1FJGC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fjgC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1fjgC02
1N36C 5IWAC 4DV6C 2BJOA 4DR7C 3J7AD 1NYEA 4LF4C 2UUCC 4JI8C 2OPLB 1ZB9A 2UXBC 1IBKC 2UXDC 4JI6C 4BSZA 2EGTA 4DR2C 4DV3C 2UUBC 4LF8C 1N33C 1IBMC 5A2QD 4LF9C 4DCVA 2E8EA 5IT9D 4OX9C 2KZFA 2VQFC 1XNQC 4K0KC 1VLAA 5LMNC 1N2FA 4NXMC 4JI7C 1MKYA 1HNWC 4B3MC 4DR1C 2E7GA 4DR5C 1N32C 4DCTA 3IEUA 3J80D 2JMPA 1XNRC 4XX2A 2YCBA 4DR6C 4MH4A 1HNXC 2HJGA 4DR4C 4X64C 4MTNA 2OPLA 1K0RA 2CY1A 3T1YC 3AF5A 4LFAC 3AF6A 5LMUC 5FLXD 1HR0C 4JYAC 2PN2A 3J81D 1USPA 5BR8C 1XMQC 4DV0C 3GKUA 2CXCA 1KKGA 4X65C 3OTOC 2VQEC 1JOSA 2F4VC 1WH9A 4KHPC 3R9XA 2ONFA 4JI2C 1HH2P 2UU9C 1ML8A 4B3RC 4YHHC 2D7VA 3CJEA 2ZM6C 4GKJC 4B3TC 4DUYC 2E5LC 2E8FA 4DCSA 4NXNC 1ZB8A 4DV7C 4JI4C 4LF5C 4DV5C 3I07A 4DCUA 4LF7C 4DV2C 3T1HC 2PT7G 3LUSA 4AQYC 1IBLC 1N34C 4X66C 2UXCC 1USPB 4YY3C 1FJGC 3EERA 4B3SC 2QL8A 4DR3C 2UUAC 4JI3C 2DYJA 1PA4A 1WF3A 1XMOC 4JV5C 4JI1C 2E8CA 2HHHC 1UKKA 4X62C 4DUZC 4DV4C 3IEVA 4LFCC 2ATWA 4JI5C 1LQLA 1HNZC 2XR1A 3R9WA 1I94C 4DV1C 3JAMD 4NOZA 4LF6C 1EGAA 4LFBC 1QWIA 4JI0C 1L2FA 1J5EC 2ASBA 4GKKC
chains in the Genus database with same CATH superfamily
1N36C 1ULTA 2M5OA 2KDNA 1NYEA 4KTVA 4LF4C 2YX1A 2UXDC 5AE1A 3LGXA 2EGTA 4LF8C 1N33C 2E8EA 3L8CA 4K0KC 1VLAA 1XRBA 4RLQA 1O90A 3RG2A 2P2QA 4RLFA 2P2FA 3EQ6A 1XNRC 4XX2A 4MH4A 2ZTBA 4DR4C 3DLPX 2KZ0A 4RVNA 2WD9A 4MTNA 3AF6A 1HR0C 4JYAC 4L4QA 1USPA 1XRAA 4I9GA 3UOWA 3LNOA 4KHPC 4TPSB 1HH2P 3SO4A 4ZLPA 5BSMA 2D7VA 2ZM6C 2Y27A 1ZB8A 3I07A 1M6XA 4JM1A 2Z51A 3CQ3A 1IBLC 3FM7A 3L95X 5BSVA 4IZ6A 1PG3A 2QL8A 4PUGA 4FUTA 5BURA 4HPVA 1XMOC 4JV5C 3GR0A 2E8CA 3ETCA 4D57A 3IEVA 4WS9A 4GXQA 1P4EC 2OO4A 4LFCC 2ATWA 5IFIA 1MDFA 3JAMD 1MXCA 4NOZA 3TDEA 4PUIA 1L2FA 2OBVA 4GKKC 2D1TA 1T5DX 4DV6C 4DR7C 5KEIA 1XS3A 2UXBC 2ZZMA 5KYVA 5CZVA 4BSZA 4DR2C 3VNQA 4NDNA 4BBYA 2VQFC 1TH5A 3FCEA 4WV3A 4L7IA 4D4GA 4R1LA 4NXMC 2CU6A 4PUHA 4JI7C 3I08A 4K0BA 4OXIA 2AYAA 3NYRA 4DR1C 3ETOA 4KTTA 4DR5C 2JMPA 1AMUA 5KYTA 5AE2A 4X64C 5BSUA 1YGTA 2OPLA 4EATA 1K0RA 1V26A 2CY1A 2VSQA 3T1YC 3AF5A 5FLXD 2PN2A 2Y4NA 4DV0C 2DHMA 3N2QA 4GXRA 4U5YD 2PG1E 1RY2A 4X65C 2VQEC 5LCIA 1O92A 4IR7A 3R9XA 4G36A 4B3RC 5T8SA 3CJEA 4B3TC 4DUYC 2E8FA 4DV7C 1LCIA 4LF5C 4DV5C 4RMNA 3LUSA 4X66C 2UXCC 4YY3C 3CQ1A 4I9FA 2E0GA 3EERA 2P2MA 4B3SC 5AE3A 3UX3A 5BUSA 3C5EA 2UUAC 2DYJA 4JI1C 5ADZA 2HHHC 1UKKA 1XRCA 2Y4OA 4OYCA 4X62C 2D1RA 2QVXX 5A19A 3TQIA 1MXAA 2DPLA 4RM2A 5K8FA 4RM3A 3LNVA 1HNZC 3R9WA 3A9UA 4DV1C 3CQ2A 3R44A 1FLOA 2BJOA 1PG4A 3J7AD 2UUCC 2OPLB 3GR1A 3VNSA 3GPCA 4JI6C 2UUBC 1IBMC 4DCVA 4OX9C 2KZFA 1XNQC 1N2FA 3CW9A 3PESA 3RV2A 4B3MC 4FTFA 2QVYX 1N32C 2M5HA 3IEUA 3J80D 1HNXC 3FCCA 3O2EA 4LFAC 4PZPA 4ZJZA 5LMUC 4DG8A 2YWCA 4R1MA 3J81D 5BR8C 1XMQC 2CXCA 4BCAA 3OTOC 2MMAB 5K85A 1JOSA 3E7XA 2JNVA 4DG9A 2ONFA 4JI2C 3KXWA 3CW8X 4D56A 1V25A 2BH1X 2UU9C 1ML8A 1WCJA 4GKJC 3DAYA 2E5LC 4NXNC 4DCSA 4JI4C 1O9TA 1M6XC 2PT7G 4AQYC 1USPB 5CZXA 5E7QA 3NYQA 4ODJA 5JRHA 1XDXA 1UWDA 4JI3C 1QM4A 1PA4A 2P2BA 2YWBA 1P4EA 5DV9A 1PU1A 2P02A 4PHTA 3N54B 4JI5C 1T5HX 3UX2A 1MXBA 4LFBC 1J5EC 5A1GA 2P2JA 5IWAC 5BSRA 4GS5A 3S82A 4JI8C 1ZB9A 4G1IA 1IBKC 3A25A 4DV3C 5A2QD 4LF9C 3H2TA 5IT9D 2VZEA 5LMNC 5BUQA 2MM9A 1MKYA 2D1QA 4R0MA 1HNWC 3AY0A 2E7GA 3TUFA 3B7WA 4DCTA 2QW0X 2YCBA 4DR6C 4BC9A 2D1SA 2HJGA 1BA3A 4LE5A 1XHJA 3NPDA 2V7BA 3K6RA 2D27A 1VEHA 3VNRA 4L2ZA 3GKUA 1KKGA 3TR3A 3E7WA 1FUGA 3IMLA 5T8TA 2F4VC 1WH9A 3PBKA 4G37A 1RG9A 5BSWA 4FUQA 4YHHC 1P7LA 3NI2A 5BSTA 4DCUA 3DHVA 3A9VA 4LF7C 2PROA 4DV2C 3T1HC 4BC7A 1N34C 3PROC 3LAXA 1FJGC 2ZZNA 1YJ7A 5A1IA 3UZ0A 2P20A 4DR3C 2WP0C 2NCLA 5H9UA 1WF3A 1IB8A 3A4IA 4ISBA 4RVOA 2QVZX 4DUZC 4DV4C 1MDBA 2MCQA 5GTDA 1GPMA 3A26A 3UEBA 4D4IA 1O93A 1LQLA 1MD9A 2XR1A 1V60A 1I94C 4LF6C 1EGAA 4PROC 3G7SA 2D28C 1QWIA 1NY8A 3IPLA 4JI0C 2ASBA
chains in the Genus database with same CATH topology
1N36C 1ULTA 1NYEA 4KTVA 4LF4C 2UXDC 5AE1A 3LGXA 2EGTA 4LF8C 1N33C 2E8EA 3L8CA 4K0KC 1VLAA 1XRBA 4RLQA 1O90A 3RG2A 2P2QA 4RLFA 2P2FA 3EQ6A 1XNRC 4XX2A 4MH4A 4DR4C 3DLPX 4RVNA 2WD9A 4MTNA 3AF6A 1HR0C 4JYAC 4L4QA 1USPA 1XRAA 4I9GA 3UOWA 4KHPC 4TPSB 1HH2P 3SO4A 4ZLPA 5BSMA 2D7VA 2ZM6C 2Y27A 1ZB8A 3I07A 4JM1A 1IBLC 3L95X 5BSVA 4IZ6A 1PG3A 2QL8A 4FUTA 5BURA 4HPVA 1XMOC 4JV5C 3GR0A 2E8CA 3ETCA 4D57A 3IEVA 4WS9A 4GXQA 2OO4A 4LFCC 2ATWA 5IFIA 1MDFA 3JAMD 1MXCA 4NOZA 3TDEA 1L2FA 2OBVA 4GKKC 2D1TA 1T5DX 4DV6C 4DR7C 5KEIA 2UXBC 5KYVA 5CZVA 4BSZA 4DR2C 3VNQA 4NDNA 4BBYA 2VQFC 3FCEA 4WV3A 4L7IA 4D4GA 4R1LA 4NXMC 4JI7C 3I08A 4K0BA 4OXIA 2AYAA 3NYRA 4DR1C 3ETOA 4KTTA 4DR5C 2JMPA 1AMUA 5KYTA 5AE2A 4X64C 5BSUA 2OPLA 4EATA 1K0RA 1V26A 2CY1A 2VSQA 3T1YC 3AF5A 5FLXD 2PN2A 2Y4NA 4DV0C 3N2QA 4GXRA 4U5YD 1RY2A 4X65C 2VQEC 1O92A 4IR7A 3R9XA 4G36A 4B3RC 5T8SA 3CJEA 4B3TC 4DUYC 2E8FA 4DV7C 1LCIA 4LF5C 4DV5C 4RMNA 3LUSA 4X66C 2UXCC 4YY3C 4I9FA 2E0GA 3EERA 2P2MA 4B3SC 5AE3A 5BUSA 3C5EA 2UUAC 2DYJA 4JI1C 5ADZA 2HHHC 1UKKA 1XRCA 2Y4OA 4OYCA 4X62C 2D1RA 2QVXX 5A19A 3TQIA 1MXAA 2DPLA 4RM2A 5K8FA 4RM3A 3LNVA 1HNZC 3R9WA 3A9UA 4DV1C 3R44A 2BJOA 1PG4A 3J7AD 2UUCC 2OPLB 3GR1A 3VNSA 3GPCA 4JI6C 2UUBC 1IBMC 4DCVA 4OX9C 2KZFA 1XNQC 1N2FA 3CW9A 3PESA 3RV2A 4B3MC 4FTFA 2QVYX 1N32C 3IEUA 3J80D 1HNXC 3FCCA 4LFAC 4PZPA 4ZJZA 5LMUC 4DG8A 2YWCA 4R1MA 3J81D 5BR8C 1XMQC 2CXCA 4BCAA 3OTOC 5K85A 1JOSA 3E7XA 4DG9A 2ONFA 4JI2C 3KXWA 3CW8X 4D56A 1V25A 2BH1X 2UU9C 1ML8A 4GKJC 3DAYA 2E5LC 4NXNC 4DCSA 4JI4C 1O9TA 2PT7G 4AQYC 1USPB 5CZXA 5E7QA 3NYQA 4ODJA 5JRHA 4JI3C 1QM4A 1PA4A 2P2BA 2YWBA 5DV9A 2P02A 4PHTA 3N54B 4JI5C 1T5HX 1MXBA 4LFBC 1J5EC 5A1GA 2P2JA 5IWAC 5BSRA 4GS5A 3S82A 4JI8C 1ZB9A 4G1IA 1IBKC 4DV3C 5A2QD 4LF9C 3H2TA 5IT9D 2VZEA 5LMNC 5BUQA 1MKYA 2D1QA 4R0MA 1HNWC 2E7GA 3TUFA 3B7WA 4DCTA 2QW0X 2YCBA 4DR6C 4BC9A 2D1SA 2HJGA 1BA3A 4LE5A 3NPDA 2V7BA 2D27A 3VNRA 4L2ZA 3GKUA 1KKGA 3E7WA 1FUGA 3IMLA 5T8TA 2F4VC 1WH9A 3PBKA 4G37A 1RG9A 5BSWA 4FUQA 4YHHC 1P7LA 3NI2A 5BSTA 4DCUA 3DHVA 3A9VA 4LF7C 2PROA 4DV2C 3T1HC 4BC7A 1N34C 3PROC 3LAXA 1FJGC 1YJ7A 5A1IA 3UZ0A 2P20A 4DR3C 2WP0C 5H9UA 1WF3A 3A4IA 4ISBA 4RVOA 2QVZX 4DUZC 4DV4C 1MDBA 5GTDA 1GPMA 4D4IA 1O93A 1LQLA 1MD9A 2XR1A 1I94C 4LF6C 1EGAA 4PROC 3G7SA 2D28C 1QWIA 3IPLA 4JI0C 2ASBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 C;  5IWA C;  4DV6 C;  2BJO A;  4DR7 C;  3J7A D;  1NYE A;  4LF4 C;  2UUC C;  4JI8 C;  2OPL B;  1ZB9 A;  2UXB C;  1IBK C;  2UXD C;  4JI6 C;  4BSZ A;  2EGT A;  4DR2 C;  4DV3 C;  2UUB C;  4LF8 C;  1N33 C;  1IBM C;  5A2Q D;  4LF9 C;  4DCV A;  2E8E A;  5IT9 D;  4OX9 C;  2KZF A;  2VQF C;  1XNQ C;  4K0K C;  1VLA A;  5LMN C;  1N2F A;  4NXM C;  4JI7 C;  1MKY A;  1HNW C;  4B3M C;  4DR1 C;  2E7G A;  4DR5 C;  1N32 C;  4DCT A;  3IEU A;  3J80 D;  2JMP A;  1XNR C;  4XX2 A;  2YCB A;  4DR6 C;  4MH4 A;  1HNX C;  2HJG A;  4DR4 C;  4X64 C;  4MTN A;  2OPL A;  1K0R A;  2CY1 A;  3T1Y C;  3AF5 A;  4LFA C;  3AF6 A;  5LMU C;  5FLX D;  1HR0 C;  4JYA C;  2PN2 A;  3J81 D;  1USP A;  5BR8 C;  1XMQ C;  4DV0 C;  3GKU A;  2CXC A;  1KKG A;  4X65 C;  3OTO C;  2VQE C;  1JOS A;  2F4V C;  1WH9 A;  4KHP C;  3R9X A;  2ONF A;  4JI2 C;  1HH2 P;  2UU9 C;  1ML8 A;  4B3R C;  4YHH C;  2D7V A;  3CJE A;  2ZM6 C;  4GKJ C;  4B3T C;  4DUY C;  2E5L C;  2E8F A;  4DCS A;  4NXN C;  1ZB8 A;  4DV7 C;  4JI4 C;  4LF5 C;  4DV5 C;  3I07 A;  4DCU A;  4LF7 C;  4DV2 C;  3T1H C;  2PT7 G;  3LUS A;  4AQY C;  1IBL C;  1N34 C;  4X66 C;  2UXC C;  1USP B;  4YY3 C;  1FJG C;  3EER A;  4B3S C;  2QL8 A;  4DR3 C;  2UUA C;  4JI3 C;  2DYJ A;  1PA4 A;  1WF3 A;  1XMO C;  4JV5 C;  4JI1 C;  2E8C A;  2HHH C;  1UKK A;  4X62 C;  4DUZ C;  4DV4 C;  3IEV A;  4LFC C;  2ATW A;  4JI5 C;  1LQL A;  1HNZ C;  2XR1 A;  3R9W A;  1I94 C;  4DV1 C;  3JAM D;  4NOZ A;  4LF6 C;  1EGA A;  4LFB C;  1QWI A;  4JI0 C;  1L2F A;  1J5E C;  2ASB A;  4GKK C; 
#chains in the Genus database with same CATH topology
 1N36 C;  1ULT A;  2M5O A;  2KDN A;  1NYE A;  4KTV A;  4LF4 C;  2YX1 A;  2UXD C;  5AE1 A;  3LGX A;  2EGT A;  4LF8 C;  1N33 C;  2E8E A;  3L8C A;  4K0K C;  1VLA A;  1XRB A;  4RLQ A;  1O90 A;  3RG2 A;  2P2Q A;  4RLF A;  2P2F A;  3EQ6 A;  1XNR C;  4XX2 A;  4MH4 A;  2ZTB A;  4DR4 C;  3DLP X;  2KZ0 A;  4RVN A;  2WD9 A;  4MTN A;  3AF6 A;  1HR0 C;  4JYA C;  4L4Q A;  1USP A;  1XRA A;  4I9G A;  3UOW A;  3LNO A;  4KHP C;  4TPS B;  1HH2 P;  3SO4 A;  4ZLP A;  5BSM A;  2D7V A;  2ZM6 C;  2Y27 A;  1ZB8 A;  3I07 A;  1M6X A;  4JM1 A;  2Z51 A;  3CQ3 A;  1IBL C;  3FM7 A;  3L95 X;  5BSV A;  4IZ6 A;  1PG3 A;  2QL8 A;  4PUG A;  4FUT A;  5BUR A;  4HPV A;  1XMO C;  4JV5 C;  3GR0 A;  2E8C A;  3ETC A;  4D57 A;  3IEV A;  4WS9 A;  4GXQ A;  1P4E C;  2OO4 A;  4LFC C;  2ATW A;  5IFI A;  1MDF A;  3JAM D;  1MXC A;  4NOZ A;  3TDE A;  4PUI A;  1L2F A;  2OBV A;  4GKK C;  2D1T A;  1T5D X;  4DV6 C;  4DR7 C;  5KEI A;  1XS3 A;  2UXB C;  2ZZM A;  5KYV A;  5CZV A;  4BSZ A;  4DR2 C;  3VNQ A;  4NDN A;  4BBY A;  2VQF C;  1TH5 A;  3FCE A;  4WV3 A;  4L7I A;  4D4G A;  4R1L A;  4NXM C;  2CU6 A;  4PUH A;  4JI7 C;  3I08 A;  4K0B A;  4OXI A;  2AYA A;  3NYR A;  4DR1 C;  3ETO A;  4KTT A;  4DR5 C;  2JMP A;  1AMU A;  5KYT A;  5AE2 A;  4X64 C;  5BSU A;  1YGT A;  2OPL A;  4EAT A;  1K0R A;  1V26 A;  2CY1 A;  2VSQ A;  3T1Y C;  3AF5 A;  5FLX D;  2PN2 A;  2Y4N A;  4DV0 C;  2DHM A;  3N2Q A;  4GXR A;  4U5Y D;  2PG1 E;  1RY2 A;  4X65 C;  2VQE C;  5LCI A;  1O92 A;  4IR7 A;  3R9X A;  4G36 A;  4B3R C;  5T8S A;  3CJE A;  4B3T C;  4DUY C;  2E8F A;  4DV7 C;  1LCI A;  4LF5 C;  4DV5 C;  4RMN A;  3LUS A;  4X66 C;  2UXC C;  4YY3 C;  3CQ1 A;  4I9F A;  2E0G A;  3EER A;  2P2M A;  4B3S C;  5AE3 A;  3UX3 A;  5BUS A;  3C5E A;  2UUA C;  2DYJ A;  4JI1 C;  5ADZ A;  2HHH C;  1UKK A;  1XRC A;  2Y4O A;  4OYC A;  4X62 C;  2D1R A;  2QVX X;  5A19 A;  3TQI A;  1MXA A;  2DPL A;  4RM2 A;  5K8F A;  4RM3 A;  3LNV A;  1HNZ C;  3R9W A;  3A9U A;  4DV1 C;  3CQ2 A;  3R44 A;  1FLO A;  2BJO A;  1PG4 A;  3J7A D;  2UUC C;  2OPL B;  3GR1 A;  3VNS A;  3GPC A;  4JI6 C;  2UUB C;  1IBM C;  4DCV A;  4OX9 C;  2KZF A;  1XNQ C;  1N2F A;  3CW9 A;  3PES A;  3RV2 A;  4B3M C;  4FTF A;  2QVY X;  1N32 C;  2M5H A;  3IEU A;  3J80 D;  1HNX C;  3FCC A;  3O2E A;  4LFA C;  4PZP A;  4ZJZ A;  5LMU C;  4DG8 A;  2YWC A;  4R1M A;  3J81 D;  5BR8 C;  1XMQ C;  2CXC A;  4BCA A;  3OTO C;  2MMA B;  5K85 A;  1JOS A;  3E7X A;  2JNV A;  4DG9 A;  2ONF A;  4JI2 C;  3KXW A;  3CW8 X;  4D56 A;  1V25 A;  2BH1 X;  2UU9 C;  1ML8 A;  1WCJ A;  4GKJ C;  3DAY A;  2E5L C;  4NXN C;  4DCS A;  4JI4 C;  1O9T A;  1M6X C;  2PT7 G;  4AQY C;  1USP B;  5CZX A;  5E7Q A;  3NYQ A;  4ODJ A;  5JRH A;  1XDX A;  1UWD A;  4JI3 C;  1QM4 A;  1PA4 A;  2P2B A;  2YWB A;  1P4E A;  5DV9 A;  1PU1 A;  2P02 A;  4PHT A;  3N54 B;  4JI5 C;  1T5H X;  3UX2 A;  1MXB A;  4LFB C;  1J5E C;  5A1G A;  2P2J A;  5IWA C;  5BSR A;  4GS5 A;  3S82 A;  4JI8 C;  1ZB9 A;  4G1I A;  1IBK C;  3A25 A;  4DV3 C;  5A2Q D;  4LF9 C;  3H2T A;  5IT9 D;  2VZE A;  5LMN C;  5BUQ A;  2MM9 A;  1MKY A;  2D1Q A;  4R0M A;  1HNW C;  3AY0 A;  2E7G A;  3TUF A;  3B7W A;  4DCT A;  2QW0 X;  2YCB A;  4DR6 C;  4BC9 A;  2D1S A;  2HJG A;  1BA3 A;  4LE5 A;  1XHJ A;  3NPD A;  2V7B A;  3K6R A;  2D27 A;  1VEH A;  3VNR A;  4L2Z A;  3GKU A;  1KKG A;  3TR3 A;  3E7W A;  1FUG A;  3IML A;  5T8T A;  2F4V C;  1WH9 A;  3PBK A;  4G37 A;  1RG9 A;  5BSW A;  4FUQ A;  4YHH C;  1P7L A;  3NI2 A;  5BST A;  4DCU A;  3DHV A;  3A9V A;  4LF7 C;  2PRO A;  4DV2 C;  3T1H C;  4BC7 A;  1N34 C;  3PRO C;  3LAX A;  1FJG C;  2ZZN A;  1YJ7 A;  5A1I A;  3UZ0 A;  2P20 A;  4DR3 C;  2WP0 C;  2NCL A;  5H9U A;  1WF3 A;  1IB8 A;  3A4I A;  4ISB A;  4RVO A;  2QVZ X;  4DUZ C;  4DV4 C;  1MDB A;  2MCQ A;  5GTD A;  1GPM A;  3A26 A;  3UEB A;  4D4I A;  1O93 A;  1LQL A;  1MD9 A;  2XR1 A;  1V60 A;  1I94 C;  4LF6 C;  1EGA A;  4PRO C;  3G7S A;  2D28 C;  1QWI A;  1NY8 A;  3IPL A;  4JI0 C;  2ASB A; 
#chains in the Genus database with same CATH homology
 1N36 C;  1ULT A;  1NYE A;  4KTV A;  4LF4 C;  2UXD C;  5AE1 A;  3LGX A;  2EGT A;  4LF8 C;  1N33 C;  2E8E A;  3L8C A;  4K0K C;  1VLA A;  1XRB A;  4RLQ A;  1O90 A;  3RG2 A;  2P2Q A;  4RLF A;  2P2F A;  3EQ6 A;  1XNR C;  4XX2 A;  4MH4 A;  4DR4 C;  3DLP X;  4RVN A;  2WD9 A;  4MTN A;  3AF6 A;  1HR0 C;  4JYA C;  4L4Q A;  1USP A;  1XRA A;  4I9G A;  3UOW A;  4KHP C;  4TPS B;  1HH2 P;  3SO4 A;  4ZLP A;  5BSM A;  2D7V A;  2ZM6 C;  2Y27 A;  1ZB8 A;  3I07 A;  4JM1 A;  1IBL C;  3L95 X;  5BSV A;  4IZ6 A;  1PG3 A;  2QL8 A;  4FUT A;  5BUR A;  4HPV A;  1XMO C;  4JV5 C;  3GR0 A;  2E8C A;  3ETC A;  4D57 A;  3IEV A;  4WS9 A;  4GXQ A;  2OO4 A;  4LFC C;  2ATW A;  5IFI A;  1MDF A;  3JAM D;  1MXC A;  4NOZ A;  3TDE A;  1L2F A;  2OBV A;  4GKK C;  2D1T A;  1T5D X;  4DV6 C;  4DR7 C;  5KEI A;  2UXB C;  5KYV A;  5CZV A;  4BSZ A;  4DR2 C;  3VNQ A;  4NDN A;  4BBY A;  2VQF C;  3FCE A;  4WV3 A;  4L7I A;  4D4G A;  4R1L A;  4NXM C;  4JI7 C;  3I08 A;  4K0B A;  4OXI A;  2AYA A;  3NYR A;  4DR1 C;  3ETO A;  4KTT A;  4DR5 C;  2JMP A;  1AMU A;  5KYT A;  5AE2 A;  4X64 C;  5BSU A;  2OPL A;  4EAT A;  1K0R A;  1V26 A;  2CY1 A;  2VSQ A;  3T1Y C;  3AF5 A;  5FLX D;  2PN2 A;  2Y4N A;  4DV0 C;  3N2Q A;  4GXR A;  4U5Y D;  1RY2 A;  4X65 C;  2VQE C;  1O92 A;  4IR7 A;  3R9X A;  4G36 A;  4B3R C;  5T8S A;  3CJE A;  4B3T C;  4DUY C;  2E8F A;  4DV7 C;  1LCI A;  4LF5 C;  4DV5 C;  4RMN A;  3LUS A;  4X66 C;  2UXC C;  4YY3 C;  4I9F A;  2E0G A;  3EER A;  2P2M A;  4B3S C;  5AE3 A;  5BUS A;  3C5E A;  2UUA C;  2DYJ A;  4JI1 C;  5ADZ A;  2HHH C;  1UKK A;  1XRC A;  2Y4O A;  4OYC A;  4X62 C;  2D1R A;  2QVX X;  5A19 A;  3TQI A;  1MXA A;  2DPL A;  4RM2 A;  5K8F A;  4RM3 A;  3LNV A;  1HNZ C;  3R9W A;  3A9U A;  4DV1 C;  3R44 A;  2BJO A;  1PG4 A;  3J7A D;  2UUC C;  2OPL B;  3GR1 A;  3VNS A;  3GPC A;  4JI6 C;  2UUB C;  1IBM C;  4DCV A;  4OX9 C;  2KZF A;  1XNQ C;  1N2F A;  3CW9 A;  3PES A;  3RV2 A;  4B3M C;  4FTF A;  2QVY X;  1N32 C;  3IEU A;  3J80 D;  1HNX C;  3FCC A;  4LFA C;  4PZP A;  4ZJZ A;  5LMU C;  4DG8 A;  2YWC A;  4R1M A;  3J81 D;  5BR8 C;  1XMQ C;  2CXC A;  4BCA A;  3OTO C;  5K85 A;  1JOS A;  3E7X A;  4DG9 A;  2ONF A;  4JI2 C;  3KXW A;  3CW8 X;  4D56 A;  1V25 A;  2BH1 X;  2UU9 C;  1ML8 A;  4GKJ C;  3DAY A;  2E5L C;  4NXN C;  4DCS A;  4JI4 C;  1O9T A;  2PT7 G;  4AQY C;  1USP B;  5CZX A;  5E7Q A;  3NYQ A;  4ODJ A;  5JRH A;  4JI3 C;  1QM4 A;  1PA4 A;  2P2B A;  2YWB A;  5DV9 A;  2P02 A;  4PHT A;  3N54 B;  4JI5 C;  1T5H X;  1MXB A;  4LFB C;  1J5E C;  5A1G A;  2P2J A;  5IWA C;  5BSR A;  4GS5 A;  3S82 A;  4JI8 C;  1ZB9 A;  4G1I A;  1IBK C;  4DV3 C;  5A2Q D;  4LF9 C;  3H2T A;  5IT9 D;  2VZE A;  5LMN C;  5BUQ A;  1MKY A;  2D1Q A;  4R0M A;  1HNW C;  2E7G A;  3TUF A;  3B7W A;  4DCT A;  2QW0 X;  2YCB A;  4DR6 C;  4BC9 A;  2D1S A;  2HJG A;  1BA3 A;  4LE5 A;  3NPD A;  2V7B A;  2D27 A;  3VNR A;  4L2Z A;  3GKU A;  1KKG A;  3E7W A;  1FUG A;  3IML A;  5T8T A;  2F4V C;  1WH9 A;  3PBK A;  4G37 A;  1RG9 A;  5BSW A;  4FUQ A;  4YHH C;  1P7L A;  3NI2 A;  5BST A;  4DCU A;  3DHV A;  3A9V A;  4LF7 C;  2PRO A;  4DV2 C;  3T1H C;  4BC7 A;  1N34 C;  3PRO C;  3LAX A;  1FJG C;  1YJ7 A;  5A1I A;  3UZ0 A;  2P20 A;  4DR3 C;  2WP0 C;  5H9U A;  1WF3 A;  3A4I A;  4ISB A;  4RVO A;  2QVZ X;  4DUZ C;  4DV4 C;  1MDB A;  5GTD A;  1GPM A;  4D4I A;  1O93 A;  1LQL A;  1MD9 A;  2XR1 A;  1I94 C;  4LF6 C;  1EGA A;  4PRO C;  3G7S A;  2D28 C;  1QWI A;  3IPL A;  4JI0 C;  2ASB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...