3J81D

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
223
structure length
223
Chain Sequence
AIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRATKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHSGQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKALPDAVTIIEPKEEEPVLEPSVKDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 47
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
D PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3j81D01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3j81D02
2KZFA 2D7VA 2E5LC 4JI7C 4DCUA 5A2QD 4JI8C 2VQFC 1KKGA 1HNXC 1K0RA 4JI3C 3J81D 4AQYC 1N2FA 4YY3C 4DV3C 4LF6C 4LFAC 1HR0C 4GKKC 1JOSA 4MH4A 3T1HC 2OPLA 2VQEC 2CXCA 1XMOC 4DUYC 1XNQC 3IEVA 4DR4C 3J80D 4X62C 4DCSA 4DV0C 5LMNC 1UKKA 2E7GA 1WH9A 5BR8C 1HNZC 2UXBC 2UXDC 1J5EC 4YHHC 1IBKC 4OX9C 4DV4C 2UXCC 2CY1A 4JI0C 1XMQC 4DV5C 4X66C 3CJEA 4DV2C 4JYAC 1USPB 1FJGC 2E8EA 2BJOA 2ASBA 4DUZC 1LQLA 2HHHC 3AF6A 5IWAC 1I94C 5LMUC 4B3SC 3R9XA 4DV7C 4LF4C 4DR6C 2UUCC 1HH2P 2E8FA 2UUAC 2UUBC 2HJGA 2ATWA 4JV5C 1ZB8A 3JAMD 1IBMC 4DV6C 1MKYA 1VLAA 3OTOC 4X64C 4DR5C 2E8CA 4X65C 4KHPC 2UU9C 4XX2A 3T1YC 4JI1C 4DCVA 4DR3C 2ONFA 3LUSA 4JI5C 4JI6C 2PT7G 5IT9D 3J7AD 4NOZA 3GKUA 1HNWC 1N36C 1L2FA 4LF5C 2F4VC 1EGAA 4K0KC 2PN2A 3I07A 2EGTA 1XNRC 1ML8A 2ZM6C 2OPLB 4B3MC 2JMPA 4LF9C 3EERA 4JI2C 4LF7C 3IEUA 4NXMC 4B3TC 2XR1A 1WF3A 1N33C 4MTNA 4LFBC 4NXNC 1NYEA 4DR1C 3AF5A 2DYJA 1USPA 1IBLC 4DCTA 3R9WA 4BSZA 4B3RC 4LFCC 2QL8A 4LF8C 1N34C 4GKJC 1N32C 2YCBA 4DR2C 4DR7C 1PA4A 1QWIA 5FLXD 1ZB9A 4JI4C 4DV1C
chains in the Genus database with same CATH superfamily
4DCUA 2NCLA 4JI8C 4NDNA 3J81D 1LCIA 2QVZX 3VNRA 4GKKC 1T5DX 3I08A 2OPLA 2VQEC 2CXCA 1XNQC 4DR4C 2QVXX 3IEVA 4RVOA 3J80D 2P20A 1WH9A 1J5EC 3IPLA 3TQIA 1O9TA 2P2BA 4D57A 4DV2C 3CJEA 4U5YD 4JYAC 4PZPA 2E8EA 2ASBA 3EQ6A 1FLOA 2ZZNA 1XRAA 4BBYA 5H9UA 2Y4OA 3AF6A 2BH1X 4DV7C 2HJGA 1YJ7A 4GXRA 5A1GA 1PG4A 3CQ2A 1O93A 4DCVA 4DR3C 2ONFA 1ULTA 5IT9D 3L8CA 3GR0A 4K0BA 1L2FA 3LAXA 4JM1A 1EGAA 4ODJA 3PESA 3AY0A 3I07A 2EGTA 4OYCA 3CQ1A 4IR7A 4LF9C 2D28C 3K6RA 3EERA 1PG3A 4JI2C 4B3TC 2YX1A 4PHTA 4MTNA 5JRHA 4NXNC 3AF5A 1MXAA 4IZ6A 4BC7A 2AYAA 2QL8A 1N34C 1O90A 4GKJC 2D1SA 1QWIA 4KTTA 2KZFA 5IFIA 2D7VA 1XRCA 2KDNA 3TDEA 4ISBA 1HNXC 4JI3C 1TH5A 2JNVA 2D27A 5BSTA 1HR0C 3UX3A 1BA3A 2OO4A 1FUGA 5CZVA 1MD9A 4OXIA 4DG9A 1UKKA 1HNZC 4FUQA 3UZ0A 4YHHC 1IBKC 4DV4C 1XS3A 2CY1A 3CQ3A 1XMQC 4HPVA 4R1LA 2V7BA 3CW9A 5E7QA 2BJOA 3LNVA 4DUZC 4WV3A 4G1IA 2HHHC 3NYRA 1V25A 1P7LA 5IWAC 3C5EA 2QW0X 4LF4C 4DR6C 3RV2A 3NI2A 2UUAC 2UUBC 3RG2A 4L2ZA 1AMUA 1MKYA 2D1TA 4RLFA 3L95X 4BC9A 3OTOC 4DR5C 3VNSA 4D4GA 4JI1C 5DV9A 4JI6C 3J7AD 5BSUA 3GKUA 1HNWC 1N36C 2MM9A 2KZ0A 4ZLPA 5LCIA 3ETOA 3A9VA 1XNRC 1XRBA 1YGTA 5BSMA 4I9GA 2OPLB 1T5HX 2JMPA 3B7WA 5AE1A 4TPSB 3GR1A 1RY2A 2Y4NA 2XR1A 1WF3A 3NPDA 1N33C 1NYEA 3DLPX 4DCTA 1P4EA 5CZXA 4WS9A 4L7IA 4DR2C 3IMLA 1PA4A 2WP0C 5FLXD 1KKGA 4JI4C 2E5LC 1GPMA 4JI7C 5A2QD 1UWDA 1K0RA 4R1MA 3A4IA 1P4EC 4AQYC 5KYVA 1N2FA 1NY8A 3VNQA 4KTVA 4LF6C 3E7XA 5A1IA 4PUHA 4MH4A 3T1HC 2MMAB 2DHMA 5BUQA 1VEHA 2M5OA 2E0GA 2E7GA 4RM3A 4D4IA 3KXWA 2UXCC 3FCCA 4DV5C 4X66C 4RM2A 5BSWA 1USPB 3ETCA 1V60A 1MDBA 4ZJZA 1LQLA 3FCEA 3PROC 1I94C 5BUSA 2QVYX 1MXCA 3GPCA 3O2EA 1ZB8A 3H2TA 2YWBA 2ZTBA 5T8SA 4X64C 2E8CA 4X65C 2UU9C 4XX2A 3G7SA 4L4QA 3T1YC 3LUSA 3UEBA 4JI5C 5BSVA 2PT7G 5GTDA 1MDFA 1M6XA 2VSQA 2YWCA 2PN2A 1PU1A 4RVNA 1ML8A 2ZM6C 4B3MC 3DAYA 2M5HA 5T8TA 4G37A 2D1RA 3LGXA 2P02A 4LFBC 3TR3A 2OBVA 4BCAA 2DYJA 2Y27A 3R9WA 4B3RC 2P2QA 3E7WA 4LFCC 4DR7C 5BSRA 1FJGC 4DV1C 2VQFC 3NYQA 3PBKA 5AE3A 4YY3C 2PROA 4RLQA 4DV3C 4LFAC 5AE2A 5KEIA 1JOSA 1XMOC 4DUYC 1O92A 4X62C 4DCSA 3UOWA 4DV0C 5LMNC 5BR8C 2UXBC 2Z51A 2UXDC 4OX9C 4LE5A 4GS5A 4DG8A 2VZEA 5ADZA 4JI0C 4GXQA 3LNOA 1QM4A 3CW8X 1IB8A 5K85A 2WD9A 3S82A 2PG1E 4RMNA 4B3SC 5LMUC 3R9XA 5BURA 4G36A 4FTFA 2UUCC 1HH2P 2E8FA 4PUGA 4FUTA 2ATWA 4JV5C 3JAMD 1IBMC 2DPLA 4DV6C 3A25A 1V26A 2ZZMA 5A19A 1VLAA 2D1QA 1XHJA 2P2FA 3N2QA 4KHPC 5KYTA 3A9UA 4EATA 4I9FA 4NOZA 2CU6A 3FM7A 1M6XC 4K0KC 4LF5C 2F4VC 1MXBA 5K8FA 3UX2A 2P2JA 3TUFA 2MCQA 4D56A 4LF7C 4R0MA 2P2MA 3IEUA 4NXMC 3DHVA 3A26A 4PROC 4DR1C 3N54B 4PUIA 1USPA 1IBLC 4BSZA 1WCJA 1RG9A 1XDXA 3SO4A 4LF8C 1N32C 2YCBA 3R44A 1ZB9A
chains in the Genus database with same CATH topology
4DCUA 4JI8C 4NDNA 3J81D 1LCIA 2QVZX 3VNRA 4GKKC 1T5DX 3I08A 2OPLA 2VQEC 2CXCA 1XNQC 4DR4C 2QVXX 3IEVA 4RVOA 3J80D 2P20A 1WH9A 1J5EC 3IPLA 3TQIA 1O9TA 2P2BA 4D57A 4DV2C 3CJEA 4U5YD 4JYAC 4PZPA 2E8EA 2ASBA 3EQ6A 1XRAA 4BBYA 5H9UA 2Y4OA 3AF6A 2BH1X 4DV7C 2HJGA 1YJ7A 4GXRA 5A1GA 1PG4A 1O93A 4DCVA 4DR3C 2ONFA 1ULTA 5IT9D 3L8CA 3GR0A 4K0BA 1L2FA 3LAXA 4JM1A 1EGAA 4ODJA 3PESA 3I07A 2EGTA 4OYCA 4IR7A 4LF9C 2D28C 3EERA 1PG3A 4JI2C 4B3TC 4PHTA 4MTNA 5JRHA 4NXNC 3AF5A 1MXAA 4IZ6A 4BC7A 2AYAA 2QL8A 1N34C 1O90A 4GKJC 2D1SA 1QWIA 4KTTA 2KZFA 5IFIA 2D7VA 1XRCA 3TDEA 4ISBA 1HNXC 4JI3C 2D27A 5BSTA 1HR0C 1BA3A 2OO4A 1FUGA 5CZVA 1MD9A 4OXIA 4DG9A 1UKKA 1HNZC 4FUQA 3UZ0A 4YHHC 1IBKC 4DV4C 2CY1A 1XMQC 4HPVA 4R1LA 2V7BA 3CW9A 5E7QA 2BJOA 3LNVA 4DUZC 4WV3A 4G1IA 2HHHC 3NYRA 1V25A 1P7LA 5IWAC 3C5EA 2QW0X 4LF4C 4DR6C 3RV2A 3NI2A 2UUAC 2UUBC 3RG2A 4L2ZA 1AMUA 1MKYA 2D1TA 4RLFA 3L95X 4BC9A 3OTOC 4DR5C 3VNSA 4D4GA 4JI1C 5DV9A 4JI6C 3J7AD 5BSUA 3GKUA 1HNWC 1N36C 4ZLPA 3ETOA 3A9VA 1XNRC 1XRBA 5BSMA 4I9GA 2OPLB 1T5HX 2JMPA 3B7WA 5AE1A 4TPSB 3GR1A 1RY2A 2Y4NA 2XR1A 1WF3A 3NPDA 1N33C 1NYEA 3DLPX 4DCTA 5CZXA 4WS9A 4L7IA 4DR2C 3IMLA 1PA4A 2WP0C 5FLXD 1KKGA 4JI4C 2E5LC 1GPMA 4JI7C 5A2QD 4R1MA 1K0RA 3A4IA 4AQYC 5KYVA 1N2FA 3VNQA 4KTVA 4LF6C 3E7XA 5A1IA 4MH4A 3T1HC 5BUQA 2E0GA 2E7GA 4RM3A 4D4IA 3KXWA 2UXCC 3FCCA 4DV5C 4X66C 4RM2A 5BSWA 1USPB 3ETCA 1MDBA 4ZJZA 1LQLA 3FCEA 3PROC 1I94C 5BUSA 2QVYX 1MXCA 3GPCA 1ZB8A 3H2TA 2YWBA 5T8SA 4X64C 2E8CA 4X65C 2UU9C 4XX2A 3G7SA 4L4QA 3T1YC 3LUSA 4JI5C 5BSVA 2PT7G 5GTDA 1MDFA 2VSQA 2YWCA 2PN2A 4RVNA 1ML8A 2ZM6C 4B3MC 3DAYA 5T8TA 4G37A 2D1RA 3LGXA 2P02A 4LFBC 2OBVA 4BCAA 2DYJA 2Y27A 3R9WA 4B3RC 2P2QA 3E7WA 4LFCC 4DR7C 5BSRA 1FJGC 4DV1C 2VQFC 3NYQA 3PBKA 5AE3A 4YY3C 2PROA 4RLQA 4DV3C 4LFAC 5AE2A 5KEIA 1JOSA 1XMOC 4DUYC 1O92A 4X62C 4DCSA 3UOWA 4DV0C 5LMNC 5BR8C 2UXBC 2UXDC 4OX9C 4LE5A 4GS5A 4DG8A 2VZEA 5ADZA 4JI0C 4GXQA 1QM4A 3CW8X 5K85A 2WD9A 3S82A 4RMNA 4B3SC 5LMUC 3R9XA 5BURA 4G36A 4FTFA 2UUCC 1HH2P 2E8FA 4FUTA 2ATWA 4JV5C 3JAMD 1IBMC 2DPLA 4DV6C 1V26A 5A19A 1VLAA 2D1QA 2P2FA 3N2QA 4KHPC 5KYTA 3A9UA 4EATA 4I9FA 4NOZA 4K0KC 4LF5C 2F4VC 1MXBA 5K8FA 2P2JA 3TUFA 4D56A 4LF7C 4R0MA 2P2MA 3IEUA 4NXMC 3DHVA 4PROC 4DR1C 3N54B 1USPA 1IBLC 4BSZA 1RG9A 3SO4A 4LF8C 1N32C 2YCBA 3R44A 1ZB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZF A;  2D7V A;  2E5L C;  4JI7 C;  4DCU A;  5A2Q D;  4JI8 C;  2VQF C;  1KKG A;  1HNX C;  1K0R A;  4JI3 C;  3J81 D;  4AQY C;  1N2F A;  4YY3 C;  4DV3 C;  4LF6 C;  4LFA C;  1HR0 C;  4GKK C;  1JOS A;  4MH4 A;  3T1H C;  2OPL A;  2VQE C;  2CXC A;  1XMO C;  4DUY C;  1XNQ C;  3IEV A;  4DR4 C;  3J80 D;  4X62 C;  4DCS A;  4DV0 C;  5LMN C;  1UKK A;  2E7G A;  1WH9 A;  5BR8 C;  1HNZ C;  2UXB C;  2UXD C;  1J5E C;  4YHH C;  1IBK C;  4OX9 C;  4DV4 C;  2UXC C;  2CY1 A;  4JI0 C;  1XMQ C;  4DV5 C;  4X66 C;  3CJE A;  4DV2 C;  4JYA C;  1USP B;  1FJG C;  2E8E A;  2BJO A;  2ASB A;  4DUZ C;  1LQL A;  2HHH C;  3AF6 A;  5IWA C;  1I94 C;  5LMU C;  4B3S C;  3R9X A;  4DV7 C;  4LF4 C;  4DR6 C;  2UUC C;  1HH2 P;  2E8F A;  2UUA C;  2UUB C;  2HJG A;  2ATW A;  4JV5 C;  1ZB8 A;  3JAM D;  1IBM C;  4DV6 C;  1MKY A;  1VLA A;  3OTO C;  4X64 C;  4DR5 C;  2E8C A;  4X65 C;  4KHP C;  2UU9 C;  4XX2 A;  3T1Y C;  4JI1 C;  4DCV A;  4DR3 C;  2ONF A;  3LUS A;  4JI5 C;  4JI6 C;  2PT7 G;  5IT9 D;  3J7A D;  4NOZ A;  3GKU A;  1HNW C;  1N36 C;  1L2F A;  4LF5 C;  2F4V C;  1EGA A;  4K0K C;  2PN2 A;  3I07 A;  2EGT A;  1XNR C;  1ML8 A;  2ZM6 C;  2OPL B;  4B3M C;  2JMP A;  4LF9 C;  3EER A;  4JI2 C;  4LF7 C;  3IEU A;  4NXM C;  4B3T C;  2XR1 A;  1WF3 A;  1N33 C;  4MTN A;  4LFB C;  4NXN C;  1NYE A;  4DR1 C;  3AF5 A;  2DYJ A;  1USP A;  1IBL C;  4DCT A;  3R9W A;  4BSZ A;  4B3R C;  4LFC C;  2QL8 A;  4LF8 C;  1N34 C;  4GKJ C;  1N32 C;  2YCB A;  4DR2 C;  4DR7 C;  1PA4 A;  1QWI A;  5FLX D;  1ZB9 A;  4JI4 C;  4DV1 C; 
#chains in the Genus database with same CATH topology
 4DCU A;  2NCL A;  4JI8 C;  4NDN A;  3J81 D;  1LCI A;  2QVZ X;  3VNR A;  4GKK C;  1T5D X;  3I08 A;  2OPL A;  2VQE C;  2CXC A;  1XNQ C;  4DR4 C;  2QVX X;  3IEV A;  4RVO A;  3J80 D;  2P20 A;  1WH9 A;  1J5E C;  3IPL A;  3TQI A;  1O9T A;  2P2B A;  4D57 A;  4DV2 C;  3CJE A;  4U5Y D;  4JYA C;  4PZP A;  2E8E A;  2ASB A;  3EQ6 A;  1FLO A;  2ZZN A;  1XRA A;  4BBY A;  5H9U A;  2Y4O A;  3AF6 A;  2BH1 X;  4DV7 C;  2HJG A;  1YJ7 A;  4GXR A;  5A1G A;  1PG4 A;  3CQ2 A;  1O93 A;  4DCV A;  4DR3 C;  2ONF A;  1ULT A;  5IT9 D;  3L8C A;  3GR0 A;  4K0B A;  1L2F A;  3LAX A;  4JM1 A;  1EGA A;  4ODJ A;  3PES A;  3AY0 A;  3I07 A;  2EGT A;  4OYC A;  3CQ1 A;  4IR7 A;  4LF9 C;  2D28 C;  3K6R A;  3EER A;  1PG3 A;  4JI2 C;  4B3T C;  2YX1 A;  4PHT A;  4MTN A;  5JRH A;  4NXN C;  3AF5 A;  1MXA A;  4IZ6 A;  4BC7 A;  2AYA A;  2QL8 A;  1N34 C;  1O90 A;  4GKJ C;  2D1S A;  1QWI A;  4KTT A;  2KZF A;  5IFI A;  2D7V A;  1XRC A;  2KDN A;  3TDE A;  4ISB A;  1HNX C;  4JI3 C;  1TH5 A;  2JNV A;  2D27 A;  5BST A;  1HR0 C;  3UX3 A;  1BA3 A;  2OO4 A;  1FUG A;  5CZV A;  1MD9 A;  4OXI A;  4DG9 A;  1UKK A;  1HNZ C;  4FUQ A;  3UZ0 A;  4YHH C;  1IBK C;  4DV4 C;  1XS3 A;  2CY1 A;  3CQ3 A;  1XMQ C;  4HPV A;  4R1L A;  2V7B A;  3CW9 A;  5E7Q A;  2BJO A;  3LNV A;  4DUZ C;  4WV3 A;  4G1I A;  2HHH C;  3NYR A;  1V25 A;  1P7L A;  5IWA C;  3C5E A;  2QW0 X;  4LF4 C;  4DR6 C;  3RV2 A;  3NI2 A;  2UUA C;  2UUB C;  3RG2 A;  4L2Z A;  1AMU A;  1MKY A;  2D1T A;  4RLF A;  3L95 X;  4BC9 A;  3OTO C;  4DR5 C;  3VNS A;  4D4G A;  4JI1 C;  5DV9 A;  4JI6 C;  3J7A D;  5BSU A;  3GKU A;  1HNW C;  1N36 C;  2MM9 A;  2KZ0 A;  4ZLP A;  5LCI A;  3ETO A;  3A9V A;  1XNR C;  1XRB A;  1YGT A;  5BSM A;  4I9G A;  2OPL B;  1T5H X;  2JMP A;  3B7W A;  5AE1 A;  4TPS B;  3GR1 A;  1RY2 A;  2Y4N A;  2XR1 A;  1WF3 A;  3NPD A;  1N33 C;  1NYE A;  3DLP X;  4DCT A;  1P4E A;  5CZX A;  4WS9 A;  4L7I A;  4DR2 C;  3IML A;  1PA4 A;  2WP0 C;  5FLX D;  1KKG A;  4JI4 C;  2E5L C;  1GPM A;  4JI7 C;  5A2Q D;  1UWD A;  1K0R A;  4R1M A;  3A4I A;  1P4E C;  4AQY C;  5KYV A;  1N2F A;  1NY8 A;  3VNQ A;  4KTV A;  4LF6 C;  3E7X A;  5A1I A;  4PUH A;  4MH4 A;  3T1H C;  2MMA B;  2DHM A;  5BUQ A;  1VEH A;  2M5O A;  2E0G A;  2E7G A;  4RM3 A;  4D4I A;  3KXW A;  2UXC C;  3FCC A;  4DV5 C;  4X66 C;  4RM2 A;  5BSW A;  1USP B;  3ETC A;  1V60 A;  1MDB A;  4ZJZ A;  1LQL A;  3FCE A;  3PRO C;  1I94 C;  5BUS A;  2QVY X;  1MXC A;  3GPC A;  3O2E A;  1ZB8 A;  3H2T A;  2YWB A;  2ZTB A;  5T8S A;  4X64 C;  2E8C A;  4X65 C;  2UU9 C;  4XX2 A;  3G7S A;  4L4Q A;  3T1Y C;  3LUS A;  3UEB A;  4JI5 C;  5BSV A;  2PT7 G;  5GTD A;  1MDF A;  1M6X A;  2VSQ A;  2YWC A;  2PN2 A;  1PU1 A;  4RVN A;  1ML8 A;  2ZM6 C;  4B3M C;  3DAY A;  2M5H A;  5T8T A;  4G37 A;  2D1R A;  3LGX A;  2P02 A;  4LFB C;  3TR3 A;  2OBV A;  4BCA A;  2DYJ A;  2Y27 A;  3R9W A;  4B3R C;  2P2Q A;  3E7W A;  4LFC C;  4DR7 C;  5BSR A;  1FJG C;  4DV1 C;  2VQF C;  3NYQ A;  3PBK A;  5AE3 A;  4YY3 C;  2PRO A;  4RLQ A;  4DV3 C;  4LFA C;  5AE2 A;  5KEI A;  1JOS A;  1XMO C;  4DUY C;  1O92 A;  4X62 C;  4DCS A;  3UOW A;  4DV0 C;  5LMN C;  5BR8 C;  2UXB C;  2Z51 A;  2UXD C;  4OX9 C;  4LE5 A;  4GS5 A;  4DG8 A;  2VZE A;  5ADZ A;  4JI0 C;  4GXQ A;  3LNO A;  1QM4 A;  3CW8 X;  1IB8 A;  5K85 A;  2WD9 A;  3S82 A;  2PG1 E;  4RMN A;  4B3S C;  5LMU C;  3R9X A;  5BUR A;  4G36 A;  4FTF A;  2UUC C;  1HH2 P;  2E8F A;  4PUG A;  4FUT A;  2ATW A;  4JV5 C;  3JAM D;  1IBM C;  2DPL A;  4DV6 C;  3A25 A;  1V26 A;  2ZZM A;  5A19 A;  1VLA A;  2D1Q A;  1XHJ A;  2P2F A;  3N2Q A;  4KHP C;  5KYT A;  3A9U A;  4EAT A;  4I9F A;  4NOZ A;  2CU6 A;  3FM7 A;  1M6X C;  4K0K C;  4LF5 C;  2F4V C;  1MXB A;  5K8F A;  3UX2 A;  2P2J A;  3TUF A;  2MCQ A;  4D56 A;  4LF7 C;  4R0M A;  2P2M A;  3IEU A;  4NXM C;  3DHV A;  3A26 A;  4PRO C;  4DR1 C;  3N54 B;  4PUI A;  1USP A;  1IBL C;  4BSZ A;  1WCJ A;  1RG9 A;  1XDX A;  3SO4 A;  4LF8 C;  1N32 C;  2YCB A;  3R44 A;  1ZB9 A; 
#chains in the Genus database with same CATH homology
 4DCU A;  4JI8 C;  4NDN A;  3J81 D;  1LCI A;  2QVZ X;  3VNR A;  4GKK C;  1T5D X;  3I08 A;  2OPL A;  2VQE C;  2CXC A;  1XNQ C;  4DR4 C;  2QVX X;  3IEV A;  4RVO A;  3J80 D;  2P20 A;  1WH9 A;  1J5E C;  3IPL A;  3TQI A;  1O9T A;  2P2B A;  4D57 A;  4DV2 C;  3CJE A;  4U5Y D;  4JYA C;  4PZP A;  2E8E A;  2ASB A;  3EQ6 A;  1XRA A;  4BBY A;  5H9U A;  2Y4O A;  3AF6 A;  2BH1 X;  4DV7 C;  2HJG A;  1YJ7 A;  4GXR A;  5A1G A;  1PG4 A;  1O93 A;  4DCV A;  4DR3 C;  2ONF A;  1ULT A;  5IT9 D;  3L8C A;  3GR0 A;  4K0B A;  1L2F A;  3LAX A;  4JM1 A;  1EGA A;  4ODJ A;  3PES A;  3I07 A;  2EGT A;  4OYC A;  4IR7 A;  4LF9 C;  2D28 C;  3EER A;  1PG3 A;  4JI2 C;  4B3T C;  4PHT A;  4MTN A;  5JRH A;  4NXN C;  3AF5 A;  1MXA A;  4IZ6 A;  4BC7 A;  2AYA A;  2QL8 A;  1N34 C;  1O90 A;  4GKJ C;  2D1S A;  1QWI A;  4KTT A;  2KZF A;  5IFI A;  2D7V A;  1XRC A;  3TDE A;  4ISB A;  1HNX C;  4JI3 C;  2D27 A;  5BST A;  1HR0 C;  1BA3 A;  2OO4 A;  1FUG A;  5CZV A;  1MD9 A;  4OXI A;  4DG9 A;  1UKK A;  1HNZ C;  4FUQ A;  3UZ0 A;  4YHH C;  1IBK C;  4DV4 C;  2CY1 A;  1XMQ C;  4HPV A;  4R1L A;  2V7B A;  3CW9 A;  5E7Q A;  2BJO A;  3LNV A;  4DUZ C;  4WV3 A;  4G1I A;  2HHH C;  3NYR A;  1V25 A;  1P7L A;  5IWA C;  3C5E A;  2QW0 X;  4LF4 C;  4DR6 C;  3RV2 A;  3NI2 A;  2UUA C;  2UUB C;  3RG2 A;  4L2Z A;  1AMU A;  1MKY A;  2D1T A;  4RLF A;  3L95 X;  4BC9 A;  3OTO C;  4DR5 C;  3VNS A;  4D4G A;  4JI1 C;  5DV9 A;  4JI6 C;  3J7A D;  5BSU A;  3GKU A;  1HNW C;  1N36 C;  4ZLP A;  3ETO A;  3A9V A;  1XNR C;  1XRB A;  5BSM A;  4I9G A;  2OPL B;  1T5H X;  2JMP A;  3B7W A;  5AE1 A;  4TPS B;  3GR1 A;  1RY2 A;  2Y4N A;  2XR1 A;  1WF3 A;  3NPD A;  1N33 C;  1NYE A;  3DLP X;  4DCT A;  5CZX A;  4WS9 A;  4L7I A;  4DR2 C;  3IML A;  1PA4 A;  2WP0 C;  5FLX D;  1KKG A;  4JI4 C;  2E5L C;  1GPM A;  4JI7 C;  5A2Q D;  4R1M A;  1K0R A;  3A4I A;  4AQY C;  5KYV A;  1N2F A;  3VNQ A;  4KTV A;  4LF6 C;  3E7X A;  5A1I A;  4MH4 A;  3T1H C;  5BUQ A;  2E0G A;  2E7G A;  4RM3 A;  4D4I A;  3KXW A;  2UXC C;  3FCC A;  4DV5 C;  4X66 C;  4RM2 A;  5BSW A;  1USP B;  3ETC A;  1MDB A;  4ZJZ A;  1LQL A;  3FCE A;  3PRO C;  1I94 C;  5BUS A;  2QVY X;  1MXC A;  3GPC A;  1ZB8 A;  3H2T A;  2YWB A;  5T8S A;  4X64 C;  2E8C A;  4X65 C;  2UU9 C;  4XX2 A;  3G7S A;  4L4Q A;  3T1Y C;  3LUS A;  4JI5 C;  5BSV A;  2PT7 G;  5GTD A;  1MDF A;  2VSQ A;  2YWC A;  2PN2 A;  4RVN A;  1ML8 A;  2ZM6 C;  4B3M C;  3DAY A;  5T8T A;  4G37 A;  2D1R A;  3LGX A;  2P02 A;  4LFB C;  2OBV A;  4BCA A;  2DYJ A;  2Y27 A;  3R9W A;  4B3R C;  2P2Q A;  3E7W A;  4LFC C;  4DR7 C;  5BSR A;  1FJG C;  4DV1 C;  2VQF C;  3NYQ A;  3PBK A;  5AE3 A;  4YY3 C;  2PRO A;  4RLQ A;  4DV3 C;  4LFA C;  5AE2 A;  5KEI A;  1JOS A;  1XMO C;  4DUY C;  1O92 A;  4X62 C;  4DCS A;  3UOW A;  4DV0 C;  5LMN C;  5BR8 C;  2UXB C;  2UXD C;  4OX9 C;  4LE5 A;  4GS5 A;  4DG8 A;  2VZE A;  5ADZ A;  4JI0 C;  4GXQ A;  1QM4 A;  3CW8 X;  5K85 A;  2WD9 A;  3S82 A;  4RMN A;  4B3S C;  5LMU C;  3R9X A;  5BUR A;  4G36 A;  4FTF A;  2UUC C;  1HH2 P;  2E8F A;  4FUT A;  2ATW A;  4JV5 C;  3JAM D;  1IBM C;  2DPL A;  4DV6 C;  1V26 A;  5A19 A;  1VLA A;  2D1Q A;  2P2F A;  3N2Q A;  4KHP C;  5KYT A;  3A9U A;  4EAT A;  4I9F A;  4NOZ A;  4K0K C;  4LF5 C;  2F4V C;  1MXB A;  5K8F A;  2P2J A;  3TUF A;  4D56 A;  4LF7 C;  4R0M A;  2P2M A;  3IEU A;  4NXM C;  3DHV A;  4PRO C;  4DR1 C;  3N54 B;  1USP A;  1IBL C;  4BSZ A;  1RG9 A;  3SO4 A;  4LF8 C;  1N32 C;  2YCB A;  3R44 A;  1ZB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...