4DUYC

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 50
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4duyC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4duyC02
1FJGC 1XMOC 4MH4A 1VLAA 4X64C 3J80D 2E5LC 1HNWC 4XX2A 3R9WA 2F4VC 4DV0C 4AQYC 4DR4C 4GKJC 4B3MC 1HNXC 3OTOC 1L2FA 2UU9C 4JI0C 4DR5C 2UXBC 2E7GA 2DYJA 1WH9A 2E8CA 4LF7C 2ASBA 3IEUA 2ONFA 3EERA 2XR1A 2HHHC 2UUCC 2CY1A 4DV3C 2JMPA 4DV6C 1XNQC 4DV2C 5FLXD 3AF6A 4DV7C 5IWAC 5LMUC 4DR6C 3JAMD 4JV5C 3AF5A 2QL8A 2HJGA 3J7AD 1IBLC 5A2QD 3T1YC 1QWIA 1PA4A 4LF9C 4DR7C 1N32C 4YY3C 5BR8C 4DV5C 4X66C 1I94C 1K0RA 1N2FA 1J5EC 1WF3A 4DCUA 4JI1C 1XNRC 5LMNC 3I07A 4JI7C 1N36C 4LF8C 4MTNA 4JI4C 4DR1C 4OX9C 1HH2P 1USPA 4DCSA 4YHHC 4DV4C 4LF5C 4NXNC 1UKKA 4B3SC 4JI6C 4DR2C 4X65C 1NYEA 2UUAC 4X62C 4DCTA 2VQFC 4DCVA 2UXCC 2OPLB 2UUBC 4B3RC 1EGAA 1HR0C 1IBMC 1HNZC 4JI5C 2PT7G 3R9XA 2BJOA 4LF4C 3CJEA 4JI2C 1LQLA 4LFCC 4LF6C 1USPB 3GKUA 1ML8A 3IEVA 1N33C 4JI8C 2E8FA 4BSZA 3J81D 1N34C 1XMQC 2UXDC 4DUZC 4KHPC 4DR3C 4JI3C 2KZFA 4DUYC 2E8EA 1IBKC 4GKKC 2D7VA 4K0KC 2OPLA 2VQEC 2ATWA 1ZB8A 1JOSA 3T1HC 1KKGA 3LUSA 4LFAC 1ZB9A 2YCBA 4NXMC 4DV1C 2PN2A 2EGTA 2CXCA 2ZM6C 4LFBC 4JYAC 4B3TC 4NOZA 5IT9D 1MKYA
chains in the Genus database with same CATH superfamily
4AQYC 2QVXX 4B3MC 1P7LA 4D4IA 4OYCA 4DR5C 4PHTA 3RG2A 2DYJA 4NDNA 2WP0C 4FUTA 2UUCC 3S82A 2JMPA 3H2TA 4DG9A 4TPSB 5IWAC 4JV5C 2HJGA 2Y4NA 1IBLC 3T1YC 2CU6A 2KDNA 4DV5C 4RM2A 3VNQA 2D1TA 1RG9A 1V26A 1J5EC 4K0BA 2PG1E 1XRAA 3NI2A 2D28C 1N36C 4FUQA 4MTNA 3E7WA 4YHHC 4LF5C 5BSUA 4NXNC 4B3SC 1M6XA 1NYEA 2UUAC 4D4GA 1YGTA 4X62C 4DCVA 2UXCC 2QW0X 4D57A 3LNVA 3PROC 3UEBA 2YWCA 2BJOA 5AE1A 2P02A 3DHVA 1MD9A 3NPDA 3UX2A 1USPB 1V60A 2OBVA 1N33C 4JI8C 3J81D 1MXCA 4GKKC 2OPLA 5GTDA 2P2MA 2Y27A 2P20A 3PBKA 1JOSA 1ZB9A 1FLOA 4ZJZA 4D56A 2PN2A 2CXCA 5T8TA 4LFBC 5IFIA 4G1IA 4X64C 1M6XC 1HNWC 4WV3A 5AE2A 3FM7A 4PUIA 4JI0C 3B7WA 2QVYX 5KEIA 4L4QA 5A1GA 5A19A 2CY1A 1O9TA 3JAMD 4L7IA 1IB8A 3AF5A 2MCQA 4G36A 1PA4A 1UWDA 3TUFA 1N32C 4G37A 4YY3C 4X66C 1I94C 1WF3A 3L8CA 4GXQA 2ZZMA 3FCCA 1XRBA 1TH5A 5BSMA 5ADZA 4R1LA 1HH2P 4DCSA 1XDXA 4DR2C 3CQ3A 4X65C 5BUSA 1FUGA 3TDEA 4RM3A 3I08A 2VQFC 2UUBC 2VSQA 1HR0C 5E7QA 2ZZNA 1XRCA 3FCEA 4JI5C 4KTVA 1O90A 3C5EA 2AYAA 3K6RA 2WD9A 4JI2C 4RVOA 2M5OA 4I9GA 3UOWA 3IEVA 4JM1A 1XMQC 2YX1A 4BCAA 4DG8A 4KHPC 5DV9A 2MM9A 4DUYC 1IBKC 2D7VA 1P4EC 2ATWA 1BA3A 1LCIA 1KKGA 4R1MA 3LUSA 2OO4A 2YCBA 4DV1C 1P4EA 2ZM6C 4I9FA 4B3TC 4DV7C 1MKYA 4RLFA 4OXIA 4MH4A 3J80D 2E5LC 4XX2A 3R9WA 1T5DX 4DV0C 4DR4C 4GKJC 1RY2A 3OTOC 4ODJA 3IPLA 3DAYA 5BSRA 2M5HA 2E8CA 5H9UA 4LF7C 3IMLA 3IEUA 2DPLA 2XR1A 4PZPA 2HHHC 2D1RA 3G7SA 3E7XA 4DV6C 3N2QA 1XNQC 4DV2C 3ETCA 5FLXD 5LMUC 1QWIA 3KXWA 4PROC 1MXAA 1ULTA 4LF9C 1K0RA 1N2FA 2D1SA 2BH1X 4JI1C 2P2FA 3L95X 4LF8C 3CW8X 2QVZX 1XS3A 4RLQA 3VNRA 4DR1C 4OX9C 1USPA 4DV4C 3AY0A 1UKKA 1WCJA 3NYRA 4LE5A 1MDFA 5K8FA 2OPLB 1IBMC 3LNOA 4ISBA 4U5YD 1PG4A 3GR1A 4LF4C 3ETOA 3CJEA 4LFCC 4GS5A 3GKUA 5LCIA 4RVNA 2E0GA 4RMNA 2E8FA 3TR3A 2Y4OA 5K85A 2UXDC 4IR7A 3GR0A 1XHJA 3UZ0A 1ZB8A 2DHMA 3T1HC 4GXRA 4PUGA 4PUHA 5KYTA 5BSTA 4LFAC 4NXMC 3VNSA 5BURA 4JYAC 4NOZA 5IT9D 1FJGC 1XMOC 1VLAA 1MDBA 1O93A 4WS9A 1V25A 2F4VC 3DLPX 1HNXC 1MXBA 1L2FA 2Z51A 2UU9C 3PESA 2UXBC 2VZEA 2E7GA 2D1QA 3SO4A 1WH9A 2PROA 5CZXA 3NYQA 2ASBA 2ONFA 3EERA 4KTTA 3N54B 5KYVA 4DV3C 4FTFA 2KZ0A 3AF6A 1T5HX 4DR6C 4L2ZA 2QL8A 3J7AD 5A2QD 3EQ6A 4DR7C 3RV2A 5BR8C 4IZ6A 3CW9A 5A1IA 4DCUA 3LGXA 1XNRC 5LMNC 1NY8A 3I07A 4JI7C 4EATA 3UX3A 3GPCA 1PG3A 1YJ7A 4JI4C 2V7BA 5CZVA 4JI6C 1GPMA 3LAXA 4DCTA 5BSWA 1VEHA 4B3RC 1EGAA 2YWBA 3CQ1A 2P2QA 4BC7A 3A9VA 2NCLA 1HNZC 3A25A 2ZTBA 2JNVA 2PT7G 3A4IA 3R9XA 3A9UA 4BC9A 2P2BA 1LQLA 3O2EA 1PU1A 2P2JA 4LF6C 1ML8A 5JRHA 1QM4A 4BSZA 5BSVA 3R44A 3TQIA 1N34C 5BUQA 5T8SA 4DUZC 4DR3C 4JI3C 4BBYA 2KZFA 2E8EA 4K0KC 2VQEC 3A26A 5AE3A 2MMAB 1O92A 1AMUA 4HPVA 2D27A 2EGTA 4ZLPA 4R0MA 3CQ2A
chains in the Genus database with same CATH topology
4AQYC 2QVXX 4B3MC 1P7LA 4D4IA 4OYCA 4DR5C 4PHTA 3RG2A 2DYJA 4NDNA 2WP0C 4FUTA 2UUCC 3S82A 2JMPA 3H2TA 4DG9A 4TPSB 5IWAC 4JV5C 2HJGA 2Y4NA 1IBLC 3T1YC 4DV5C 4RM2A 3VNQA 2D1TA 1RG9A 1V26A 1J5EC 4K0BA 1XRAA 3NI2A 2D28C 1N36C 4FUQA 4MTNA 3E7WA 4YHHC 4LF5C 5BSUA 4NXNC 4B3SC 1NYEA 2UUAC 4D4GA 4X62C 4DCVA 2UXCC 2QW0X 4D57A 3LNVA 3PROC 2YWCA 2BJOA 5AE1A 2P02A 3DHVA 1MD9A 3NPDA 1USPB 2OBVA 1N33C 4JI8C 3J81D 1MXCA 4GKKC 2OPLA 5GTDA 2P2MA 2Y27A 2P20A 3PBKA 1JOSA 1ZB9A 4ZJZA 4D56A 2PN2A 2CXCA 5T8TA 4LFBC 5IFIA 4G1IA 4X64C 1HNWC 4WV3A 5AE2A 4JI0C 3B7WA 2QVYX 5KEIA 4L4QA 5A1GA 5A19A 2CY1A 1O9TA 3JAMD 4L7IA 3AF5A 4G36A 1PA4A 3TUFA 1N32C 4G37A 4YY3C 4X66C 1I94C 1WF3A 3L8CA 4GXQA 3FCCA 1XRBA 5BSMA 5ADZA 4R1LA 1HH2P 4DCSA 4DR2C 4X65C 5BUSA 1FUGA 3TDEA 4RM3A 3I08A 2VQFC 2UUBC 2VSQA 1HR0C 5E7QA 1XRCA 3FCEA 4JI5C 4KTVA 1O90A 3C5EA 2AYAA 2WD9A 4JI2C 4RVOA 4I9GA 3UOWA 3IEVA 4JM1A 1XMQC 4BCAA 4DG8A 4KHPC 5DV9A 4DUYC 1IBKC 2D7VA 2ATWA 1BA3A 1LCIA 1KKGA 4R1MA 3LUSA 2OO4A 2YCBA 4DV1C 2ZM6C 4I9FA 4B3TC 4DV7C 1MKYA 4RLFA 4OXIA 4MH4A 3J80D 2E5LC 4XX2A 3R9WA 1T5DX 4DV0C 4DR4C 4GKJC 1RY2A 3OTOC 4ODJA 3IPLA 3DAYA 5BSRA 2E8CA 5H9UA 4LF7C 3IMLA 3IEUA 2DPLA 2XR1A 4PZPA 2HHHC 2D1RA 3G7SA 3E7XA 4DV6C 3N2QA 1XNQC 4DV2C 3ETCA 5FLXD 5LMUC 1QWIA 3KXWA 4PROC 1MXAA 1ULTA 4LF9C 1K0RA 1N2FA 2D1SA 2BH1X 4JI1C 2P2FA 3L95X 4LF8C 3CW8X 2QVZX 4RLQA 3VNRA 4DR1C 4OX9C 1USPA 4DV4C 1UKKA 3NYRA 4LE5A 1MDFA 5K8FA 2OPLB 1IBMC 4ISBA 4U5YD 1PG4A 3GR1A 4LF4C 3ETOA 3CJEA 4LFCC 4GS5A 3GKUA 4RVNA 2E0GA 4RMNA 2E8FA 2Y4OA 5K85A 2UXDC 4IR7A 3GR0A 3UZ0A 1ZB8A 3T1HC 4GXRA 5KYTA 5BSTA 4LFAC 4NXMC 3VNSA 5BURA 4JYAC 4NOZA 5IT9D 1FJGC 1XMOC 1VLAA 1MDBA 1O93A 4WS9A 1V25A 2F4VC 3DLPX 1HNXC 1MXBA 1L2FA 2UU9C 3PESA 2UXBC 2VZEA 2E7GA 2D1QA 3SO4A 1WH9A 2PROA 5CZXA 3NYQA 2ASBA 2ONFA 3EERA 4KTTA 3N54B 5KYVA 4DV3C 4FTFA 3AF6A 1T5HX 4DR6C 4L2ZA 2QL8A 3J7AD 5A2QD 3EQ6A 4DR7C 3RV2A 5BR8C 4IZ6A 3CW9A 5A1IA 4DCUA 3LGXA 1XNRC 5LMNC 3I07A 4JI7C 4EATA 3GPCA 1PG3A 1YJ7A 4JI4C 2V7BA 5CZVA 4JI6C 1GPMA 3LAXA 4DCTA 5BSWA 4B3RC 1EGAA 2YWBA 2P2QA 4BC7A 3A9VA 1HNZC 2PT7G 3A4IA 3R9XA 3A9UA 4BC9A 2P2BA 1LQLA 2P2JA 4LF6C 1ML8A 5JRHA 1QM4A 4BSZA 5BSVA 3R44A 3TQIA 1N34C 5BUQA 5T8SA 4DUZC 4DR3C 4JI3C 4BBYA 2KZFA 2E8EA 4K0KC 2VQEC 5AE3A 1O92A 1AMUA 4HPVA 2D27A 2EGTA 4ZLPA 4R0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG C;  1XMO C;  4MH4 A;  1VLA A;  4X64 C;  3J80 D;  2E5L C;  1HNW C;  4XX2 A;  3R9W A;  2F4V C;  4DV0 C;  4AQY C;  4DR4 C;  4GKJ C;  4B3M C;  1HNX C;  3OTO C;  1L2F A;  2UU9 C;  4JI0 C;  4DR5 C;  2UXB C;  2E7G A;  2DYJ A;  1WH9 A;  2E8C A;  4LF7 C;  2ASB A;  3IEU A;  2ONF A;  3EER A;  2XR1 A;  2HHH C;  2UUC C;  2CY1 A;  4DV3 C;  2JMP A;  4DV6 C;  1XNQ C;  4DV2 C;  5FLX D;  3AF6 A;  4DV7 C;  5IWA C;  5LMU C;  4DR6 C;  3JAM D;  4JV5 C;  3AF5 A;  2QL8 A;  2HJG A;  3J7A D;  1IBL C;  5A2Q D;  3T1Y C;  1QWI A;  1PA4 A;  4LF9 C;  4DR7 C;  1N32 C;  4YY3 C;  5BR8 C;  4DV5 C;  4X66 C;  1I94 C;  1K0R A;  1N2F A;  1J5E C;  1WF3 A;  4DCU A;  4JI1 C;  1XNR C;  5LMN C;  3I07 A;  4JI7 C;  1N36 C;  4LF8 C;  4MTN A;  4JI4 C;  4DR1 C;  4OX9 C;  1HH2 P;  1USP A;  4DCS A;  4YHH C;  4DV4 C;  4LF5 C;  4NXN C;  1UKK A;  4B3S C;  4JI6 C;  4DR2 C;  4X65 C;  1NYE A;  2UUA C;  4X62 C;  4DCT A;  2VQF C;  4DCV A;  2UXC C;  2OPL B;  2UUB C;  4B3R C;  1EGA A;  1HR0 C;  1IBM C;  1HNZ C;  4JI5 C;  2PT7 G;  3R9X A;  2BJO A;  4LF4 C;  3CJE A;  4JI2 C;  1LQL A;  4LFC C;  4LF6 C;  1USP B;  3GKU A;  1ML8 A;  3IEV A;  1N33 C;  4JI8 C;  2E8F A;  4BSZ A;  3J81 D;  1N34 C;  1XMQ C;  2UXD C;  4DUZ C;  4KHP C;  4DR3 C;  4JI3 C;  2KZF A;  4DUY C;  2E8E A;  1IBK C;  4GKK C;  2D7V A;  4K0K C;  2OPL A;  2VQE C;  2ATW A;  1ZB8 A;  1JOS A;  3T1H C;  1KKG A;  3LUS A;  4LFA C;  1ZB9 A;  2YCB A;  4NXM C;  4DV1 C;  2PN2 A;  2EGT A;  2CXC A;  2ZM6 C;  4LFB C;  4JYA C;  4B3T C;  4NOZ A;  5IT9 D;  1MKY A; 
#chains in the Genus database with same CATH topology
 4AQY C;  2QVX X;  4B3M C;  1P7L A;  4D4I A;  4OYC A;  4DR5 C;  4PHT A;  3RG2 A;  2DYJ A;  4NDN A;  2WP0 C;  4FUT A;  2UUC C;  3S82 A;  2JMP A;  3H2T A;  4DG9 A;  4TPS B;  5IWA C;  4JV5 C;  2HJG A;  2Y4N A;  1IBL C;  3T1Y C;  2CU6 A;  2KDN A;  4DV5 C;  4RM2 A;  3VNQ A;  2D1T A;  1RG9 A;  1V26 A;  1J5E C;  4K0B A;  2PG1 E;  1XRA A;  3NI2 A;  2D28 C;  1N36 C;  4FUQ A;  4MTN A;  3E7W A;  4YHH C;  4LF5 C;  5BSU A;  4NXN C;  4B3S C;  1M6X A;  1NYE A;  2UUA C;  4D4G A;  1YGT A;  4X62 C;  4DCV A;  2UXC C;  2QW0 X;  4D57 A;  3LNV A;  3PRO C;  3UEB A;  2YWC A;  2BJO A;  5AE1 A;  2P02 A;  3DHV A;  1MD9 A;  3NPD A;  3UX2 A;  1USP B;  1V60 A;  2OBV A;  1N33 C;  4JI8 C;  3J81 D;  1MXC A;  4GKK C;  2OPL A;  5GTD A;  2P2M A;  2Y27 A;  2P20 A;  3PBK A;  1JOS A;  1ZB9 A;  1FLO A;  4ZJZ A;  4D56 A;  2PN2 A;  2CXC A;  5T8T A;  4LFB C;  5IFI A;  4G1I A;  4X64 C;  1M6X C;  1HNW C;  4WV3 A;  5AE2 A;  3FM7 A;  4PUI A;  4JI0 C;  3B7W A;  2QVY X;  5KEI A;  4L4Q A;  5A1G A;  5A19 A;  2CY1 A;  1O9T A;  3JAM D;  4L7I A;  1IB8 A;  3AF5 A;  2MCQ A;  4G36 A;  1PA4 A;  1UWD A;  3TUF A;  1N32 C;  4G37 A;  4YY3 C;  4X66 C;  1I94 C;  1WF3 A;  3L8C A;  4GXQ A;  2ZZM A;  3FCC A;  1XRB A;  1TH5 A;  5BSM A;  5ADZ A;  4R1L A;  1HH2 P;  4DCS A;  1XDX A;  4DR2 C;  3CQ3 A;  4X65 C;  5BUS A;  1FUG A;  3TDE A;  4RM3 A;  3I08 A;  2VQF C;  2UUB C;  2VSQ A;  1HR0 C;  5E7Q A;  2ZZN A;  1XRC A;  3FCE A;  4JI5 C;  4KTV A;  1O90 A;  3C5E A;  2AYA A;  3K6R A;  2WD9 A;  4JI2 C;  4RVO A;  2M5O A;  4I9G A;  3UOW A;  3IEV A;  4JM1 A;  1XMQ C;  2YX1 A;  4BCA A;  4DG8 A;  4KHP C;  5DV9 A;  2MM9 A;  4DUY C;  1IBK C;  2D7V A;  1P4E C;  2ATW A;  1BA3 A;  1LCI A;  1KKG A;  4R1M A;  3LUS A;  2OO4 A;  2YCB A;  4DV1 C;  1P4E A;  2ZM6 C;  4I9F A;  4B3T C;  4DV7 C;  1MKY A;  4RLF A;  4OXI A;  4MH4 A;  3J80 D;  2E5L C;  4XX2 A;  3R9W A;  1T5D X;  4DV0 C;  4DR4 C;  4GKJ C;  1RY2 A;  3OTO C;  4ODJ A;  3IPL A;  3DAY A;  5BSR A;  2M5H A;  2E8C A;  5H9U A;  4LF7 C;  3IML A;  3IEU A;  2DPL A;  2XR1 A;  4PZP A;  2HHH C;  2D1R A;  3G7S A;  3E7X A;  4DV6 C;  3N2Q A;  1XNQ C;  4DV2 C;  3ETC A;  5FLX D;  5LMU C;  1QWI A;  3KXW A;  4PRO C;  1MXA A;  1ULT A;  4LF9 C;  1K0R A;  1N2F A;  2D1S A;  2BH1 X;  4JI1 C;  2P2F A;  3L95 X;  4LF8 C;  3CW8 X;  2QVZ X;  1XS3 A;  4RLQ A;  3VNR A;  4DR1 C;  4OX9 C;  1USP A;  4DV4 C;  3AY0 A;  1UKK A;  1WCJ A;  3NYR A;  4LE5 A;  1MDF A;  5K8F A;  2OPL B;  1IBM C;  3LNO A;  4ISB A;  4U5Y D;  1PG4 A;  3GR1 A;  4LF4 C;  3ETO A;  3CJE A;  4LFC C;  4GS5 A;  3GKU A;  5LCI A;  4RVN A;  2E0G A;  4RMN A;  2E8F A;  3TR3 A;  2Y4O A;  5K85 A;  2UXD C;  4IR7 A;  3GR0 A;  1XHJ A;  3UZ0 A;  1ZB8 A;  2DHM A;  3T1H C;  4GXR A;  4PUG A;  4PUH A;  5KYT A;  5BST A;  4LFA C;  4NXM C;  3VNS A;  5BUR A;  4JYA C;  4NOZ A;  5IT9 D;  1FJG C;  1XMO C;  1VLA A;  1MDB A;  1O93 A;  4WS9 A;  1V25 A;  2F4V C;  3DLP X;  1HNX C;  1MXB A;  1L2F A;  2Z51 A;  2UU9 C;  3PES A;  2UXB C;  2VZE A;  2E7G A;  2D1Q A;  3SO4 A;  1WH9 A;  2PRO A;  5CZX A;  3NYQ A;  2ASB A;  2ONF A;  3EER A;  4KTT A;  3N54 B;  5KYV A;  4DV3 C;  4FTF A;  2KZ0 A;  3AF6 A;  1T5H X;  4DR6 C;  4L2Z A;  2QL8 A;  3J7A D;  5A2Q D;  3EQ6 A;  4DR7 C;  3RV2 A;  5BR8 C;  4IZ6 A;  3CW9 A;  5A1I A;  4DCU A;  3LGX A;  1XNR C;  5LMN C;  1NY8 A;  3I07 A;  4JI7 C;  4EAT A;  3UX3 A;  3GPC A;  1PG3 A;  1YJ7 A;  4JI4 C;  2V7B A;  5CZV A;  4JI6 C;  1GPM A;  3LAX A;  4DCT A;  5BSW A;  1VEH A;  4B3R C;  1EGA A;  2YWB A;  3CQ1 A;  2P2Q A;  4BC7 A;  3A9V A;  2NCL A;  1HNZ C;  3A25 A;  2ZTB A;  2JNV A;  2PT7 G;  3A4I A;  3R9X A;  3A9U A;  4BC9 A;  2P2B A;  1LQL A;  3O2E A;  1PU1 A;  2P2J A;  4LF6 C;  1ML8 A;  5JRH A;  1QM4 A;  4BSZ A;  5BSV A;  3R44 A;  3TQI A;  1N34 C;  5BUQ A;  5T8S A;  4DUZ C;  4DR3 C;  4JI3 C;  4BBY A;  2KZF A;  2E8E A;  4K0K C;  2VQE C;  3A26 A;  5AE3 A;  2MMA B;  1O92 A;  1AMU A;  4HPV A;  2D27 A;  2EGT A;  4ZLP A;  4R0M A;  3CQ2 A; 
#chains in the Genus database with same CATH homology
 4AQY C;  2QVX X;  4B3M C;  1P7L A;  4D4I A;  4OYC A;  4DR5 C;  4PHT A;  3RG2 A;  2DYJ A;  4NDN A;  2WP0 C;  4FUT A;  2UUC C;  3S82 A;  2JMP A;  3H2T A;  4DG9 A;  4TPS B;  5IWA C;  4JV5 C;  2HJG A;  2Y4N A;  1IBL C;  3T1Y C;  4DV5 C;  4RM2 A;  3VNQ A;  2D1T A;  1RG9 A;  1V26 A;  1J5E C;  4K0B A;  1XRA A;  3NI2 A;  2D28 C;  1N36 C;  4FUQ A;  4MTN A;  3E7W A;  4YHH C;  4LF5 C;  5BSU A;  4NXN C;  4B3S C;  1NYE A;  2UUA C;  4D4G A;  4X62 C;  4DCV A;  2UXC C;  2QW0 X;  4D57 A;  3LNV A;  3PRO C;  2YWC A;  2BJO A;  5AE1 A;  2P02 A;  3DHV A;  1MD9 A;  3NPD A;  1USP B;  2OBV A;  1N33 C;  4JI8 C;  3J81 D;  1MXC A;  4GKK C;  2OPL A;  5GTD A;  2P2M A;  2Y27 A;  2P20 A;  3PBK A;  1JOS A;  1ZB9 A;  4ZJZ A;  4D56 A;  2PN2 A;  2CXC A;  5T8T A;  4LFB C;  5IFI A;  4G1I A;  4X64 C;  1HNW C;  4WV3 A;  5AE2 A;  4JI0 C;  3B7W A;  2QVY X;  5KEI A;  4L4Q A;  5A1G A;  5A19 A;  2CY1 A;  1O9T A;  3JAM D;  4L7I A;  3AF5 A;  4G36 A;  1PA4 A;  3TUF A;  1N32 C;  4G37 A;  4YY3 C;  4X66 C;  1I94 C;  1WF3 A;  3L8C A;  4GXQ A;  3FCC A;  1XRB A;  5BSM A;  5ADZ A;  4R1L A;  1HH2 P;  4DCS A;  4DR2 C;  4X65 C;  5BUS A;  1FUG A;  3TDE A;  4RM3 A;  3I08 A;  2VQF C;  2UUB C;  2VSQ A;  1HR0 C;  5E7Q A;  1XRC A;  3FCE A;  4JI5 C;  4KTV A;  1O90 A;  3C5E A;  2AYA A;  2WD9 A;  4JI2 C;  4RVO A;  4I9G A;  3UOW A;  3IEV A;  4JM1 A;  1XMQ C;  4BCA A;  4DG8 A;  4KHP C;  5DV9 A;  4DUY C;  1IBK C;  2D7V A;  2ATW A;  1BA3 A;  1LCI A;  1KKG A;  4R1M A;  3LUS A;  2OO4 A;  2YCB A;  4DV1 C;  2ZM6 C;  4I9F A;  4B3T C;  4DV7 C;  1MKY A;  4RLF A;  4OXI A;  4MH4 A;  3J80 D;  2E5L C;  4XX2 A;  3R9W A;  1T5D X;  4DV0 C;  4DR4 C;  4GKJ C;  1RY2 A;  3OTO C;  4ODJ A;  3IPL A;  3DAY A;  5BSR A;  2E8C A;  5H9U A;  4LF7 C;  3IML A;  3IEU A;  2DPL A;  2XR1 A;  4PZP A;  2HHH C;  2D1R A;  3G7S A;  3E7X A;  4DV6 C;  3N2Q A;  1XNQ C;  4DV2 C;  3ETC A;  5FLX D;  5LMU C;  1QWI A;  3KXW A;  4PRO C;  1MXA A;  1ULT A;  4LF9 C;  1K0R A;  1N2F A;  2D1S A;  2BH1 X;  4JI1 C;  2P2F A;  3L95 X;  4LF8 C;  3CW8 X;  2QVZ X;  4RLQ A;  3VNR A;  4DR1 C;  4OX9 C;  1USP A;  4DV4 C;  1UKK A;  3NYR A;  4LE5 A;  1MDF A;  5K8F A;  2OPL B;  1IBM C;  4ISB A;  4U5Y D;  1PG4 A;  3GR1 A;  4LF4 C;  3ETO A;  3CJE A;  4LFC C;  4GS5 A;  3GKU A;  4RVN A;  2E0G A;  4RMN A;  2E8F A;  2Y4O A;  5K85 A;  2UXD C;  4IR7 A;  3GR0 A;  3UZ0 A;  1ZB8 A;  3T1H C;  4GXR A;  5KYT A;  5BST A;  4LFA C;  4NXM C;  3VNS A;  5BUR A;  4JYA C;  4NOZ A;  5IT9 D;  1FJG C;  1XMO C;  1VLA A;  1MDB A;  1O93 A;  4WS9 A;  1V25 A;  2F4V C;  3DLP X;  1HNX C;  1MXB A;  1L2F A;  2UU9 C;  3PES A;  2UXB C;  2VZE A;  2E7G A;  2D1Q A;  3SO4 A;  1WH9 A;  2PRO A;  5CZX A;  3NYQ A;  2ASB A;  2ONF A;  3EER A;  4KTT A;  3N54 B;  5KYV A;  4DV3 C;  4FTF A;  3AF6 A;  1T5H X;  4DR6 C;  4L2Z A;  2QL8 A;  3J7A D;  5A2Q D;  3EQ6 A;  4DR7 C;  3RV2 A;  5BR8 C;  4IZ6 A;  3CW9 A;  5A1I A;  4DCU A;  3LGX A;  1XNR C;  5LMN C;  3I07 A;  4JI7 C;  4EAT A;  3GPC A;  1PG3 A;  1YJ7 A;  4JI4 C;  2V7B A;  5CZV A;  4JI6 C;  1GPM A;  3LAX A;  4DCT A;  5BSW A;  4B3R C;  1EGA A;  2YWB A;  2P2Q A;  4BC7 A;  3A9V A;  1HNZ C;  2PT7 G;  3A4I A;  3R9X A;  3A9U A;  4BC9 A;  2P2B A;  1LQL A;  2P2J A;  4LF6 C;  1ML8 A;  5JRH A;  1QM4 A;  4BSZ A;  5BSV A;  3R44 A;  3TQI A;  1N34 C;  5BUQ A;  5T8S A;  4DUZ C;  4DR3 C;  4JI3 C;  4BBY A;  2KZF A;  2E8E A;  4K0K C;  2VQE C;  5AE3 A;  1O92 A;  1AMU A;  4HPV A;  2D27 A;  2EGT A;  4ZLP A;  4R0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...