6C 3JAMD 1PA4A 1P7LA 3CQ3A 2PROA 1NYEA 1FUGA 1L2FA 5BSWA 1XMOC 3IMLA 1K0RA 4OXIA 5BUSA 3LUSA 3DHVA 4ISBA 2ZM6C 1YGTA 1N36C 1QWIA 2DHMA 3AF5A 3L8CA 1XDXA 3LAXA 1ULTA 3CQ1A 4K0KC 2M5OA 5LMNC 4B3MC 2KZFA 2VSQA 3VNSA 4MTNA 2V7BA 1I94C 4RVNA 1N34C 2YWBA 1KKGA 5DV9A 2UXBC 4JI8C 1MXCA 4L7IA 3SO4A 4DUYC 3TR3A 3H2TA 1P4EA 4FTFA 4D56A 1T5DX 1O93A 1PU1A 2D1RA 2E7GA 5JRHA 5AE1A 4LF6C 3J7AD 1RG9A 3I08A 3FM7A 3GPCA 3L95X 2AYAA 5A1GA 5IT9D 3EERA 4DR5C 1T5HX 4DUZC 1YJ7A 1UKKA 2KDNA 4I9FA 4DV3C 5A19A 4LF9C 3GR0A 4DV4C 4R1MA 1J5EC 2D1QA 3UEBA 5BSVA 4JI2C 3N54B 1N2FA 4HPVA 4IR7A 2D27A 2JNVA 4RLQA 1USPA 3UZ0A 4PUGA 2E8FA 1IBLC 4BC7A 1HNXC 5T8SA 3I07A 3FCCA 5K85A 2PN2A 2Z51A 5BSMA 5LCIA 4GKJC 4X62C 5AE2A 2QVYX 2UUCC 4X66C 3A26A 1EGAA 2F4VC 4DR2C 1MD9A 2YWCA 1FLOA 3GR1A 2OPLB 5A2QD 5BSRA 2QL8A 4RM2A 1VEHA 4NOZA 1IB8A 4GXRA 2UUAC 3R9WA 3VNRA 1WF3A 5IWAC 5T8TA 4R0MA 4LF7C 4BC9A 2UXDC 2CU6A 2P2JA
chains in the Genus database with same CATH topology
5ADZA 2Y27A 4DR6C 2YCBA 2DPLA 5KEIA 4ODJA 3CW8X 1WH9A 2WD9A 3TQIA 4B3RC 1FJGC 4JI0C 3DLPX 1XRAA 1GPMA 4LFBC 3T1HC 5BSTA 4KTTA 3R9XA 1XNQC 3A4IA 4IZ6A 4RLFA 1V25A 4JI1C 5AE3A 1MXBA 5IFIA 4DV0C 5H9UA 4B3TC 5FLXD 2JMPA 4JI6C 2E8CA 1XNRC 1ZB8A 3B7WA 3NYRA 3J80D 4WS9A 1VLAA 1HR0C 4LFAC 1HNZC 3A9UA 2D7VA 4JI4C 3E7XA 3IEVA 4DCVA 2Y4OA 2P20A 2QW0X 2DYJA 4KHPC 4MH4A 3NYQA 1N32C 4DCUA 2UU9C 3ETCA 4D57A 4JI3C 2BJOA 1PG4A 3KXWA 5BR8C 3TUFA 2QVXX 4JM1A 5GTDA 1HH2P 2EGTA 4FUQA 1BA3A 3FCEA 2UXCC 2XR1A 4DR1C 5K8FA 2WP0C 1AMUA 4U5YD 2Y4NA 4GXQA 2D1TA 1ML8A 4ZLPA 2BH1X 2P2QA 4YY3C 3OTOC 4G36A 4YHHC 2UUBC 4DV1C 4D4GA 4NXNC 3IEUA 4LF5C 1RY2A 4D4IA 2P2MA 2ASBA 2QVZX 4K0BA 4OYCA 3VNQA 4DCSA 4EATA 3PESA 4RMNA 4X65C 3ETOA 2ATWA 1LCIA 4X64C 1O90A 3PROC 2E8EA 2VQFC 4L4QA 4I9GA 4JYAC 5CZXA 3S82A 3AF6A 4B3SC 3CJEA 1XRCA 4R1LA 3A9VA 1MDBA 3R44A 3J81D 1V26A 3RG2A 2E5LC 2PT7G 3RV2A 3UOWA 4DG9A 4PROC 4GKKC 2D28C 4DCTA 4OX9C 1ZB9A 4AQYC 5KYVA 1O92A 3PBKA 5CZVA 2CY1A 5BUQA 5KYTA 4DV7C 4PZPA 1IBKC 4DR4C 1QM4A 2D1SA 4DV2C 4GS5A 2ONFA 4FUTA 4G1IA 4LF4C 2E0GA 1XRBA 4KTVA 4BCAA 4DR3C 4PHTA 4JV5C 1MKYA 1O9TA 4LFCC 2P2FA 2VZEA 4WV3A 2CXCA 1JOSA 3N2QA 3IPLA 4DV5C 4NDNA 1MXAA 4RM3A 1IBMC 1HNWC 3NI2A 4DG8A 2OO4A 3TDEA 3E7WA 5A1IA 2HHHC 5E7QA 3C5EA 4L2ZA 4DR7C 1LQLA 1XMQC 4ZJZA 3LGXA 2VQEC 4BBYA 4XX2A 2OPLA 1MDFA 5LMUC 5BURA 1N33C 4JI7C 3EQ6A 4LF8C 1USPB 4RVOA 3GKUA 2HJGA 3CW9A 3G7SA 5BSUA 3LNVA 4G37A 2OBVA 3NPDA 4TPSB 4NXMC 4JI5C 3T1YC 4LE5A 2P02A 1PG3A 3DAYA 2P2BA 4BSZA 4DV6C 3JAMD 1PA4A 1P7LA 2PROA 1NYEA 1FUGA 1L2FA 5BSWA 1XMOC 3IMLA 1K0RA 4OXIA 5BUSA 3LUSA 3DHVA 4ISBA 2ZM6C 1N36C 1QWIA 3AF5A 3L8CA 3LAXA 1ULTA 4K0KC 5LMNC 4B3MC 2KZFA 2VSQA 3VNSA 4MTNA 2V7BA 1I94C 4RVNA 1N34C 2YWBA 1KKGA 5DV9A 2UXBC 4JI8C 1MXCA 4L7IA 3SO4A 4DUYC 3H2TA 4FTFA 4D56A 1T5DX 1O93A 2D1RA 2E7GA 5JRHA 5AE1A 4LF6C 3J7AD 1RG9A 3I08A 3GPCA 3L95X 2AYAA 5A1GA 5IT9D 3EERA 4DR5C 1T5HX 4DUZC 1YJ7A 1UKKA 4I9FA 4DV3C 5A19A 4LF9C 3GR0A 4DV4C 4R1MA 1J5EC 2D1QA 5BSVA 4JI2C 3N54B 1N2FA 4HPVA 4IR7A 2D27A 4RLQA 1USPA 3UZ0A 2E8FA 1IBLC 4BC7A 1HNXC 5T8SA 3I07A 3FCCA 5K85A 2PN2A 5BSMA 4GKJC 4X62C 5AE2A 2QVYX 2UUCC 4X66C 1EGAA 2F4VC 4DR2C 1MD9A 2YWCA 3GR1A 2OPLB 5A2QD 5BSRA 2QL8A 4RM2A 4NOZA 4GXRA 2UUAC 3R9WA 3VNRA 1WF3A 5IWAC 5T8TA 4R0MA 4LF7C 4BC9A 2UXDC 2P2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XR1 A;  4DR1 C;  4DV5 C;  4DR6 C;  1IBM C;  2YCB A;  1HNW C;  1WH9 A;  2E7G A;  4B3R C;  1ML8 A;  1FJG C;  2HHH C;  4YY3 C;  3OTO C;  4LF6 C;  3J7A D;  4JI0 C;  4YHH C;  2UUB C;  4DV1 C;  4DR7 C;  1LQL A;  1XMQ C;  4NXN C;  3IEU A;  4LFB C;  2VQE C;  4LF5 C;  4XX2 A;  3T1H C;  5IT9 D;  2OPL A;  3EER A;  4DR5 C;  2ASB A;  4DUZ C;  5LMU C;  3R9X A;  1N33 C;  1XNQ C;  1UKK A;  4DCS A;  4JI7 C;  4LF8 C;  1USP B;  3GKU A;  2HJG A;  4DV3 C;  4JI1 C;  4X65 C;  4DV0 C;  4LF9 C;  4DV4 C;  2ATW A;  4B3T C;  1J5E C;  4X64 C;  5FLX D;  2JMP A;  4JI6 C;  2E8E A;  4JI2 C;  2VQF C;  2E8C A;  1N2F A;  4NXM C;  1XNR C;  1ZB8 A;  4JI5 C;  3J80 D;  3T1Y C;  1VLA A;  1USP A;  4JYA C;  4BSZ A;  1HR0 C;  2E8F A;  4DV6 C;  3AF6 A;  3JAM D;  1IBL C;  4B3S C;  3CJE A;  4LFA C;  1HNX C;  1HNZ C;  3I07 A;  3J81 D;  1PA4 A;  2E5L C;  2D7V A;  4JI4 C;  2PT7 G;  2PN2 A;  3IEV A;  4DCV A;  1NYE A;  4GKK C;  1L2F A;  2DYJ A;  4DCT A;  4OX9 C;  4GKJ C;  4X62 C;  1XMO C;  1ZB9 A;  2UUC C;  4KHP C;  1K0R A;  4X66 C;  4AQY C;  1EGA A;  3LUS A;  2ZM6 C;  2F4V C;  2CY1 A;  1QWI A;  4DR2 C;  1N36 C;  3AF5 A;  4MH4 A;  1N32 C;  4DCU A;  4DV7 C;  2UU9 C;  4JI3 C;  2OPL B;  5A2Q D;  2BJO A;  1IBK C;  4K0K C;  5LMN C;  4B3M C;  4DR4 C;  2KZF A;  5BR8 C;  4DV2 C;  2QL8 A;  4MTN A;  4NOZ A;  2ONF A;  1I94 C;  4LF4 C;  1HH2 P;  2UUA C;  4DR3 C;  1N34 C;  1KKG A;  3R9W A;  2UXB C;  1WF3 A;  5IWA C;  2EGT A;  4JI8 C;  4LF7 C;  1MKY A;  4JV5 C;  4LFC C;  4DUY C;  2UXD C;  2CXC A;  1JOS A;  2UXC C; 
#chains in the Genus database with same CATH topology
 5ADZ A;  2Y27 A;  4DR6 C;  2MMA B;  2NCL A;  2YCB A;  2DPL A;  5KEI A;  4ODJ A;  3CW8 X;  1WH9 A;  2WD9 A;  3TQI A;  4B3R C;  1FJG C;  4JI0 C;  1XS3 A;  3DLP X;  1M6X A;  1XRA A;  1GPM A;  1TH5 A;  4LFB C;  3T1H C;  5BST A;  4KTT A;  3R9X A;  1XNQ C;  3A4I A;  4IZ6 A;  4RLF A;  1V25 A;  4JI1 C;  5AE3 A;  1MXB A;  5IFI A;  4DV0 C;  5H9U A;  4B3T C;  5FLX D;  2JMP A;  4JI6 C;  3CQ2 A;  2E8C A;  1XNR C;  1ZB8 A;  2ZTB A;  3B7W A;  3NYR A;  3UX2 A;  3J80 D;  4WS9 A;  1VLA A;  1HR0 C;  2M5H A;  4LFA C;  1HNZ C;  3A9U A;  2D7V A;  4JI4 C;  3E7X A;  3IEV A;  4DCV A;  2Y4O A;  2P20 A;  2ZZN A;  2QW0 X;  2DYJ A;  4KHP C;  1M6X C;  3K6R A;  4MH4 A;  3NYQ A;  1N32 C;  4DCU A;  2UU9 C;  3O2E A;  3ETC A;  4D57 A;  4JI3 C;  4PUH A;  2BJO A;  1PG4 A;  3KXW A;  5BR8 C;  3TUF A;  2QVX X;  4JM1 A;  5GTD A;  1HH2 P;  2EGT A;  4FUQ A;  1BA3 A;  3FCE A;  2UXC C;  2XR1 A;  4DR1 C;  5K8F A;  2WP0 C;  1AMU A;  4U5Y D;  2Y4N A;  1NY8 A;  4GXQ A;  2D1T A;  1ML8 A;  4ZLP A;  1WCJ A;  2BH1 X;  2P2Q A;  4YY3 C;  3OTO C;  4G36 A;  4YHH C;  2UUB C;  4DV1 C;  4D4G A;  1UWD A;  4NXN C;  3IEU A;  2ZZM A;  4LF5 C;  1RY2 A;  4D4I A;  2P2M A;  2ASB A;  2QVZ X;  4K0B A;  4OYC A;  3VNQ A;  4DCS A;  4EAT A;  3PES A;  4RMN A;  4X65 C;  3ETO A;  2ATW A;  1LCI A;  4X64 C;  1O90 A;  3PRO C;  2E8E A;  2VQF C;  4PUI A;  4L4Q A;  1V60 A;  4I9G A;  4JYA C;  2MM9 A;  5CZX A;  3S82 A;  3AF6 A;  4B3S C;  3CJE A;  1XRC A;  4R1L A;  3A9V A;  1MDB A;  3R44 A;  3J81 D;  1V26 A;  3RG2 A;  2E5L C;  2PG1 E;  2PT7 G;  3RV2 A;  3UOW A;  4DG9 A;  4PRO C;  4GKK C;  2D28 C;  4DCT A;  4OX9 C;  1ZB9 A;  4AQY C;  5KYV A;  3LNO A;  1O92 A;  3PBK A;  5CZV A;  2CY1 A;  5BUQ A;  5KYT A;  4DV7 C;  4PZP A;  1IBK C;  4DR4 C;  1QM4 A;  2D1S A;  3UX3 A;  4DV2 C;  4GS5 A;  2ONF A;  4FUT A;  4G1I A;  4LF4 C;  2E0G A;  1XRB A;  4KTV A;  4BCA A;  2KZ0 A;  4DR3 C;  4PHT A;  4JV5 C;  1MKY A;  1O9T A;  2P2F A;  2VZE A;  4WV3 A;  4LFC C;  3AY0 A;  2CXC A;  1JOS A;  3N2Q A;  3IPL A;  4DV5 C;  4NDN A;  1MXA A;  4RM3 A;  1IBM C;  1HNW C;  3NI2 A;  4DG8 A;  2OO4 A;  3TDE A;  3E7W A;  5A1I A;  2HHH C;  5E7Q A;  3C5E A;  4L2Z A;  4DR7 C;  1LQL A;  1XMQ C;  4ZJZ A;  3LGX A;  2VQE C;  4BBY A;  4XX2 A;  2OPL A;  1MDF A;  2YX1 A;  5LMU C;  5BUR A;  1N33 C;  4JI7 C;  3EQ6 A;  4LF8 C;  1USP B;  4RVO A;  1P4E C;  3GKU A;  2HJG A;  3CW9 A;  1XHJ A;  3A25 A;  3G7S A;  5BSU A;  3LNV A;  4G37 A;  2OBV A;  3NPD A;  4TPS B;  4NXM C;  4JI5 C;  3T1Y C;  4LE5 A;  2MCQ A;  2P02 A;  1PG3 A;  3DAY A;  2P2B A;  4BSZ A;  4DV6 C;  3JAM D;  1PA4 A;  1P7L A;  3CQ3 A;  2PRO A;  1NYE A;  1FUG A;  1L2F A;  5BSW A;  1XMO C;  3IML A;  1K0R A;  4OXI A;  5BUS A;  3LUS A;  3DHV A;  4ISB A;  2ZM6 C;  1YGT A;  1N36 C;  1QWI A;  2DHM A;  3AF5 A;  3L8C A;  1XDX A;  3LAX A;  1ULT A;  3CQ1 A;  4K0K C;  2M5O A;  5LMN C;  4B3M C;  2KZF A;  2VSQ A;  3VNS A;  4MTN A;  2V7B A;  1I94 C;  4RVN A;  1N34 C;  2YWB A;  1KKG A;  5DV9 A;  2UXB C;  4JI8 C;  1MXC A;  4L7I A;  3SO4 A;  4DUY C;  3TR3 A;  3H2T A;  1P4E A;  4FTF A;  4D56 A;  1T5D X;  1O93 A;  1PU1 A;  2D1R A;  2E7G A;  5JRH A;  5AE1 A;  4LF6 C;  3J7A D;  1RG9 A;  3I08 A;  3FM7 A;  3GPC A;  3L95 X;  2AYA A;  5A1G A;  5IT9 D;  3EER A;  4DR5 C;  1T5H X;  4DUZ C;  1YJ7 A;  1UKK A;  2KDN A;  4I9F A;  4DV3 C;  5A19 A;  4LF9 C;  3GR0 A;  4DV4 C;  4R1M A;  1J5E C;  2D1Q A;  3UEB A;  5BSV A;  4JI2 C;  3N54 B;  1N2F A;  4HPV A;  4IR7 A;  2D27 A;  2JNV A;  4RLQ A;  1USP A;  3UZ0 A;  4PUG A;  2E8F A;  1IBL C;  4BC7 A;  1HNX C;  5T8S A;  3I07 A;  3FCC A;  5K85 A;  2PN2 A;  2Z51 A;  5BSM A;  5LCI A;  4GKJ C;  4X62 C;  5AE2 A;  2QVY X;  2UUC C;  4X66 C;  3A26 A;  1EGA A;  2F4V C;  4DR2 C;  1MD9 A;  2YWC A;  1FLO A;  3GR1 A;  2OPL B;  5A2Q D;  5BSR A;  2QL8 A;  4RM2 A;  1VEH A;  4NOZ A;  1IB8 A;  4GXR A;  2UUA C;  3R9W A;  3VNR A;  1WF3 A;  5IWA C;  5T8T A;  4R0M A;  4LF7 C;  4BC9 A;  2UXD C;  2CU6 A;  2P2J A; 
#chains in the Genus database with same CATH homology
 5ADZ A;  2Y27 A;  4DR6 C;  2YCB A;  2DPL A;  5KEI A;  4ODJ A;  3CW8 X;  1WH9 A;  2WD9 A;  3TQI A;  4B3R C;  1FJG C;  4JI0 C;  3DLP X;  1XRA A;  1GPM A;  4LFB C;  3T1H C;  5BST A;  4KTT A;  3R9X A;  1XNQ C;  3A4I A;  4IZ6 A;  4RLF A;  1V25 A;  4JI1 C;  5AE3 A;  1MXB A;  5IFI A;  4DV0 C;  5H9U A;  4B3T C;  5FLX D;  2JMP A;  4JI6 C;  2E8C A;  1XNR C;  1ZB8 A;  3B7W A;  3NYR A;  3J80 D;  4WS9 A;  1VLA A;  1HR0 C;  4LFA C;  1HNZ C;  3A9U A;  2D7V A;  4JI4 C;  3E7X A;  3IEV A;  4DCV A;  2Y4O A;  2P20 A;  2QW0 X;  2DYJ A;  4KHP C;  4MH4 A;  3NYQ A;  1N32 C;  4DCU A;  2UU9 C;  3ETC A;  4D57 A;  4JI3 C;  2BJO A;  1PG4 A;  3KXW A;  5BR8 C;  3TUF A;  2QVX X;  4JM1 A;  5GTD A;  1HH2 P;  2EGT A;  4FUQ A;  1BA3 A;  3FCE A;  2UXC C;  2XR1 A;  4DR1 C;  5K8F A;  2WP0 C;  1AMU A;  4U5Y D;  2Y4N A;  4GXQ A;  2D1T A;  1ML8 A;  4ZLP A;  2BH1 X;  2P2Q A;  4YY3 C;  3OTO C;  4G36 A;  4YHH C;  2UUB C;  4DV1 C;  4D4G A;  4NXN C;  3IEU A;  4LF5 C;  1RY2 A;  4D4I A;  2P2M A;  2ASB A;  2QVZ X;  4K0B A;  4OYC A;  3VNQ A;  4DCS A;  4EAT A;  3PES A;  4RMN A;  4X65 C;  3ETO A;  2ATW A;  1LCI A;  4X64 C;  1O90 A;  3PRO C;  2E8E A;  2VQF C;  4L4Q A;  4I9G A;  4JYA C;  5CZX A;  3S82 A;  3AF6 A;  4B3S C;  3CJE A;  1XRC A;  4R1L A;  3A9V A;  1MDB A;  3R44 A;  3J81 D;  1V26 A;  3RG2 A;  2E5L C;  2PT7 G;  3RV2 A;  3UOW A;  4DG9 A;  4PRO C;  4GKK C;  2D28 C;  4DCT A;  4OX9 C;  1ZB9 A;  4AQY C;  5KYV A;  1O92 A;  3PBK A;  5CZV A;  2CY1 A;  5BUQ A;  5KYT A;  4DV7 C;  4PZP A;  1IBK C;  4DR4 C;  1QM4 A;  2D1S A;  4DV2 C;  4GS5 A;  2ONF A;  4FUT A;  4G1I A;  4LF4 C;  2E0G A;  1XRB A;  4KTV A;  4BCA A;  4DR3 C;  4PHT A;  4JV5 C;  1MKY A;  1O9T A;  4LFC C;  2P2F A;  2VZE A;  4WV3 A;  2CXC A;  1JOS A;  3N2Q A;  3IPL A;  4DV5 C;  4NDN A;  1MXA A;  4RM3 A;  1IBM C;  1HNW C;  3NI2 A;  4DG8 A;  2OO4 A;  3TDE A;  3E7W A;  5A1I A;  2HHH C;  5E7Q A;  3C5E A;  4L2Z A;  4DR7 C;  1LQL A;  1XMQ C;  4ZJZ A;  3LGX A;  2VQE C;  4BBY A;  4XX2 A;  2OPL A;  1MDF A;  5LMU C;  5BUR A;  1N33 C;  4JI7 C;  3EQ6 A;  4LF8 C;  1USP B;  4RVO A;  3GKU A;  2HJG A;  3CW9 A;  3G7S A;  5BSU A;  3LNV A;  4G37 A;  2OBV A;  3NPD A;  4TPS B;  4NXM C;  4JI5 C;  3T1Y C;  4LE5 A;  2P02 A;  1PG3 A;  3DAY A;  2P2B A;  4BSZ A;  4DV6 C;  3JAM D;  1PA4 A;  1P7L A;  2PRO A;  1NYE A;  1FUG A;  1L2F A;  5BSW A;  1XMO C;  3IML A;  1K0R A;  4OXI A;  5BUS A;  3LUS A;  3DHV A;  4ISB A;  2ZM6 C;  1N36 C;  1QWI A;  3AF5 A;  3L8C A;  3LAX A;  1ULT A;  4K0K C;  5LMN C;  4B3M C;  2KZF A;  2VSQ A;  3VNS A;  4MTN A;  2V7B A;  1I94 C;  4RVN A;  1N34 C;  2YWB A;  1KKG A;  5DV9 A;  2UXB C;  4JI8 C;  1MXC A;  4L7I A;  3SO4 A;  4DUY C;  3H2T A;  4FTF A;  4D56 A;  1T5D X;  1O93 A;  2D1R A;  2E7G A;  5JRH A;  5AE1 A;  4LF6 C;  3J7A D;  1RG9 A;  3I08 A;  3GPC A;  3L95 X;  2AYA A;  5A1G A;  5IT9 D;  3EER A;  4DR5 C;  1T5H X;  4DUZ C;  1YJ7 A;  1UKK A;  4I9F A;  4DV3 C;  5A19 A;  4LF9 C;  3GR0 A;  4DV4 C;  4R1M A;  1J5E C;  2D1Q A;  5BSV A;  4JI2 C;  3N54 B;  1N2F A;  4HPV A;  4IR7 A;  2D27 A;  4RLQ A;  1USP A;  3UZ0 A;  2E8F A;  1IBL C;  4BC7 A;  1HNX C;  5T8S A;  3I07 A;  3FCC A;  5K85 A;  2PN2 A;  5BSM A;  4GKJ C;  4X62 C;  5AE2 A;  2QVY X;  2UUC C;  4X66 C;  1EGA A;  2F4V C;  4DR2 C;  1MD9 A;  2YWC A;  3GR1 A;  2OPL B;  5A2Q D;  5BSR A;  2QL8 A;  4RM2 A;  4NOZ A;  4GXR A;  2UUA C;  3R9W A;  3VNR A;  1WF3 A;  5IWA C;  5T8T A;  4R0M A;  4LF7 C;  4BC9 A;  2UXD C;  2P2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...