1FJGC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fjgC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1fjgC02
4JI2C 4LF9C 1MKYA 4X64C 4X66C 1HNXC 4DR3C 4AQYC 2D7VA 3IEVA 4DV3C 4LF7C 5BR8C 2EGTA 2XR1A 1WF3A 4LF4C 2UXDC 1N2FA 4LF5C 2ONFA 1HNWC 1K0RA 1N36C 3JAMD 4JI6C 2QL8A 1HNZC 2HJGA 2UUCC 1XNRC 2E5LC 1VLAA 4DR1C 4NXNC 4JI8C 3IEUA 3T1HC 4DV5C 4LFBC 2UXCC 4DCTA 1IBMC 1IBLC 1EGAA 1I94C 4DR6C 2F4VC 1WH9A 5LMUC 4JI5C 4DR2C 4GKKC 1N34C 3T1YC 4NOZA 4JI1C 4JV5C 1NYEA 1ZB9A 5FLXD 2VQEC 1XMQC 1ML8A 2UU9C 4JI0C 4DCUA 2UUBC 3I07A 4K0KC 3LUSA 4NXMC 2ZM6C 3R9WA 4DV4C 4B3SC 1HR0C 1ZB8A 2E8FA 2BJOA 2UXBC 2ATWA 4DCVA 2DYJA 2CY1A 2UUAC 4DV0C 1UKKA 3J80D 4B3MC 3OTOC 2HHHC 3EERA 1JOSA 2E8EA 1IBKC 5LMNC 3AF6A 4LFCC 2KZFA 4DR5C 4DV7C 1XMOC 4JYAC 2ASBA 4MTNA 3J81D 1FJGC 4B3TC 4X65C 2OPLB 5A2QD 4LF8C 4OX9C 4DR7C 2PT7G 4YHHC 2OPLA 3R9XA 4B3RC 1J5EC 4KHPC 4XX2A 2E8CA 4BSZA 2YCBA 4JI3C 4X62C 4DV6C 1HH2P 1LQLA 5IWAC 4GKJC 4YY3C 2VQFC 1KKGA 4DR4C 4DCSA 1XNQC 3AF5A 4DV1C 4LF6C 3J7AD 4JI4C 4MH4A 3CJEA 1QWIA 5IT9D 2JMPA 2PN2A 4DUYC 4LFAC 4JI7C 4DV2C 1PA4A 4DUZC 1N32C 1USPB 1L2FA 1N33C 3GKUA 1USPA 2CXCA 2E7GA
chains in the Genus database with same CATH superfamily
1XS3A 4LF9C 4BC7A 4RLFA 1P7LA 2P2BA 2QVZX 2D1SA 3IEVA 1V60A 4R1LA 5K8FA 5BR8C 4DV3C 4DG9A 2UXDC 4I9FA 2ONFA 2E0GA 4BBYA 5BURA 1N36C 4JI6C 2QL8A 1MXAA 3FCEA 4PZPA 1V25A 4WS9A 1BA3A 4ZLPA 1YGTA 3A9VA 4JI8C 3B7WA 3TDEA 3E7XA 2Z51A 5BSMA 4DV5C 1IBMC 4L4QA 3E7WA 4FTFA 4R0MA 5LMUC 5BSRA 4JI5C 2DHMA 1N34C 1P4EA 3T1YC 1PG4A 1ZB9A 2P2FA 4RMNA 3CW8X 5FLXD 2ZTBA 2UU9C 3O2EA 4G37A 1VEHA 3I07A 5A19A 4KTVA 2E8FA 2BJOA 3FM7A 2CY1A 2OBVA 3VNSA 3RV2A 3OTOC 5JRHA 2E8EA 4LFCC 4DR5C 2MMAB 4JYAC 3ETOA 4FUQA 2OPLB 4LF8C 1O93A 2OPLA 3NI2A 3LNOA 1J5EC 5LCIA 2DPLA 1HH2P 3UX2A 3EQ6A 2VQFC 1KKGA 3KXWA 1TH5A 3J7AD 3A26A 4DUZC 2NCLA 1MXCA 4WV3A 2P20A 3PBKA 4KTTA 4NDNA 4X64C 4D56A 2YX1A 2D7VA 1AMUA 4ZJZA 4BC9A 1XRAA 2EGTA 2XR1A 4LF5C 1K0RA 2AYAA 2P2QA 2PG1E 2OO4A 4EATA 1PG3A 1VLAA 2KDNA 4GXQA 4DR1C 4NXNC 3T1HC 2MCQA 4DCTA 2WP0C 1IB8A 2F4VC 3UX3A 4RM3A 4BCAA 2ZZNA 4G36A 4DR2C 2QVXX 3L95X 4NOZA 4TPSB 3GR1A 3IMLA 3PESA 2Y4NA 2D1TA 2UUBC 2VSQA 1XDXA 3R9WA 2ZM6C 3VNRA 4OYCA 3DHVA 1M6XC 3NYRA 4PUGA 3GR0A 3S82A 5BSWA 5E7QA 4DCVA 2DYJA 2UUAC 4ODJA 4HPVA 4DV0C 4PROC 2HHHC 3EERA 5LMNC 2KZFA 4JM1A 4DV7C 1XMOC 3TR3A 5ADZA 2ASBA 4X65C 2PT7G 3VNQA 4BSZA 4L7IA 2Y27A 4GXRA 4JI3C 4DV6C 1MDBA 1O92A 5BSUA 5IWAC 4ISBA 1RG9A 3AF5A 2KZ0A 4RLQA 1QWIA 3LGXA 2PN2A 3UZ0A 4DUYC 4DV2C 5H9UA 1N32C 1N33C 3GKUA 2JNVA 2CXCA 4PHTA 2E7GA 1UWDA 1NY8A 1V26A 4X66C 4K0BA 4AQYC 4FUTA 5BSTA 1FUGA 2BH1X 4LF7C 3RG2A 4LF4C 1N2FA 4IR7A 5CZXA 1HNWC 2MM9A 1HNZC 5A1IA 2CU6A 2HJGA 2UUCC 2QVYX 1O9TA 5T8TA 2M5OA 5A1GA 1YJ7A 2P2JA 2UXCC 1IBLC 4D4IA 3DLPX 1I94C 4DR6C 5AE1A 4D57A 3I08A 3A4IA 3LNVA 3N54B 4L2ZA 4GKKC 3K6RA 4JI1C 3FCCA 2VQEC 3NPDA 1ML8A 4JI0C 4RVOA 4DCUA 4DV4C 4B3SC 1HR0C 1O90A 2D1QA 3DAYA 2ATWA 1GPMA 5CZVA 3L8CA 4B3MC 1JOSA 4RM2A 1IBKC 2WD9A 3AF6A 3A25A 2D27A 4MTNA 2D1RA 4R1MA 4DR7C 4YHHC 5BSVA 1MD9A 4XX2A 2YWBA 2YCBA 3C5EA 4X62C 1LQLA 1T5HX 4GKJC 3AY0A 5GTDA 1XNQC 4DV1C 4LF6C 3CJEA 5IFIA 4RVNA 2D28C 2JMPA 1RY2A 1P4EC 3LAXA 1USPB 3CQ1A 1T5DX 1USPA 1M6XA 1MXBA 5AE3A 4PUIA 4U5YD 5DV9A 4JI2C 1MKYA 3G7SA 1HNXC 4DR3C 2QW0X 2Y4OA 4G1IA 1WF3A 1XRCA 1MDFA 2VZEA 3UOWA 3JAMD 3N2QA 3ETCA 1XNRC 2E5LC 3GPCA 3IEUA 2P02A 4GS5A 5T8SA 4LFBC 1EGAA 1WH9A 1FLOA 5KYTA 4JV5C 1NYEA 4D4GA 1XMQC 5BUSA 3CW9A 3UEBA 5K85A 3LUSA 4K0KC 4NXMC 1ZB8A 2UXBC 1QM4A 3CQ3A 4I9GA 1UKKA 3J80D 4PUHA 3PROC 3SO4A 5BUQA 3J81D 1FJGC 4B3TC 5A2QD 4OX9C 3R9XA 3NYQA 2P2MA 4B3RC 4KHPC 4LE5A 2E8CA 1WCJA 1XRBA 1PU1A 4IZ6A 3IPLA 3H2TA 3A9UA 4YY3C 5AE2A 4DR4C 4DCSA 5KYVA 4JI4C 4MH4A 4DG8A 5IT9D 4LFAC 3TUFA 4JI7C 3R44A 1LCIA 1PA4A 5KEIA 3CQ2A 4OXIA 1L2FA 1XHJA 2YWCA 1ULTA 2M5HA 2ZZMA 2PROA 3TQIA 2V7BA
chains in the Genus database with same CATH topology
4LF9C 4BC7A 4RLFA 1P7LA 2P2BA 2QVZX 2D1SA 3IEVA 4DV3C 4R1LA 5K8FA 5BR8C 4DG9A 2UXDC 4I9FA 2ONFA 2E0GA 4BBYA 5BURA 1N36C 4JI6C 2QL8A 1MXAA 3FCEA 4PZPA 1V25A 4WS9A 1BA3A 4ZLPA 3A9VA 4JI8C 3B7WA 3TDEA 3E7XA 5BSMA 4DV5C 1IBMC 4L4QA 3E7WA 4FTFA 4R0MA 5LMUC 5BSRA 4JI5C 1N34C 3T1YC 1PG4A 1ZB9A 2P2FA 4RMNA 3CW8X 5FLXD 2UU9C 4G37A 3I07A 5A19A 4KTVA 2E8FA 2BJOA 2CY1A 2OBVA 3VNSA 3RV2A 3OTOC 5JRHA 2E8EA 4LFCC 4DR5C 4JYAC 3ETOA 4FUQA 2OPLB 4LF8C 1O93A 2OPLA 3NI2A 1J5EC 2DPLA 1HH2P 1KKGA 2VQFC 3EQ6A 3KXWA 3J7AD 4DUZC 1MXCA 4WV3A 2P20A 3PBKA 4KTTA 4NDNA 4X64C 4D56A 2D7VA 1AMUA 4ZJZA 4BC9A 1XRAA 2EGTA 2XR1A 4LF5C 1K0RA 2AYAA 2P2QA 2OO4A 4EATA 1PG3A 1VLAA 4GXQA 4DR1C 4NXNC 3T1HC 4DCTA 2WP0C 2F4VC 4BCAA 4RM3A 4G36A 4DR2C 2QVXX 3L95X 4NOZA 4TPSB 3GR1A 3IMLA 3PESA 2Y4NA 2D1TA 2UUBC 2VSQA 3R9WA 2ZM6C 3VNRA 4OYCA 3DHVA 3NYRA 3GR0A 3S82A 5BSWA 5E7QA 4DCVA 2DYJA 2UUAC 4ODJA 4HPVA 4DV0C 4PROC 2HHHC 3EERA 5LMNC 2KZFA 4JM1A 4DV7C 1XMOC 2ASBA 5ADZA 4X65C 2PT7G 3VNQA 4BSZA 4L7IA 2Y27A 4GXRA 4JI3C 4DV6C 1MDBA 1O92A 5BSUA 5IWAC 4ISBA 1RG9A 3AF5A 4RLQA 1QWIA 3LGXA 2PN2A 3UZ0A 4DUYC 4DV2C 5H9UA 1N32C 1N33C 3GKUA 2CXCA 4PHTA 2E7GA 1V26A 4X66C 4K0BA 4AQYC 4FUTA 5BSTA 1FUGA 2BH1X 4LF7C 3RG2A 4LF4C 1N2FA 4IR7A 5CZXA 1HNWC 1HNZC 5A1IA 2HJGA 2UUCC 2QVYX 1O9TA 5T8TA 5A1GA 1YJ7A 2P2JA 2UXCC 1IBLC 4D4IA 3DLPX 1I94C 4DR6C 5AE1A 4D57A 3I08A 3A4IA 3LNVA 3N54B 4L2ZA 4GKKC 4JI1C 3FCCA 2VQEC 3NPDA 1ML8A 4JI0C 4RVOA 4DCUA 4DV4C 4B3SC 1HR0C 1O90A 2D1QA 3DAYA 2ATWA 1GPMA 5CZVA 3L8CA 4B3MC 1JOSA 4RM2A 1IBKC 2WD9A 3AF6A 2D27A 4MTNA 2D1RA 4R1MA 4DR7C 4YHHC 5BSVA 1MD9A 4XX2A 2YWBA 2YCBA 3C5EA 4X62C 1LQLA 1T5HX 4GKJC 5GTDA 1XNQC 4DV1C 4LF6C 3CJEA 5IFIA 4RVNA 2D28C 2JMPA 1RY2A 3LAXA 1USPB 1T5DX 1USPA 1MXBA 5AE3A 4U5YD 5DV9A 4JI2C 1MKYA 3G7SA 1HNXC 4DR3C 2QW0X 2Y4OA 4G1IA 1WF3A 1XRCA 1MDFA 2VZEA 3UOWA 3JAMD 3N2QA 3ETCA 1XNRC 2E5LC 3GPCA 3IEUA 2P02A 4GS5A 5T8SA 4LFBC 1EGAA 1WH9A 5KYTA 4JV5C 1NYEA 4D4GA 1XMQC 5BUSA 3CW9A 5K85A 3LUSA 4K0KC 4NXMC 1ZB8A 2UXBC 1QM4A 4I9GA 1UKKA 3J80D 3PROC 3SO4A 5BUQA 3J81D 1FJGC 4B3TC 5A2QD 4OX9C 3R9XA 3NYQA 2P2MA 4B3RC 4KHPC 4LE5A 2E8CA 1XRBA 4IZ6A 3IPLA 3H2TA 3A9UA 4YY3C 5AE2A 4DR4C 4DCSA 5KYVA 4JI4C 4MH4A 4DG8A 5IT9D 4LFAC 3TUFA 4JI7C 3R44A 1LCIA 1PA4A 5KEIA 4OXIA 1L2FA 2YWCA 1ULTA 2PROA 3TQIA 2V7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 C;  4LF9 C;  1MKY A;  4X64 C;  4X66 C;  1HNX C;  4DR3 C;  4AQY C;  2D7V A;  3IEV A;  4DV3 C;  4LF7 C;  5BR8 C;  2EGT A;  2XR1 A;  1WF3 A;  4LF4 C;  2UXD C;  1N2F A;  4LF5 C;  2ONF A;  1HNW C;  1K0R A;  1N36 C;  3JAM D;  4JI6 C;  2QL8 A;  1HNZ C;  2HJG A;  2UUC C;  1XNR C;  2E5L C;  1VLA A;  4DR1 C;  4NXN C;  4JI8 C;  3IEU A;  3T1H C;  4DV5 C;  4LFB C;  2UXC C;  4DCT A;  1IBM C;  1IBL C;  1EGA A;  1I94 C;  4DR6 C;  2F4V C;  1WH9 A;  5LMU C;  4JI5 C;  4DR2 C;  4GKK C;  1N34 C;  3T1Y C;  4NOZ A;  4JI1 C;  4JV5 C;  1NYE A;  1ZB9 A;  5FLX D;  2VQE C;  1XMQ C;  1ML8 A;  2UU9 C;  4JI0 C;  4DCU A;  2UUB C;  3I07 A;  4K0K C;  3LUS A;  4NXM C;  2ZM6 C;  3R9W A;  4DV4 C;  4B3S C;  1HR0 C;  1ZB8 A;  2E8F A;  2BJO A;  2UXB C;  2ATW A;  4DCV A;  2DYJ A;  2CY1 A;  2UUA C;  4DV0 C;  1UKK A;  3J80 D;  4B3M C;  3OTO C;  2HHH C;  3EER A;  1JOS A;  2E8E A;  1IBK C;  5LMN C;  3AF6 A;  4LFC C;  2KZF A;  4DR5 C;  4DV7 C;  1XMO C;  4JYA C;  2ASB A;  4MTN A;  3J81 D;  1FJG C;  4B3T C;  4X65 C;  2OPL B;  5A2Q D;  4LF8 C;  4OX9 C;  4DR7 C;  2PT7 G;  4YHH C;  2OPL A;  3R9X A;  4B3R C;  1J5E C;  4KHP C;  4XX2 A;  2E8C A;  4BSZ A;  2YCB A;  4JI3 C;  4X62 C;  4DV6 C;  1HH2 P;  1LQL A;  5IWA C;  4GKJ C;  4YY3 C;  2VQF C;  1KKG A;  4DR4 C;  4DCS A;  1XNQ C;  3AF5 A;  4DV1 C;  4LF6 C;  3J7A D;  4JI4 C;  4MH4 A;  3CJE A;  1QWI A;  5IT9 D;  2JMP A;  2PN2 A;  4DUY C;  4LFA C;  4JI7 C;  4DV2 C;  1PA4 A;  4DUZ C;  1N32 C;  1USP B;  1L2F A;  1N33 C;  3GKU A;  1USP A;  2CXC A;  2E7G A; 
#chains in the Genus database with same CATH topology
 1XS3 A;  4LF9 C;  4BC7 A;  4RLF A;  1P7L A;  2P2B A;  2QVZ X;  2D1S A;  3IEV A;  1V60 A;  4R1L A;  5K8F A;  5BR8 C;  4DV3 C;  4DG9 A;  2UXD C;  4I9F A;  2ONF A;  2E0G A;  4BBY A;  5BUR A;  1N36 C;  4JI6 C;  2QL8 A;  1MXA A;  3FCE A;  4PZP A;  1V25 A;  4WS9 A;  1BA3 A;  4ZLP A;  1YGT A;  3A9V A;  4JI8 C;  3B7W A;  3TDE A;  3E7X A;  2Z51 A;  5BSM A;  4DV5 C;  1IBM C;  4L4Q A;  3E7W A;  4FTF A;  4R0M A;  5LMU C;  5BSR A;  4JI5 C;  2DHM A;  1N34 C;  1P4E A;  3T1Y C;  1PG4 A;  1ZB9 A;  2P2F A;  4RMN A;  3CW8 X;  5FLX D;  2ZTB A;  2UU9 C;  3O2E A;  4G37 A;  1VEH A;  3I07 A;  5A19 A;  4KTV A;  2E8F A;  2BJO A;  3FM7 A;  2CY1 A;  2OBV A;  3VNS A;  3RV2 A;  3OTO C;  5JRH A;  2E8E A;  4LFC C;  4DR5 C;  2MMA B;  4JYA C;  3ETO A;  4FUQ A;  2OPL B;  4LF8 C;  1O93 A;  2OPL A;  3NI2 A;  3LNO A;  1J5E C;  5LCI A;  2DPL A;  1HH2 P;  3UX2 A;  3EQ6 A;  2VQF C;  1KKG A;  3KXW A;  1TH5 A;  3J7A D;  3A26 A;  4DUZ C;  2NCL A;  1MXC A;  4WV3 A;  2P20 A;  3PBK A;  4KTT A;  4NDN A;  4X64 C;  4D56 A;  2YX1 A;  2D7V A;  1AMU A;  4ZJZ A;  4BC9 A;  1XRA A;  2EGT A;  2XR1 A;  4LF5 C;  1K0R A;  2AYA A;  2P2Q A;  2PG1 E;  2OO4 A;  4EAT A;  1PG3 A;  1VLA A;  2KDN A;  4GXQ A;  4DR1 C;  4NXN C;  3T1H C;  2MCQ A;  4DCT A;  2WP0 C;  1IB8 A;  2F4V C;  3UX3 A;  4RM3 A;  4BCA A;  2ZZN A;  4G36 A;  4DR2 C;  2QVX X;  3L95 X;  4NOZ A;  4TPS B;  3GR1 A;  3IML A;  3PES A;  2Y4N A;  2D1T A;  2UUB C;  2VSQ A;  1XDX A;  3R9W A;  2ZM6 C;  3VNR A;  4OYC A;  3DHV A;  1M6X C;  3NYR A;  4PUG A;  3GR0 A;  3S82 A;  5BSW A;  5E7Q A;  4DCV A;  2DYJ A;  2UUA C;  4ODJ A;  4HPV A;  4DV0 C;  4PRO C;  2HHH C;  3EER A;  5LMN C;  2KZF A;  4JM1 A;  4DV7 C;  1XMO C;  3TR3 A;  5ADZ A;  2ASB A;  4X65 C;  2PT7 G;  3VNQ A;  4BSZ A;  4L7I A;  2Y27 A;  4GXR A;  4JI3 C;  4DV6 C;  1MDB A;  1O92 A;  5BSU A;  5IWA C;  4ISB A;  1RG9 A;  3AF5 A;  2KZ0 A;  4RLQ A;  1QWI A;  3LGX A;  2PN2 A;  3UZ0 A;  4DUY C;  4DV2 C;  5H9U A;  1N32 C;  1N33 C;  3GKU A;  2JNV A;  2CXC A;  4PHT A;  2E7G A;  1UWD A;  1NY8 A;  1V26 A;  4X66 C;  4K0B A;  4AQY C;  4FUT A;  5BST A;  1FUG A;  2BH1 X;  4LF7 C;  3RG2 A;  4LF4 C;  1N2F A;  4IR7 A;  5CZX A;  1HNW C;  2MM9 A;  1HNZ C;  5A1I A;  2CU6 A;  2HJG A;  2UUC C;  2QVY X;  1O9T A;  5T8T A;  2M5O A;  5A1G A;  1YJ7 A;  2P2J A;  2UXC C;  1IBL C;  4D4I A;  3DLP X;  1I94 C;  4DR6 C;  5AE1 A;  4D57 A;  3I08 A;  3A4I A;  3LNV A;  3N54 B;  4L2Z A;  4GKK C;  3K6R A;  4JI1 C;  3FCC A;  2VQE C;  3NPD A;  1ML8 A;  4JI0 C;  4RVO A;  4DCU A;  4DV4 C;  4B3S C;  1HR0 C;  1O90 A;  2D1Q A;  3DAY A;  2ATW A;  1GPM A;  5CZV A;  3L8C A;  4B3M C;  1JOS A;  4RM2 A;  1IBK C;  2WD9 A;  3AF6 A;  3A25 A;  2D27 A;  4MTN A;  2D1R A;  4R1M A;  4DR7 C;  4YHH C;  5BSV A;  1MD9 A;  4XX2 A;  2YWB A;  2YCB A;  3C5E A;  4X62 C;  1LQL A;  1T5H X;  4GKJ C;  3AY0 A;  5GTD A;  1XNQ C;  4DV1 C;  4LF6 C;  3CJE A;  5IFI A;  4RVN A;  2D28 C;  2JMP A;  1RY2 A;  1P4E C;  3LAX A;  1USP B;  3CQ1 A;  1T5D X;  1USP A;  1M6X A;  1MXB A;  5AE3 A;  4PUI A;  4U5Y D;  5DV9 A;  4JI2 C;  1MKY A;  3G7S A;  1HNX C;  4DR3 C;  2QW0 X;  2Y4O A;  4G1I A;  1WF3 A;  1XRC A;  1MDF A;  2VZE A;  3UOW A;  3JAM D;  3N2Q A;  3ETC A;  1XNR C;  2E5L C;  3GPC A;  3IEU A;  2P02 A;  4GS5 A;  5T8S A;  4LFB C;  1EGA A;  1WH9 A;  1FLO A;  5KYT A;  4JV5 C;  1NYE A;  4D4G A;  1XMQ C;  5BUS A;  3CW9 A;  3UEB A;  5K85 A;  3LUS A;  4K0K C;  4NXM C;  1ZB8 A;  2UXB C;  1QM4 A;  3CQ3 A;  4I9G A;  1UKK A;  3J80 D;  4PUH A;  3PRO C;  3SO4 A;  5BUQ A;  3J81 D;  1FJG C;  4B3T C;  5A2Q D;  4OX9 C;  3R9X A;  3NYQ A;  2P2M A;  4B3R C;  4KHP C;  4LE5 A;  2E8C A;  1WCJ A;  1XRB A;  1PU1 A;  4IZ6 A;  3IPL A;  3H2T A;  3A9U A;  4YY3 C;  5AE2 A;  4DR4 C;  4DCS A;  5KYV A;  4JI4 C;  4MH4 A;  4DG8 A;  5IT9 D;  4LFA C;  3TUF A;  4JI7 C;  3R44 A;  1LCI A;  1PA4 A;  5KEI A;  3CQ2 A;  4OXI A;  1L2F A;  1XHJ A;  2YWC A;  1ULT A;  2M5H A;  2ZZM A;  2PRO A;  3TQI A;  2V7B A; 
#chains in the Genus database with same CATH homology
 4LF9 C;  4BC7 A;  4RLF A;  1P7L A;  2P2B A;  2QVZ X;  2D1S A;  3IEV A;  4DV3 C;  4R1L A;  5K8F A;  5BR8 C;  4DG9 A;  2UXD C;  4I9F A;  2ONF A;  2E0G A;  4BBY A;  5BUR A;  1N36 C;  4JI6 C;  2QL8 A;  1MXA A;  3FCE A;  4PZP A;  1V25 A;  4WS9 A;  1BA3 A;  4ZLP A;  3A9V A;  4JI8 C;  3B7W A;  3TDE A;  3E7X A;  5BSM A;  4DV5 C;  1IBM C;  4L4Q A;  3E7W A;  4FTF A;  4R0M A;  5LMU C;  5BSR A;  4JI5 C;  1N34 C;  3T1Y C;  1PG4 A;  1ZB9 A;  2P2F A;  4RMN A;  3CW8 X;  5FLX D;  2UU9 C;  4G37 A;  3I07 A;  5A19 A;  4KTV A;  2E8F A;  2BJO A;  2CY1 A;  2OBV A;  3VNS A;  3RV2 A;  3OTO C;  5JRH A;  2E8E A;  4LFC C;  4DR5 C;  4JYA C;  3ETO A;  4FUQ A;  2OPL B;  4LF8 C;  1O93 A;  2OPL A;  3NI2 A;  1J5E C;  2DPL A;  1HH2 P;  1KKG A;  2VQF C;  3EQ6 A;  3KXW A;  3J7A D;  4DUZ C;  1MXC A;  4WV3 A;  2P20 A;  3PBK A;  4KTT A;  4NDN A;  4X64 C;  4D56 A;  2D7V A;  1AMU A;  4ZJZ A;  4BC9 A;  1XRA A;  2EGT A;  2XR1 A;  4LF5 C;  1K0R A;  2AYA A;  2P2Q A;  2OO4 A;  4EAT A;  1PG3 A;  1VLA A;  4GXQ A;  4DR1 C;  4NXN C;  3T1H C;  4DCT A;  2WP0 C;  2F4V C;  4BCA A;  4RM3 A;  4G36 A;  4DR2 C;  2QVX X;  3L95 X;  4NOZ A;  4TPS B;  3GR1 A;  3IML A;  3PES A;  2Y4N A;  2D1T A;  2UUB C;  2VSQ A;  3R9W A;  2ZM6 C;  3VNR A;  4OYC A;  3DHV A;  3NYR A;  3GR0 A;  3S82 A;  5BSW A;  5E7Q A;  4DCV A;  2DYJ A;  2UUA C;  4ODJ A;  4HPV A;  4DV0 C;  4PRO C;  2HHH C;  3EER A;  5LMN C;  2KZF A;  4JM1 A;  4DV7 C;  1XMO C;  2ASB A;  5ADZ A;  4X65 C;  2PT7 G;  3VNQ A;  4BSZ A;  4L7I A;  2Y27 A;  4GXR A;  4JI3 C;  4DV6 C;  1MDB A;  1O92 A;  5BSU A;  5IWA C;  4ISB A;  1RG9 A;  3AF5 A;  4RLQ A;  1QWI A;  3LGX A;  2PN2 A;  3UZ0 A;  4DUY C;  4DV2 C;  5H9U A;  1N32 C;  1N33 C;  3GKU A;  2CXC A;  4PHT A;  2E7G A;  1V26 A;  4X66 C;  4K0B A;  4AQY C;  4FUT A;  5BST A;  1FUG A;  2BH1 X;  4LF7 C;  3RG2 A;  4LF4 C;  1N2F A;  4IR7 A;  5CZX A;  1HNW C;  1HNZ C;  5A1I A;  2HJG A;  2UUC C;  2QVY X;  1O9T A;  5T8T A;  5A1G A;  1YJ7 A;  2P2J A;  2UXC C;  1IBL C;  4D4I A;  3DLP X;  1I94 C;  4DR6 C;  5AE1 A;  4D57 A;  3I08 A;  3A4I A;  3LNV A;  3N54 B;  4L2Z A;  4GKK C;  4JI1 C;  3FCC A;  2VQE C;  3NPD A;  1ML8 A;  4JI0 C;  4RVO A;  4DCU A;  4DV4 C;  4B3S C;  1HR0 C;  1O90 A;  2D1Q A;  3DAY A;  2ATW A;  1GPM A;  5CZV A;  3L8C A;  4B3M C;  1JOS A;  4RM2 A;  1IBK C;  2WD9 A;  3AF6 A;  2D27 A;  4MTN A;  2D1R A;  4R1M A;  4DR7 C;  4YHH C;  5BSV A;  1MD9 A;  4XX2 A;  2YWB A;  2YCB A;  3C5E A;  4X62 C;  1LQL A;  1T5H X;  4GKJ C;  5GTD A;  1XNQ C;  4DV1 C;  4LF6 C;  3CJE A;  5IFI A;  4RVN A;  2D28 C;  2JMP A;  1RY2 A;  3LAX A;  1USP B;  1T5D X;  1USP A;  1MXB A;  5AE3 A;  4U5Y D;  5DV9 A;  4JI2 C;  1MKY A;  3G7S A;  1HNX C;  4DR3 C;  2QW0 X;  2Y4O A;  4G1I A;  1WF3 A;  1XRC A;  1MDF A;  2VZE A;  3UOW A;  3JAM D;  3N2Q A;  3ETC A;  1XNR C;  2E5L C;  3GPC A;  3IEU A;  2P02 A;  4GS5 A;  5T8S A;  4LFB C;  1EGA A;  1WH9 A;  5KYT A;  4JV5 C;  1NYE A;  4D4G A;  1XMQ C;  5BUS A;  3CW9 A;  5K85 A;  3LUS A;  4K0K C;  4NXM C;  1ZB8 A;  2UXB C;  1QM4 A;  4I9G A;  1UKK A;  3J80 D;  3PRO C;  3SO4 A;  5BUQ A;  3J81 D;  1FJG C;  4B3T C;  5A2Q D;  4OX9 C;  3R9X A;  3NYQ A;  2P2M A;  4B3R C;  4KHP C;  4LE5 A;  2E8C A;  1XRB A;  4IZ6 A;  3IPL A;  3H2T A;  3A9U A;  4YY3 C;  5AE2 A;  4DR4 C;  4DCS A;  5KYV A;  4JI4 C;  4MH4 A;  4DG8 A;  5IT9 D;  4LFA C;  3TUF A;  4JI7 C;  3R44 A;  1LCI A;  1PA4 A;  5KEI A;  4OXI A;  1L2F A;  2YWC A;  1ULT A;  2PRO A;  3TQI A;  2V7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...