3J81D

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
223
structure length
223
Chain Sequence
AIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRATKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHSGQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKALPDAVTIIEPKEEEPVLEPSVKDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 47
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
D PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3j81D01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3j81D02
2PN2A 4OX9C 4B3MC 4DR5C 1J5EC 4LF6C 1N2FA 3R9XA 4DCUA 4DCSA 3AF6A 1HNZC 2ONFA 4YHHC 2UXBC 4YY3C 1K0RA 4X64C 2E5LC 2ZM6C 4B3TC 1N34C 4LFCC 4X65C 4DUZC 1HH2P 4DV0C 4JV5C 4JI5C 3T1YC 4KHPC 3J80D 4DR3C 4AQYC 4XX2A 4DV6C 4K0KC 1ML8A 2ATWA 1WF3A 1N33C 4X66C 1PA4A 4MH4A 2E8FA 2PT7G 4JYAC 2UUCC 4DV2C 1KKGA 1L2FA 5A2QD 1IBKC 2ASBA 4BSZA 3CJEA 1ZB8A 4JI4C 5LMNC 2DYJA 1JOSA 4MTNA 1HNXC 1WH9A 2VQEC 3GKUA 3LUSA 1UKKA 1USPA 3EERA 4X62C 4NOZA 4JI3C 4NXMC 4LF4C 5BR8C 4DUYC 3T1HC 1XNQC 2UU9C 4GKKC 2VQFC 1HNWC 4JI2C 3IEUA 4NXNC 2CXCA 4JI6C 1XNRC 4DV3C 3JAMD 4GKJC 5IT9D 2BJOA 1XMQC 2HJGA 2E8CA 2JMPA 2CY1A 1USPB 4JI0C 2OPLA 4DR4C 1MKYA 4DV7C 4DR2C 1ZB9A 2KZFA 5FLXD 2F4VC 2HHHC 5IWAC 4DV5C 4LF7C 4DR1C 1XMOC 4DR6C 4JI8C 2UXCC 3R9WA 2QL8A 1N36C 3J7AD 3OTOC 4LF9C 4B3RC 3IEVA 1QWIA 2YCBA 4DV1C 1I94C 4JI1C 3AF5A 3J81D 2UUAC 2D7VA 2XR1A 4LFAC 2UUBC 1FJGC 4DR7C 1HR0C 2OPLB 2EGTA 4JI7C 2E7GA 1LQLA 4DV4C 4LF8C 4LFBC 1N32C 4DCTA 3I07A 4B3SC 5LMUC 2UXDC 1IBLC 1EGAA 1NYEA 2E8EA 1VLAA 4LF5C 1IBMC 4DCVA
chains in the Genus database with same CATH superfamily
2YWCA 4R1MA 1YJ7A 4DR5C 4LF6C 3R9XA 4TPSB 4ZLPA 2PROA 5BSMA 3VNQA 2E0GA 1HNZC 3A4IA 4U5YD 4X64C 3C5EA 1N34C 3IPLA 4DV0C 4L2ZA 1PG4A 3TQIA 3J80D 4XX2A 2P02A 3UX2A 4RVNA 5KEIA 2D27A 3B7WA 5AE2A 4MH4A 1ULTA 4DV2C 4IZ6A 3VNSA 4BC7A 1L2FA 5A2QD 2P2FA 2YX1A 2QVYX 1ZB8A 5LMNC 3N2QA 4PUGA 2CU6A 1P4EA 4MTNA 2ZZMA 2VQEC 2QVZX 2M5HA 3LUSA 4ZJZA 1USPA 2ZTBA 4JI3C 4LF4C 5JRHA 3T1HC 3A26A 2UU9C 3FM7A 4GKKC 4K0BA 2CXCA 4JI6C 1XNRC 4D56A 4DV3C 3PROC 2MM9A 3R44A 4GXRA 3LAXA 3FCCA 4DR2C 1ZB9A 1XMOC 4JI8C 2UXCC 4RLFA 1XHJA 3A9UA 3J7AD 5KYVA 4B3RC 3EQ6A 2YCBA 3CW8X 4DV1C 4G1IA 2D7VA 4FUTA 4LFAC 5K8FA 3I07A 3KXWA 4I9GA 4FUQA 1VLAA 4HPVA 1YGTA 5ADZA 1IBMC 3E7WA 4DG9A 4B3MC 4JM1A 3AF6A 2ONFA 1K0RA 3LNOA 2ZM6C 4DUZC 1HH2P 1WCJA 4R0MA 1O93A 3T1YC 5A1GA 1RG9A 5AE3A 3CQ1A 3NI2A 2P2BA 5T8TA 4GS5A 1ML8A 1N33C 1MDFA 3G7SA 3L8CA 5H9UA 2E8FA 1VEHA 4L7IA 2P2MA 2D1QA 2ASBA 5BSWA 4BSZA 3CJEA 5T8SA 5BSVA 1HNXC 2Y27A 3PESA 3NPDA 2BH1X 4G37A 3FCEA 3EERA 3GR0A 5BSRA 4NOZA 3TUFA 4NXMC 1BA3A 3E7XA 1M6XA 2MCQA 4DUYC 1XNQC 3ETOA 1HNWC 2OBVA 3AY0A 4D4IA 5BUQA 3JAMD 2BJOA 3SO4A 3A25A 3CW9A 2JMPA 2PG1E 4DR4C 1MKYA 5K85A 1M6XC 4DR1C 4DR6C 1XS3A 4PHTA 3IEVA 1I94C 4JI1C 4BCAA 3J81D 3GR1A 4RMNA 1HR0C 2OPLB 2E7GA 4NDNA 1AMUA 3CQ2A 1N32C 4DCTA 4B3SC 3UZ0A 2NCLA 1NYEA 2D1TA 3R9WA 3LNVA 5A1IA 2PN2A 4OX9C 4EATA 2Y4OA 1TH5A 1N2FA 2ZZNA 2JNVA 4YY3C 4PZPA 3I08A 4RM2A 3TR3A 3UOWA 4B3TC 2Z51A 4X65C 2OO4A 4PROC 3UX3A 4KHPC 4DR3C 4AQYC 4G36A 1NY8A 2QVXX 3L95X 5BSTA 2AYAA 5A19A 5BUSA 2MMAB 1MDBA 1PA4A 3GPCA 4D57A 1KKGA 2UUCC 4BBYA 1IBKC 3DHVA 5CZXA 2DYJA 3UEBA 1WH9A 3LGXA 3GKUA 1UKKA 1XDXA 5DV9A 4X62C 4OYCA 3DLPX 5BSUA 2WP0C 3PBKA 4ISBA 1T5DX 4JI2C 1V26A 3IEUA 5GTDA 4R1LA 4GKJC 1XMQC 5KYTA 2P20A 2HJGA 1IB8A 3VNRA 2CY1A 1XRCA 4JI0C 2OPLA 4KTTA 4DV7C 5AE1A 2KZFA 1LCIA 4OXIA 2HHHC 4L4QA 3RG2A 2M5OA 2V7BA 3IMLA 4LF9C 3ETCA 1QWIA 1T5HX 1QM4A 1O90A 1V25A 1P7LA 2UUAC 1UWDA 5CZVA 2P2QA 4DR7C 2DHMA 2EGTA 1LQLA 3TDEA 4LF8C 4LFBC 1FLOA 2UXDC 2YWBA 2E8EA 4RM3A 4DCVA 1PU1A 2WD9A 3DAYA 2VZEA 1PG3A 1J5EC 3N54B 3K6RA 4DCUA 4DCSA 4YHHC 2UXBC 2KDNA 2E5LC 4LFCC 3H2TA 2VSQA 4JV5C 4JI5C 4D4GA 4BC9A 4DV6C 4K0KC 3S82A 2ATWA 1WF3A 1O9TA 4I9FA 2P2JA 2QW0X 2D28C 4X66C 4ODJA 4DG8A 3O2EA 2PT7G 4JYAC 1P4EC 1MXAA 4JI4C 4GXQA 2DPLA 1JOSA 5IFIA 1RY2A 3NYRA 1XRAA 4LE5A 1MXBA 1FUGA 3RV2A 1O92A 1XRBA 5E7QA 5BR8C 2D1SA 2VQFC 3CQ3A 4NXNC 2Y4NA 5IT9D 2KZ0A 4WV3A 3NYQA 2E8CA 5LCIA 1USPB 5FLXD 2F4VC 5IWAC 4DV5C 4LF7C 4IR7A 4FTFA 2QL8A 3A9VA 1N36C 3OTOC 2D1RA 1MXCA 4WS9A 3AF5A 4RVOA 2XR1A 1FJGC 2UUBC 5BURA 4JI7C 4DV4C 4KTVA 5LMUC 4PUIA 1GPMA 1IBLC 1EGAA 4RLQA 4LF5C 1MD9A 1V60A 4PUHA
chains in the Genus database with same CATH topology
2YWCA 4R1MA 1YJ7A 4DR5C 4LF6C 3R9XA 4TPSB 4ZLPA 2PROA 5BSMA 3VNQA 2E0GA 1HNZC 3A4IA 4U5YD 4X64C 3C5EA 1N34C 3IPLA 4DV0C 4L2ZA 1PG4A 3TQIA 3J80D 4XX2A 2P02A 4RVNA 5KEIA 2D27A 3B7WA 5AE2A 4MH4A 1ULTA 4DV2C 4IZ6A 3VNSA 4BC7A 1L2FA 5A2QD 2P2FA 2QVYX 1ZB8A 5LMNC 3N2QA 4MTNA 2VQEC 2QVZX 3LUSA 4ZJZA 1USPA 4JI3C 4LF4C 5JRHA 3T1HC 2UU9C 4GKKC 4K0BA 2CXCA 4JI6C 1XNRC 4D56A 4DV3C 3PROC 3R44A 4GXRA 3LAXA 3FCCA 4DR2C 1ZB9A 1XMOC 4JI8C 2UXCC 4RLFA 3A9UA 3J7AD 5KYVA 4B3RC 3EQ6A 2YCBA 3CW8X 4DV1C 4G1IA 2D7VA 4FUTA 4LFAC 5K8FA 3I07A 3KXWA 4I9GA 4FUQA 1VLAA 4HPVA 5ADZA 1IBMC 3E7WA 4DG9A 4B3MC 4JM1A 3AF6A 2ONFA 1K0RA 2ZM6C 4DUZC 1HH2P 4R0MA 1O93A 3T1YC 5A1GA 1RG9A 5AE3A 3NI2A 2P2BA 5T8TA 4GS5A 1ML8A 1N33C 1MDFA 3G7SA 3L8CA 5H9UA 2E8FA 4L7IA 2P2MA 2D1QA 2ASBA 5BSWA 4BSZA 3CJEA 5T8SA 5BSVA 1HNXC 2Y27A 3PESA 3NPDA 2BH1X 4G37A 3FCEA 3EERA 3GR0A 5BSRA 4NOZA 3TUFA 4NXMC 1BA3A 3E7XA 4DUYC 1XNQC 3ETOA 1HNWC 2OBVA 4D4IA 5BUQA 3JAMD 2BJOA 3SO4A 3CW9A 2JMPA 4DR4C 1MKYA 5K85A 4DR1C 4DR6C 4PHTA 3IEVA 1I94C 4JI1C 4BCAA 3J81D 3GR1A 4RMNA 1HR0C 2OPLB 2E7GA 4NDNA 1AMUA 1N32C 4DCTA 4B3SC 3UZ0A 1NYEA 2D1TA 3R9WA 3LNVA 5A1IA 2PN2A 4OX9C 4EATA 2Y4OA 1N2FA 4YY3C 4PZPA 3I08A 4RM2A 3UOWA 4B3TC 4X65C 2OO4A 4PROC 4KHPC 4DR3C 4AQYC 4G36A 2QVXX 3L95X 5BSTA 2AYAA 5A19A 5BUSA 1MDBA 1PA4A 3GPCA 4D57A 1KKGA 2UUCC 4BBYA 1IBKC 3DHVA 5CZXA 2DYJA 1WH9A 3LGXA 3GKUA 1UKKA 5DV9A 4X62C 4OYCA 3DLPX 5BSUA 2WP0C 3PBKA 4ISBA 1T5DX 4JI2C 1V26A 3IEUA 5GTDA 4R1LA 4GKJC 1XMQC 5KYTA 2P20A 2HJGA 3VNRA 2CY1A 1XRCA 4JI0C 2OPLA 4KTTA 4DV7C 5AE1A 2KZFA 1LCIA 4OXIA 2HHHC 4L4QA 3RG2A 2V7BA 3IMLA 4LF9C 3ETCA 1QWIA 1T5HX 1QM4A 1O90A 1V25A 1P7LA 2UUAC 5CZVA 2P2QA 4DR7C 2EGTA 1LQLA 3TDEA 4LF8C 4LFBC 2UXDC 2YWBA 2E8EA 4RM3A 4DCVA 2WD9A 3DAYA 2VZEA 1PG3A 1J5EC 3N54B 4DCUA 4DCSA 4YHHC 2UXBC 2E5LC 4LFCC 3H2TA 2VSQA 4JV5C 4JI5C 4D4GA 4BC9A 4DV6C 4K0KC 3S82A 2ATWA 1WF3A 1O9TA 4I9FA 2P2JA 2QW0X 2D28C 4X66C 4ODJA 4DG8A 2PT7G 4JYAC 1MXAA 4JI4C 4GXQA 2DPLA 1JOSA 5IFIA 1RY2A 3NYRA 1XRAA 4LE5A 1MXBA 1FUGA 3RV2A 1O92A 1XRBA 5E7QA 5BR8C 2D1SA 2VQFC 4NXNC 2Y4NA 5IT9D 4WV3A 3NYQA 2E8CA 1USPB 5FLXD 2F4VC 5IWAC 4DV5C 4LF7C 4IR7A 4FTFA 2QL8A 3A9VA 1N36C 3OTOC 2D1RA 1MXCA 4WS9A 3AF5A 4RVOA 2XR1A 1FJGC 2UUBC 5BURA 4JI7C 4DV4C 4KTVA 5LMUC 1GPMA 1IBLC 1EGAA 4RLQA 4LF5C 1MD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PN2 A;  4OX9 C;  4B3M C;  4DR5 C;  1J5E C;  4LF6 C;  1N2F A;  3R9X A;  4DCU A;  4DCS A;  3AF6 A;  1HNZ C;  2ONF A;  4YHH C;  2UXB C;  4YY3 C;  1K0R A;  4X64 C;  2E5L C;  2ZM6 C;  4B3T C;  1N34 C;  4LFC C;  4X65 C;  4DUZ C;  1HH2 P;  4DV0 C;  4JV5 C;  4JI5 C;  3T1Y C;  4KHP C;  3J80 D;  4DR3 C;  4AQY C;  4XX2 A;  4DV6 C;  4K0K C;  1ML8 A;  2ATW A;  1WF3 A;  1N33 C;  4X66 C;  1PA4 A;  4MH4 A;  2E8F A;  2PT7 G;  4JYA C;  2UUC C;  4DV2 C;  1KKG A;  1L2F A;  5A2Q D;  1IBK C;  2ASB A;  4BSZ A;  3CJE A;  1ZB8 A;  4JI4 C;  5LMN C;  2DYJ A;  1JOS A;  4MTN A;  1HNX C;  1WH9 A;  2VQE C;  3GKU A;  3LUS A;  1UKK A;  1USP A;  3EER A;  4X62 C;  4NOZ A;  4JI3 C;  4NXM C;  4LF4 C;  5BR8 C;  4DUY C;  3T1H C;  1XNQ C;  2UU9 C;  4GKK C;  2VQF C;  1HNW C;  4JI2 C;  3IEU A;  4NXN C;  2CXC A;  4JI6 C;  1XNR C;  4DV3 C;  3JAM D;  4GKJ C;  5IT9 D;  2BJO A;  1XMQ C;  2HJG A;  2E8C A;  2JMP A;  2CY1 A;  1USP B;  4JI0 C;  2OPL A;  4DR4 C;  1MKY A;  4DV7 C;  4DR2 C;  1ZB9 A;  2KZF A;  5FLX D;  2F4V C;  2HHH C;  5IWA C;  4DV5 C;  4LF7 C;  4DR1 C;  1XMO C;  4DR6 C;  4JI8 C;  2UXC C;  3R9W A;  2QL8 A;  1N36 C;  3J7A D;  3OTO C;  4LF9 C;  4B3R C;  3IEV A;  1QWI A;  2YCB A;  4DV1 C;  1I94 C;  4JI1 C;  3AF5 A;  3J81 D;  2UUA C;  2D7V A;  2XR1 A;  4LFA C;  2UUB C;  1FJG C;  4DR7 C;  1HR0 C;  2OPL B;  2EGT A;  4JI7 C;  2E7G A;  1LQL A;  4DV4 C;  4LF8 C;  4LFB C;  1N32 C;  4DCT A;  3I07 A;  4B3S C;  5LMU C;  2UXD C;  1IBL C;  1EGA A;  1NYE A;  2E8E A;  1VLA A;  4LF5 C;  1IBM C;  4DCV A; 
#chains in the Genus database with same CATH topology
 2YWC A;  4R1M A;  1YJ7 A;  4DR5 C;  4LF6 C;  3R9X A;  4TPS B;  4ZLP A;  2PRO A;  5BSM A;  3VNQ A;  2E0G A;  1HNZ C;  3A4I A;  4U5Y D;  4X64 C;  3C5E A;  1N34 C;  3IPL A;  4DV0 C;  4L2Z A;  1PG4 A;  3TQI A;  3J80 D;  4XX2 A;  2P02 A;  3UX2 A;  4RVN A;  5KEI A;  2D27 A;  3B7W A;  5AE2 A;  4MH4 A;  1ULT A;  4DV2 C;  4IZ6 A;  3VNS A;  4BC7 A;  1L2F A;  5A2Q D;  2P2F A;  2YX1 A;  2QVY X;  1ZB8 A;  5LMN C;  3N2Q A;  4PUG A;  2CU6 A;  1P4E A;  4MTN A;  2ZZM A;  2VQE C;  2QVZ X;  2M5H A;  3LUS A;  4ZJZ A;  1USP A;  2ZTB A;  4JI3 C;  4LF4 C;  5JRH A;  3T1H C;  3A26 A;  2UU9 C;  3FM7 A;  4GKK C;  4K0B A;  2CXC A;  4JI6 C;  1XNR C;  4D56 A;  4DV3 C;  3PRO C;  2MM9 A;  3R44 A;  4GXR A;  3LAX A;  3FCC A;  4DR2 C;  1ZB9 A;  1XMO C;  4JI8 C;  2UXC C;  4RLF A;  1XHJ A;  3A9U A;  3J7A D;  5KYV A;  4B3R C;  3EQ6 A;  2YCB A;  3CW8 X;  4DV1 C;  4G1I A;  2D7V A;  4FUT A;  4LFA C;  5K8F A;  3I07 A;  3KXW A;  4I9G A;  4FUQ A;  1VLA A;  4HPV A;  1YGT A;  5ADZ A;  1IBM C;  3E7W A;  4DG9 A;  4B3M C;  4JM1 A;  3AF6 A;  2ONF A;  1K0R A;  3LNO A;  2ZM6 C;  4DUZ C;  1HH2 P;  1WCJ A;  4R0M A;  1O93 A;  3T1Y C;  5A1G A;  1RG9 A;  5AE3 A;  3CQ1 A;  3NI2 A;  2P2B A;  5T8T A;  4GS5 A;  1ML8 A;  1N33 C;  1MDF A;  3G7S A;  3L8C A;  5H9U A;  2E8F A;  1VEH A;  4L7I A;  2P2M A;  2D1Q A;  2ASB A;  5BSW A;  4BSZ A;  3CJE A;  5T8S A;  5BSV A;  1HNX C;  2Y27 A;  3PES A;  3NPD A;  2BH1 X;  4G37 A;  3FCE A;  3EER A;  3GR0 A;  5BSR A;  4NOZ A;  3TUF A;  4NXM C;  1BA3 A;  3E7X A;  1M6X A;  2MCQ A;  4DUY C;  1XNQ C;  3ETO A;  1HNW C;  2OBV A;  3AY0 A;  4D4I A;  5BUQ A;  3JAM D;  2BJO A;  3SO4 A;  3A25 A;  3CW9 A;  2JMP A;  2PG1 E;  4DR4 C;  1MKY A;  5K85 A;  1M6X C;  4DR1 C;  4DR6 C;  1XS3 A;  4PHT A;  3IEV A;  1I94 C;  4JI1 C;  4BCA A;  3J81 D;  3GR1 A;  4RMN A;  1HR0 C;  2OPL B;  2E7G A;  4NDN A;  1AMU A;  3CQ2 A;  1N32 C;  4DCT A;  4B3S C;  3UZ0 A;  2NCL A;  1NYE A;  2D1T A;  3R9W A;  3LNV A;  5A1I A;  2PN2 A;  4OX9 C;  4EAT A;  2Y4O A;  1TH5 A;  1N2F A;  2ZZN A;  2JNV A;  4YY3 C;  4PZP A;  3I08 A;  4RM2 A;  3TR3 A;  3UOW A;  4B3T C;  2Z51 A;  4X65 C;  2OO4 A;  4PRO C;  3UX3 A;  4KHP C;  4DR3 C;  4AQY C;  4G36 A;  1NY8 A;  2QVX X;  3L95 X;  5BST A;  2AYA A;  5A19 A;  5BUS A;  2MMA B;  1MDB A;  1PA4 A;  3GPC A;  4D57 A;  1KKG A;  2UUC C;  4BBY A;  1IBK C;  3DHV A;  5CZX A;  2DYJ A;  3UEB A;  1WH9 A;  3LGX A;  3GKU A;  1UKK A;  1XDX A;  5DV9 A;  4X62 C;  4OYC A;  3DLP X;  5BSU A;  2WP0 C;  3PBK A;  4ISB A;  1T5D X;  4JI2 C;  1V26 A;  3IEU A;  5GTD A;  4R1L A;  4GKJ C;  1XMQ C;  5KYT A;  2P20 A;  2HJG A;  1IB8 A;  3VNR A;  2CY1 A;  1XRC A;  4JI0 C;  2OPL A;  4KTT A;  4DV7 C;  5AE1 A;  2KZF A;  1LCI A;  4OXI A;  2HHH C;  4L4Q A;  3RG2 A;  2M5O A;  2V7B A;  3IML A;  4LF9 C;  3ETC A;  1QWI A;  1T5H X;  1QM4 A;  1O90 A;  1V25 A;  1P7L A;  2UUA C;  1UWD A;  5CZV A;  2P2Q A;  4DR7 C;  2DHM A;  2EGT A;  1LQL A;  3TDE A;  4LF8 C;  4LFB C;  1FLO A;  2UXD C;  2YWB A;  2E8E A;  4RM3 A;  4DCV A;  1PU1 A;  2WD9 A;  3DAY A;  2VZE A;  1PG3 A;  1J5E C;  3N54 B;  3K6R A;  4DCU A;  4DCS A;  4YHH C;  2UXB C;  2KDN A;  2E5L C;  4LFC C;  3H2T A;  2VSQ A;  4JV5 C;  4JI5 C;  4D4G A;  4BC9 A;  4DV6 C;  4K0K C;  3S82 A;  2ATW A;  1WF3 A;  1O9T A;  4I9F A;  2P2J A;  2QW0 X;  2D28 C;  4X66 C;  4ODJ A;  4DG8 A;  3O2E A;  2PT7 G;  4JYA C;  1P4E C;  1MXA A;  4JI4 C;  4GXQ A;  2DPL A;  1JOS A;  5IFI A;  1RY2 A;  3NYR A;  1XRA A;  4LE5 A;  1MXB A;  1FUG A;  3RV2 A;  1O92 A;  1XRB A;  5E7Q A;  5BR8 C;  2D1S A;  2VQF C;  3CQ3 A;  4NXN C;  2Y4N A;  5IT9 D;  2KZ0 A;  4WV3 A;  3NYQ A;  2E8C A;  5LCI A;  1USP B;  5FLX D;  2F4V C;  5IWA C;  4DV5 C;  4LF7 C;  4IR7 A;  4FTF A;  2QL8 A;  3A9V A;  1N36 C;  3OTO C;  2D1R A;  1MXC A;  4WS9 A;  3AF5 A;  4RVO A;  2XR1 A;  1FJG C;  2UUB C;  5BUR A;  4JI7 C;  4DV4 C;  4KTV A;  5LMU C;  4PUI A;  1GPM A;  1IBL C;  1EGA A;  4RLQ A;  4LF5 C;  1MD9 A;  1V60 A;  4PUH A; 
#chains in the Genus database with same CATH homology
 2YWC A;  4R1M A;  1YJ7 A;  4DR5 C;  4LF6 C;  3R9X A;  4TPS B;  4ZLP A;  2PRO A;  5BSM A;  3VNQ A;  2E0G A;  1HNZ C;  3A4I A;  4U5Y D;  4X64 C;  3C5E A;  1N34 C;  3IPL A;  4DV0 C;  4L2Z A;  1PG4 A;  3TQI A;  3J80 D;  4XX2 A;  2P02 A;  4RVN A;  5KEI A;  2D27 A;  3B7W A;  5AE2 A;  4MH4 A;  1ULT A;  4DV2 C;  4IZ6 A;  3VNS A;  4BC7 A;  1L2F A;  5A2Q D;  2P2F A;  2QVY X;  1ZB8 A;  5LMN C;  3N2Q A;  4MTN A;  2VQE C;  2QVZ X;  3LUS A;  4ZJZ A;  1USP A;  4JI3 C;  4LF4 C;  5JRH A;  3T1H C;  2UU9 C;  4GKK C;  4K0B A;  2CXC A;  4JI6 C;  1XNR C;  4D56 A;  4DV3 C;  3PRO C;  3R44 A;  4GXR A;  3LAX A;  3FCC A;  4DR2 C;  1ZB9 A;  1XMO C;  4JI8 C;  2UXC C;  4RLF A;  3A9U A;  3J7A D;  5KYV A;  4B3R C;  3EQ6 A;  2YCB A;  3CW8 X;  4DV1 C;  4G1I A;  2D7V A;  4FUT A;  4LFA C;  5K8F A;  3I07 A;  3KXW A;  4I9G A;  4FUQ A;  1VLA A;  4HPV A;  5ADZ A;  1IBM C;  3E7W A;  4DG9 A;  4B3M C;  4JM1 A;  3AF6 A;  2ONF A;  1K0R A;  2ZM6 C;  4DUZ C;  1HH2 P;  4R0M A;  1O93 A;  3T1Y C;  5A1G A;  1RG9 A;  5AE3 A;  3NI2 A;  2P2B A;  5T8T A;  4GS5 A;  1ML8 A;  1N33 C;  1MDF A;  3G7S A;  3L8C A;  5H9U A;  2E8F A;  4L7I A;  2P2M A;  2D1Q A;  2ASB A;  5BSW A;  4BSZ A;  3CJE A;  5T8S A;  5BSV A;  1HNX C;  2Y27 A;  3PES A;  3NPD A;  2BH1 X;  4G37 A;  3FCE A;  3EER A;  3GR0 A;  5BSR A;  4NOZ A;  3TUF A;  4NXM C;  1BA3 A;  3E7X A;  4DUY C;  1XNQ C;  3ETO A;  1HNW C;  2OBV A;  4D4I A;  5BUQ A;  3JAM D;  2BJO A;  3SO4 A;  3CW9 A;  2JMP A;  4DR4 C;  1MKY A;  5K85 A;  4DR1 C;  4DR6 C;  4PHT A;  3IEV A;  1I94 C;  4JI1 C;  4BCA A;  3J81 D;  3GR1 A;  4RMN A;  1HR0 C;  2OPL B;  2E7G A;  4NDN A;  1AMU A;  1N32 C;  4DCT A;  4B3S C;  3UZ0 A;  1NYE A;  2D1T A;  3R9W A;  3LNV A;  5A1I A;  2PN2 A;  4OX9 C;  4EAT A;  2Y4O A;  1N2F A;  4YY3 C;  4PZP A;  3I08 A;  4RM2 A;  3UOW A;  4B3T C;  4X65 C;  2OO4 A;  4PRO C;  4KHP C;  4DR3 C;  4AQY C;  4G36 A;  2QVX X;  3L95 X;  5BST A;  2AYA A;  5A19 A;  5BUS A;  1MDB A;  1PA4 A;  3GPC A;  4D57 A;  1KKG A;  2UUC C;  4BBY A;  1IBK C;  3DHV A;  5CZX A;  2DYJ A;  1WH9 A;  3LGX A;  3GKU A;  1UKK A;  5DV9 A;  4X62 C;  4OYC A;  3DLP X;  5BSU A;  2WP0 C;  3PBK A;  4ISB A;  1T5D X;  4JI2 C;  1V26 A;  3IEU A;  5GTD A;  4R1L A;  4GKJ C;  1XMQ C;  5KYT A;  2P20 A;  2HJG A;  3VNR A;  2CY1 A;  1XRC A;  4JI0 C;  2OPL A;  4KTT A;  4DV7 C;  5AE1 A;  2KZF A;  1LCI A;  4OXI A;  2HHH C;  4L4Q A;  3RG2 A;  2V7B A;  3IML A;  4LF9 C;  3ETC A;  1QWI A;  1T5H X;  1QM4 A;  1O90 A;  1V25 A;  1P7L A;  2UUA C;  5CZV A;  2P2Q A;  4DR7 C;  2EGT A;  1LQL A;  3TDE A;  4LF8 C;  4LFB C;  2UXD C;  2YWB A;  2E8E A;  4RM3 A;  4DCV A;  2WD9 A;  3DAY A;  2VZE A;  1PG3 A;  1J5E C;  3N54 B;  4DCU A;  4DCS A;  4YHH C;  2UXB C;  2E5L C;  4LFC C;  3H2T A;  2VSQ A;  4JV5 C;  4JI5 C;  4D4G A;  4BC9 A;  4DV6 C;  4K0K C;  3S82 A;  2ATW A;  1WF3 A;  1O9T A;  4I9F A;  2P2J A;  2QW0 X;  2D28 C;  4X66 C;  4ODJ A;  4DG8 A;  2PT7 G;  4JYA C;  1MXA A;  4JI4 C;  4GXQ A;  2DPL A;  1JOS A;  5IFI A;  1RY2 A;  3NYR A;  1XRA A;  4LE5 A;  1MXB A;  1FUG A;  3RV2 A;  1O92 A;  1XRB A;  5E7Q A;  5BR8 C;  2D1S A;  2VQF C;  4NXN C;  2Y4N A;  5IT9 D;  4WV3 A;  3NYQ A;  2E8C A;  1USP B;  5FLX D;  2F4V C;  5IWA C;  4DV5 C;  4LF7 C;  4IR7 A;  4FTF A;  2QL8 A;  3A9V A;  1N36 C;  3OTO C;  2D1R A;  1MXC A;  4WS9 A;  3AF5 A;  4RVO A;  2XR1 A;  1FJG C;  2UUB C;  5BUR A;  4JI7 C;  4DV4 C;  4KTV A;  5LMU C;  1GPM A;  1IBL C;  1EGA A;  4RLQ A;  4LF5 C;  1MD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...