3J81D

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
223
structure length
223
Chain Sequence
AIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRATKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHSGQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKALPDAVTIIEPKEEEPVLEPSVKDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 47
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
D PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3j81D01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3j81D02
1JOSA 2QL8A 3OTOC 1N33C 1J5EC 1IBMC 3AF5A 4JI1C 4JI2C 2VQEC 4DCVA 1KKGA 1HH2P 1LQLA 4GKJC 4JI4C 1ZB9A 2PN2A 4JI6C 3J80D 3J7AD 1IBKC 1USPA 1XMOC 1WH9A 5IT9D 4X65C 2YCBA 3JAMD 3R9WA 4GKKC 5BR8C 4LF5C 4LFAC 2UXBC 3R9XA 2ZM6C 4LF9C 4KHPC 2VQFC 4LF7C 2UUBC 2JMPA 1XNQC 2F4VC 1XMQC 1HNZC 2UU9C 4DR3C 4B3MC 4DCTA 4DV5C 4X62C 4DV0C 1PA4A 3IEUA 4NOZA 5LMNC 4DV7C 4YY3C 2EGTA 4DUYC 1NYEA 2XR1A 2CXCA 3CJEA 3EERA 1WF3A 4AQYC 3T1HC 1FJGC 1XNRC 2UXCC 1I94C 4OX9C 1VLAA 2UUAC 5FLXD 1HR0C 4DV2C 1L2FA 2E8FA 4JYAC 2ONFA 2PT7G 4DV1C 2E8CA 2HJGA 3GKUA 4X66C 1ML8A 1MKYA 4MTNA 2CY1A 2KZFA 4B3RC 4YHHC 2ATWA 4DV6C 4BSZA 2OPLB 4DR1C 2E7GA 4LFCC 2E5LC 1QWIA 2DYJA 4K0KC 5A2QD 2ASBA 4LF6C 1IBLC 4JV5C 2UXDC 2HHHC 4XX2A 4NXMC 4DR2C 2OPLA 1ZB8A 1K0RA 3AF6A 2E8EA 1HNXC 2D7VA 4DUZC 4LF8C 4JI5C 1N34C 1HNWC 4JI7C 2BJOA 4B3SC 4JI0C 4DR4C 2UUCC 4JI8C 1N2FA 4DR5C 1UKKA 3LUSA 4JI3C 4DCSA 4LF4C 4X64C 3J81D 5IWAC 4LFBC 1N36C 4DV3C 1USPB 4B3TC 3I07A 5LMUC 4DR6C 4NXNC 3IEVA 1EGAA 4DV4C 4DCUA 4DR7C 1N32C 3T1YC 4MH4A
chains in the Genus database with same CATH superfamily
3A9VA 3N2QA 2WP0C 5KYVA 3E7WA 3J7AD 3E7XA 1MDBA 1USPA 3G7SA 5E7QA 5IT9D 3JAMD 1P7LA 3R9WA 2PG1E 5BSRA 5BUQA 2UXBC 2Y27A 2VQFC 2UUBC 2V7BA 2F4VC 1HNZC 4B3MC 4DR3C 4GS5A 1P4EA 2NCLA 2YX1A 1QM4A 2P20A 4ODJA 1BA3A 3RV2A 3EQ6A 3CJEA 4FUTA 2UXCC 4OX9C 1YJ7A 2WD9A 4DV2C 1L2FA 2QVYX 3N54B 2ONFA 4DV1C 1ML8A 2KZFA 2DPLA 2ATWA 3FM7A 2MMAB 4BSZA 3TR3A 4LFCC 2YWCA 1QWIA 5BSVA 4PUGA 3PROC 1HNXC 2E8EA 3AY0A 3NYRA 1MXBA 3O2EA 4JI7C 4WV3A 2BJOA 4B3SC 3ETOA 3IPLA 4EATA 1V25A 4JI3C 4DCSA 2M5HA 4D4IA 4R0MA 4IR7A 5CZXA 4LFBC 2P02A 2OO4A 3H2TA 1MXCA 4ISBA 5LMUC 3FCCA 4DCUA 4DR7C 3L8CA 1N33C 1IBMC 5A1IA 1KKGA 1HH2P 2D27A 1LQLA 5A19A 2PN2A 4D4GA 4I9FA 2DHMA 2QVZX 3ETCA 3PBKA 4LE5A 3RG2A 4G36A 5K85A 4BBYA 2PROA 5AE2A 4LF7C 1T5HX 5IFIA 1TH5A 4DCTA 3KXWA 2ZZMA 2VZEA 3A9UA 4RLFA 1O9TA 3GPCA 3IEUA 5LMNC 3A4IA 4DUYC 1NY8A 2MM9A 4GXQA 2XR1A 2CXCA 1WF3A 4D56A 4RVNA 3A26A 1VLAA 4L7IA 1HR0C 4L2ZA 1MDFA 4RM3A 5KEIA 2OBVA 2E8CA 2P2BA 3GKUA 4MTNA 4B3RC 2P2FA 2KDNA 4R1MA 4BC7A 2OPLB 5T8TA 1FLOA 2E5LC 4GXRA 1VEHA 4I9GA 4LF6C 2UXDC 4XX2A 4NXMC 4DR2C 1K0RA 3AF6A 1LCIA 1MD9A 3UEBA 1GPMA 2E0GA 5CZVA 3NI2A 4JI5C 4RMNA 4DR4C 1FUGA 5AE3A 2KZ0A 3GR1A 4WS9A 3UZ0A 2D1TA 1N36C 4FUQA 1PG3A 4DV3C 5BSWA 1USPB 3L95X 1EGAA 5AE1A 3NPDA 1N32C 2Z51A 1MXAA 2QL8A 3OTOC 1J5EC 3AF5A 3PESA 1M6XA 2ZZNA 5T8SA 4GKJC 4JI4C 4JI6C 1XHJA 4DG8A 4FTFA 3K6RA 1XMOC 3CW9A 2YCBA 2JNVA 1T5DX 4LFAC 2CU6A 4K0BA 2VSQA 4KHPC 2JMPA 4PUIA 1XMQC 2UU9C 4TPSB 4JM1A 5BSMA 4X62C 4DV0C 1PA4A 3VNSA 2EGTA 3C5EA 4PHTA 1XRAA 3EERA 2YWBA 3T1HC 1RG9A 1FJGC 1XNRC 2P2QA 3DHVA 1M6XC 5H9UA 1O92A 2UUAC 5FLXD 5JRHA 2E8FA 5ADZA 3DLPX 1XRCA 4JYAC 4PROC 2HJGA 1V26A 1PG4A 2CY1A 4PZPA 4DV6C 3IMLA 4G37A 3GR0A 2ZTBA 4PUHA 3S82A 2E7GA 1ULTA 2DYJA 4DG9A 5A2QD 4RLQA 2D1SA 1IBLC 2BH1X 1IB8A 2OPLA 1ZB8A 2Y4OA 3LGXA 2P2JA 4D57A 4LF8C 4G1IA 3CW8X 4JI0C 1YGTA 1WCJA 5BURA 4JI8C 1N2FA 4ZJZA 3LUSA 1RY2A 4LF4C 3LNVA 3J81D 5DV9A 1V60A 5IWAC 3LAXA 4KTVA 5BSUA 3I07A 4DR6C 3VNRA 3IEVA 4DV4C 4R1LA 1XDXA 3T1YC 3NYQA 4MH4A 1JOSA 2AYAA 2QW0X 3LNOA 3FCEA 4JI1C 4JI2C 2VQEC 4DCVA 3TDEA 1ZB9A 4KTTA 3J80D 1IBKC 1PU1A 1WH9A 4X65C 2D1RA 3CQ2A 4GKKC 4BC9A 5BR8C 4LF5C 3R9XA 3SO4A 2ZM6C 4LF9C 4IZ6A 4RM2A 2Y4NA 2D28C 1XNQC 2M5OA 4NDNA 4DV5C 4NOZA 4DV7C 4OYCA 4YY3C 1O93A 1NYEA 5GTDA 4AQYC 3A25A 3UX3A 3UX2A 2MCQA 1I94C 5LCIA 3VNQA 2D1QA 2PT7G 5BUSA 5KYTA 4X66C 1MKYA 5A1GA 3CQ3A 4YHHC 4HPVA 4ZLPA 4DR1C 3CQ1A 1AMUA 3B7WA 5K8FA 4K0KC 2ASBA 4JV5C 2P2MA 2HHHC 4BCAA 5BSTA 3UOWA 2D7VA 1P4EC 4OXIA 1XS3A 4DUZC 1HNWC 1N34C 3DAYA 1UWDA 2UUCC 4RVOA 4DR5C 1UKKA 4X64C 3TUFA 3TQIA 4B3TC 1XRBA 4U5YD 4NXNC 2QVXX 4L4QA 3R44A 3I08A 1O90A
chains in the Genus database with same CATH topology
3A9VA 3N2QA 2WP0C 5KYVA 3E7WA 3J7AD 3E7XA 1MDBA 1USPA 3G7SA 5E7QA 5IT9D 3JAMD 1P7LA 3R9WA 5BSRA 5BUQA 2UXBC 2Y27A 2VQFC 2UUBC 2V7BA 2F4VC 1HNZC 4B3MC 4DR3C 4GS5A 1QM4A 2P20A 4ODJA 1BA3A 3RV2A 3EQ6A 3CJEA 4FUTA 2UXCC 4OX9C 1YJ7A 2WD9A 4DV2C 1L2FA 2QVYX 3N54B 2ONFA 4DV1C 1ML8A 2KZFA 2DPLA 2ATWA 4BSZA 4LFCC 2YWCA 1QWIA 5BSVA 3PROC 1HNXC 2E8EA 3NYRA 1MXBA 4JI7C 4WV3A 2BJOA 4B3SC 3ETOA 3IPLA 4EATA 1V25A 4JI3C 4DCSA 4D4IA 4R0MA 4IR7A 5CZXA 4LFBC 2P02A 2OO4A 3H2TA 1MXCA 4ISBA 5LMUC 3FCCA 4DCUA 4DR7C 3L8CA 1N33C 1IBMC 5A1IA 1KKGA 1HH2P 2D27A 1LQLA 5A19A 2PN2A 4D4GA 4I9FA 2QVZX 3ETCA 3PBKA 4LE5A 3RG2A 4G36A 5K85A 4BBYA 2PROA 5AE2A 4LF7C 1T5HX 5IFIA 4DCTA 3KXWA 2VZEA 3A9UA 4RLFA 1O9TA 3GPCA 3IEUA 5LMNC 3A4IA 4DUYC 4GXQA 2XR1A 2CXCA 1WF3A 4D56A 4RVNA 1VLAA 4L7IA 1HR0C 4L2ZA 1MDFA 4RM3A 5KEIA 2OBVA 2E8CA 2P2BA 3GKUA 4MTNA 4B3RC 2P2FA 4R1MA 4BC7A 2OPLB 5T8TA 2E5LC 4GXRA 4I9GA 4LF6C 2UXDC 4XX2A 4NXMC 4DR2C 1K0RA 3AF6A 1LCIA 1MD9A 1GPMA 2E0GA 5CZVA 3NI2A 4JI5C 4RMNA 4DR4C 1FUGA 5AE3A 3GR1A 4WS9A 3UZ0A 2D1TA 1N36C 4FUQA 1PG3A 4DV3C 5BSWA 1USPB 3L95X 1EGAA 5AE1A 3NPDA 1N32C 1MXAA 2QL8A 3OTOC 1J5EC 3AF5A 3PESA 5T8SA 4GKJC 4JI4C 4JI6C 4DG8A 4FTFA 1XMOC 3CW9A 2YCBA 1T5DX 4LFAC 4K0BA 2VSQA 4KHPC 2JMPA 1XMQC 2UU9C 4TPSB 4JM1A 5BSMA 4X62C 4DV0C 1PA4A 3VNSA 2EGTA 3C5EA 4PHTA 1XRAA 3EERA 2YWBA 3T1HC 1RG9A 1FJGC 1XNRC 2P2QA 3DHVA 5H9UA 1O92A 2UUAC 5FLXD 5JRHA 2E8FA 5ADZA 3DLPX 1XRCA 4JYAC 4PROC 2HJGA 1V26A 1PG4A 2CY1A 4PZPA 4DV6C 3IMLA 4G37A 3GR0A 3S82A 2E7GA 1ULTA 2DYJA 4DG9A 5A2QD 4RLQA 2D1SA 1IBLC 2BH1X 2OPLA 1ZB8A 2Y4OA 3LGXA 2P2JA 4D57A 4LF8C 4G1IA 3CW8X 4JI0C 5BURA 4JI8C 1N2FA 4ZJZA 3LUSA 1RY2A 4LF4C 3LNVA 3J81D 5DV9A 5IWAC 3LAXA 4KTVA 5BSUA 3I07A 4DR6C 3VNRA 3IEVA 4DV4C 4R1LA 3T1YC 3NYQA 4MH4A 1JOSA 2AYAA 2QW0X 3FCEA 4JI1C 4JI2C 2VQEC 4DCVA 3TDEA 1ZB9A 4KTTA 3J80D 1IBKC 1WH9A 4X65C 2D1RA 4GKKC 4BC9A 5BR8C 4LF5C 3R9XA 3SO4A 2ZM6C 4LF9C 4IZ6A 4RM2A 2Y4NA 2D28C 1XNQC 4NDNA 4DV5C 4NOZA 4DV7C 4OYCA 4YY3C 1O93A 1NYEA 5GTDA 4AQYC 1I94C 3VNQA 2D1QA 2PT7G 5BUSA 5KYTA 4X66C 1MKYA 5A1GA 4YHHC 4HPVA 4ZLPA 4DR1C 1AMUA 3B7WA 5K8FA 4K0KC 2ASBA 4JV5C 2P2MA 2HHHC 4BCAA 5BSTA 3UOWA 2D7VA 4OXIA 4DUZC 1HNWC 1N34C 3DAYA 2UUCC 4RVOA 4DR5C 1UKKA 4X64C 3TUFA 3TQIA 4B3TC 1XRBA 4U5YD 4NXNC 2QVXX 4L4QA 3R44A 3I08A 1O90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOS A;  2QL8 A;  3OTO C;  1N33 C;  1J5E C;  1IBM C;  3AF5 A;  4JI1 C;  4JI2 C;  2VQE C;  4DCV A;  1KKG A;  1HH2 P;  1LQL A;  4GKJ C;  4JI4 C;  1ZB9 A;  2PN2 A;  4JI6 C;  3J80 D;  3J7A D;  1IBK C;  1USP A;  1XMO C;  1WH9 A;  5IT9 D;  4X65 C;  2YCB A;  3JAM D;  3R9W A;  4GKK C;  5BR8 C;  4LF5 C;  4LFA C;  2UXB C;  3R9X A;  2ZM6 C;  4LF9 C;  4KHP C;  2VQF C;  4LF7 C;  2UUB C;  2JMP A;  1XNQ C;  2F4V C;  1XMQ C;  1HNZ C;  2UU9 C;  4DR3 C;  4B3M C;  4DCT A;  4DV5 C;  4X62 C;  4DV0 C;  1PA4 A;  3IEU A;  4NOZ A;  5LMN C;  4DV7 C;  4YY3 C;  2EGT A;  4DUY C;  1NYE A;  2XR1 A;  2CXC A;  3CJE A;  3EER A;  1WF3 A;  4AQY C;  3T1H C;  1FJG C;  1XNR C;  2UXC C;  1I94 C;  4OX9 C;  1VLA A;  2UUA C;  5FLX D;  1HR0 C;  4DV2 C;  1L2F A;  2E8F A;  4JYA C;  2ONF A;  2PT7 G;  4DV1 C;  2E8C A;  2HJG A;  3GKU A;  4X66 C;  1ML8 A;  1MKY A;  4MTN A;  2CY1 A;  2KZF A;  4B3R C;  4YHH C;  2ATW A;  4DV6 C;  4BSZ A;  2OPL B;  4DR1 C;  2E7G A;  4LFC C;  2E5L C;  1QWI A;  2DYJ A;  4K0K C;  5A2Q D;  2ASB A;  4LF6 C;  1IBL C;  4JV5 C;  2UXD C;  2HHH C;  4XX2 A;  4NXM C;  4DR2 C;  2OPL A;  1ZB8 A;  1K0R A;  3AF6 A;  2E8E A;  1HNX C;  2D7V A;  4DUZ C;  4LF8 C;  4JI5 C;  1N34 C;  1HNW C;  4JI7 C;  2BJO A;  4B3S C;  4JI0 C;  4DR4 C;  2UUC C;  4JI8 C;  1N2F A;  4DR5 C;  1UKK A;  3LUS A;  4JI3 C;  4DCS A;  4LF4 C;  4X64 C;  3J81 D;  5IWA C;  4LFB C;  1N36 C;  4DV3 C;  1USP B;  4B3T C;  3I07 A;  5LMU C;  4DR6 C;  4NXN C;  3IEV A;  1EGA A;  4DV4 C;  4DCU A;  4DR7 C;  1N32 C;  3T1Y C;  4MH4 A; 
#chains in the Genus database with same CATH topology
 3A9V A;  3N2Q A;  2WP0 C;  5KYV A;  3E7W A;  3J7A D;  3E7X A;  1MDB A;  1USP A;  3G7S A;  5E7Q A;  5IT9 D;  3JAM D;  1P7L A;  3R9W A;  2PG1 E;  5BSR A;  5BUQ A;  2UXB C;  2Y27 A;  2VQF C;  2UUB C;  2V7B A;  2F4V C;  1HNZ C;  4B3M C;  4DR3 C;  4GS5 A;  1P4E A;  2NCL A;  2YX1 A;  1QM4 A;  2P20 A;  4ODJ A;  1BA3 A;  3RV2 A;  3EQ6 A;  3CJE A;  4FUT A;  2UXC C;  4OX9 C;  1YJ7 A;  2WD9 A;  4DV2 C;  1L2F A;  2QVY X;  3N54 B;  2ONF A;  4DV1 C;  1ML8 A;  2KZF A;  2DPL A;  2ATW A;  3FM7 A;  2MMA B;  4BSZ A;  3TR3 A;  4LFC C;  2YWC A;  1QWI A;  5BSV A;  4PUG A;  3PRO C;  1HNX C;  2E8E A;  3AY0 A;  3NYR A;  1MXB A;  3O2E A;  4JI7 C;  4WV3 A;  2BJO A;  4B3S C;  3ETO A;  3IPL A;  4EAT A;  1V25 A;  4JI3 C;  4DCS A;  2M5H A;  4D4I A;  4R0M A;  4IR7 A;  5CZX A;  4LFB C;  2P02 A;  2OO4 A;  3H2T A;  1MXC A;  4ISB A;  5LMU C;  3FCC A;  4DCU A;  4DR7 C;  3L8C A;  1N33 C;  1IBM C;  5A1I A;  1KKG A;  1HH2 P;  2D27 A;  1LQL A;  5A19 A;  2PN2 A;  4D4G A;  4I9F A;  2DHM A;  2QVZ X;  3ETC A;  3PBK A;  4LE5 A;  3RG2 A;  4G36 A;  5K85 A;  4BBY A;  2PRO A;  5AE2 A;  4LF7 C;  1T5H X;  5IFI A;  1TH5 A;  4DCT A;  3KXW A;  2ZZM A;  2VZE A;  3A9U A;  4RLF A;  1O9T A;  3GPC A;  3IEU A;  5LMN C;  3A4I A;  4DUY C;  1NY8 A;  2MM9 A;  4GXQ A;  2XR1 A;  2CXC A;  1WF3 A;  4D56 A;  4RVN A;  3A26 A;  1VLA A;  4L7I A;  1HR0 C;  4L2Z A;  1MDF A;  4RM3 A;  5KEI A;  2OBV A;  2E8C A;  2P2B A;  3GKU A;  4MTN A;  4B3R C;  2P2F A;  2KDN A;  4R1M A;  4BC7 A;  2OPL B;  5T8T A;  1FLO A;  2E5L C;  4GXR A;  1VEH A;  4I9G A;  4LF6 C;  2UXD C;  4XX2 A;  4NXM C;  4DR2 C;  1K0R A;  3AF6 A;  1LCI A;  1MD9 A;  3UEB A;  1GPM A;  2E0G A;  5CZV A;  3NI2 A;  4JI5 C;  4RMN A;  4DR4 C;  1FUG A;  5AE3 A;  2KZ0 A;  3GR1 A;  4WS9 A;  3UZ0 A;  2D1T A;  1N36 C;  4FUQ A;  1PG3 A;  4DV3 C;  5BSW A;  1USP B;  3L95 X;  1EGA A;  5AE1 A;  3NPD A;  1N32 C;  2Z51 A;  1MXA A;  2QL8 A;  3OTO C;  1J5E C;  3AF5 A;  3PES A;  1M6X A;  2ZZN A;  5T8S A;  4GKJ C;  4JI4 C;  4JI6 C;  1XHJ A;  4DG8 A;  4FTF A;  3K6R A;  1XMO C;  3CW9 A;  2YCB A;  2JNV A;  1T5D X;  4LFA C;  2CU6 A;  4K0B A;  2VSQ A;  4KHP C;  2JMP A;  4PUI A;  1XMQ C;  2UU9 C;  4TPS B;  4JM1 A;  5BSM A;  4X62 C;  4DV0 C;  1PA4 A;  3VNS A;  2EGT A;  3C5E A;  4PHT A;  1XRA A;  3EER A;  2YWB A;  3T1H C;  1RG9 A;  1FJG C;  1XNR C;  2P2Q A;  3DHV A;  1M6X C;  5H9U A;  1O92 A;  2UUA C;  5FLX D;  5JRH A;  2E8F A;  5ADZ A;  3DLP X;  1XRC A;  4JYA C;  4PRO C;  2HJG A;  1V26 A;  1PG4 A;  2CY1 A;  4PZP A;  4DV6 C;  3IML A;  4G37 A;  3GR0 A;  2ZTB A;  4PUH A;  3S82 A;  2E7G A;  1ULT A;  2DYJ A;  4DG9 A;  5A2Q D;  4RLQ A;  2D1S A;  1IBL C;  2BH1 X;  1IB8 A;  2OPL A;  1ZB8 A;  2Y4O A;  3LGX A;  2P2J A;  4D57 A;  4LF8 C;  4G1I A;  3CW8 X;  4JI0 C;  1YGT A;  1WCJ A;  5BUR A;  4JI8 C;  1N2F A;  4ZJZ A;  3LUS A;  1RY2 A;  4LF4 C;  3LNV A;  3J81 D;  5DV9 A;  1V60 A;  5IWA C;  3LAX A;  4KTV A;  5BSU A;  3I07 A;  4DR6 C;  3VNR A;  3IEV A;  4DV4 C;  4R1L A;  1XDX A;  3T1Y C;  3NYQ A;  4MH4 A;  1JOS A;  2AYA A;  2QW0 X;  3LNO A;  3FCE A;  4JI1 C;  4JI2 C;  2VQE C;  4DCV A;  3TDE A;  1ZB9 A;  4KTT A;  3J80 D;  1IBK C;  1PU1 A;  1WH9 A;  4X65 C;  2D1R A;  3CQ2 A;  4GKK C;  4BC9 A;  5BR8 C;  4LF5 C;  3R9X A;  3SO4 A;  2ZM6 C;  4LF9 C;  4IZ6 A;  4RM2 A;  2Y4N A;  2D28 C;  1XNQ C;  2M5O A;  4NDN A;  4DV5 C;  4NOZ A;  4DV7 C;  4OYC A;  4YY3 C;  1O93 A;  1NYE A;  5GTD A;  4AQY C;  3A25 A;  3UX3 A;  3UX2 A;  2MCQ A;  1I94 C;  5LCI A;  3VNQ A;  2D1Q A;  2PT7 G;  5BUS A;  5KYT A;  4X66 C;  1MKY A;  5A1G A;  3CQ3 A;  4YHH C;  4HPV A;  4ZLP A;  4DR1 C;  3CQ1 A;  1AMU A;  3B7W A;  5K8F A;  4K0K C;  2ASB A;  4JV5 C;  2P2M A;  2HHH C;  4BCA A;  5BST A;  3UOW A;  2D7V A;  1P4E C;  4OXI A;  1XS3 A;  4DUZ C;  1HNW C;  1N34 C;  3DAY A;  1UWD A;  2UUC C;  4RVO A;  4DR5 C;  1UKK A;  4X64 C;  3TUF A;  3TQI A;  4B3T C;  1XRB A;  4U5Y D;  4NXN C;  2QVX X;  4L4Q A;  3R44 A;  3I08 A;  1O90 A; 
#chains in the Genus database with same CATH homology
 3A9V A;  3N2Q A;  2WP0 C;  5KYV A;  3E7W A;  3J7A D;  3E7X A;  1MDB A;  1USP A;  3G7S A;  5E7Q A;  5IT9 D;  3JAM D;  1P7L A;  3R9W A;  5BSR A;  5BUQ A;  2UXB C;  2Y27 A;  2VQF C;  2UUB C;  2V7B A;  2F4V C;  1HNZ C;  4B3M C;  4DR3 C;  4GS5 A;  1QM4 A;  2P20 A;  4ODJ A;  1BA3 A;  3RV2 A;  3EQ6 A;  3CJE A;  4FUT A;  2UXC C;  4OX9 C;  1YJ7 A;  2WD9 A;  4DV2 C;  1L2F A;  2QVY X;  3N54 B;  2ONF A;  4DV1 C;  1ML8 A;  2KZF A;  2DPL A;  2ATW A;  4BSZ A;  4LFC C;  2YWC A;  1QWI A;  5BSV A;  3PRO C;  1HNX C;  2E8E A;  3NYR A;  1MXB A;  4JI7 C;  4WV3 A;  2BJO A;  4B3S C;  3ETO A;  3IPL A;  4EAT A;  1V25 A;  4JI3 C;  4DCS A;  4D4I A;  4R0M A;  4IR7 A;  5CZX A;  4LFB C;  2P02 A;  2OO4 A;  3H2T A;  1MXC A;  4ISB A;  5LMU C;  3FCC A;  4DCU A;  4DR7 C;  3L8C A;  1N33 C;  1IBM C;  5A1I A;  1KKG A;  1HH2 P;  2D27 A;  1LQL A;  5A19 A;  2PN2 A;  4D4G A;  4I9F A;  2QVZ X;  3ETC A;  3PBK A;  4LE5 A;  3RG2 A;  4G36 A;  5K85 A;  4BBY A;  2PRO A;  5AE2 A;  4LF7 C;  1T5H X;  5IFI A;  4DCT A;  3KXW A;  2VZE A;  3A9U A;  4RLF A;  1O9T A;  3GPC A;  3IEU A;  5LMN C;  3A4I A;  4DUY C;  4GXQ A;  2XR1 A;  2CXC A;  1WF3 A;  4D56 A;  4RVN A;  1VLA A;  4L7I A;  1HR0 C;  4L2Z A;  1MDF A;  4RM3 A;  5KEI A;  2OBV A;  2E8C A;  2P2B A;  3GKU A;  4MTN A;  4B3R C;  2P2F A;  4R1M A;  4BC7 A;  2OPL B;  5T8T A;  2E5L C;  4GXR A;  4I9G A;  4LF6 C;  2UXD C;  4XX2 A;  4NXM C;  4DR2 C;  1K0R A;  3AF6 A;  1LCI A;  1MD9 A;  1GPM A;  2E0G A;  5CZV A;  3NI2 A;  4JI5 C;  4RMN A;  4DR4 C;  1FUG A;  5AE3 A;  3GR1 A;  4WS9 A;  3UZ0 A;  2D1T A;  1N36 C;  4FUQ A;  1PG3 A;  4DV3 C;  5BSW A;  1USP B;  3L95 X;  1EGA A;  5AE1 A;  3NPD A;  1N32 C;  1MXA A;  2QL8 A;  3OTO C;  1J5E C;  3AF5 A;  3PES A;  5T8S A;  4GKJ C;  4JI4 C;  4JI6 C;  4DG8 A;  4FTF A;  1XMO C;  3CW9 A;  2YCB A;  1T5D X;  4LFA C;  4K0B A;  2VSQ A;  4KHP C;  2JMP A;  1XMQ C;  2UU9 C;  4TPS B;  4JM1 A;  5BSM A;  4X62 C;  4DV0 C;  1PA4 A;  3VNS A;  2EGT A;  3C5E A;  4PHT A;  1XRA A;  3EER A;  2YWB A;  3T1H C;  1RG9 A;  1FJG C;  1XNR C;  2P2Q A;  3DHV A;  5H9U A;  1O92 A;  2UUA C;  5FLX D;  5JRH A;  2E8F A;  5ADZ A;  3DLP X;  1XRC A;  4JYA C;  4PRO C;  2HJG A;  1V26 A;  1PG4 A;  2CY1 A;  4PZP A;  4DV6 C;  3IML A;  4G37 A;  3GR0 A;  3S82 A;  2E7G A;  1ULT A;  2DYJ A;  4DG9 A;  5A2Q D;  4RLQ A;  2D1S A;  1IBL C;  2BH1 X;  2OPL A;  1ZB8 A;  2Y4O A;  3LGX A;  2P2J A;  4D57 A;  4LF8 C;  4G1I A;  3CW8 X;  4JI0 C;  5BUR A;  4JI8 C;  1N2F A;  4ZJZ A;  3LUS A;  1RY2 A;  4LF4 C;  3LNV A;  3J81 D;  5DV9 A;  5IWA C;  3LAX A;  4KTV A;  5BSU A;  3I07 A;  4DR6 C;  3VNR A;  3IEV A;  4DV4 C;  4R1L A;  3T1Y C;  3NYQ A;  4MH4 A;  1JOS A;  2AYA A;  2QW0 X;  3FCE A;  4JI1 C;  4JI2 C;  2VQE C;  4DCV A;  3TDE A;  1ZB9 A;  4KTT A;  3J80 D;  1IBK C;  1WH9 A;  4X65 C;  2D1R A;  4GKK C;  4BC9 A;  5BR8 C;  4LF5 C;  3R9X A;  3SO4 A;  2ZM6 C;  4LF9 C;  4IZ6 A;  4RM2 A;  2Y4N A;  2D28 C;  1XNQ C;  4NDN A;  4DV5 C;  4NOZ A;  4DV7 C;  4OYC A;  4YY3 C;  1O93 A;  1NYE A;  5GTD A;  4AQY C;  1I94 C;  3VNQ A;  2D1Q A;  2PT7 G;  5BUS A;  5KYT A;  4X66 C;  1MKY A;  5A1G A;  4YHH C;  4HPV A;  4ZLP A;  4DR1 C;  1AMU A;  3B7W A;  5K8F A;  4K0K C;  2ASB A;  4JV5 C;  2P2M A;  2HHH C;  4BCA A;  5BST A;  3UOW A;  2D7V A;  4OXI A;  4DUZ C;  1HNW C;  1N34 C;  3DAY A;  2UUC C;  4RVO A;  4DR5 C;  1UKK A;  4X64 C;  3TUF A;  3TQI A;  4B3T C;  1XRB A;  4U5Y D;  4NXN C;  2QVX X;  4L4Q A;  3R44 A;  3I08 A;  1O90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...