4DUYC

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 50
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4duyC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4duyC02
1ZB9A 4X62C 2OPLA 2OPLB 2CY1A 4AQYC 1QWIA 4LFBC 2CXCA 4OX9C 4LF7C 3AF5A 3T1YC 4DCVA 4DV2C 4LFAC 1IBMC 4JI5C 1KKGA 2QL8A 1J5EC 1XMQC 2UU9C 1ZB8A 2HJGA 2E8EA 2ZM6C 2UUAC 2XR1A 4JI6C 4DR6C 1EGAA 4X64C 3R9XA 4DUZC 4LF4C 4NOZA 2E5LC 1HNZC 3OTOC 3CJEA 1N36C 3GKUA 1UKKA 4NXMC 3IEVA 3LUSA 5FLXD 1IBLC 4DV6C 2UXCC 2DYJA 4DUYC 1FJGC 4NXNC 1XNQC 4DCTA 4JI3C 4YHHC 4DR5C 4YY3C 2F4VC 3IEUA 2UUCC 4GKJC 4LFCC 1XNRC 4DV7C 1I94C 5BR8C 4DV5C 1N2FA 1HNWC 2E7GA 2ASBA 1HR0C 2UXBC 2D7VA 2PT7G 1ML8A 4K0KC 2E8FA 4JI0C 1IBKC 4X65C 4DV0C 4LF9C 1WF3A 5IT9D 2E8CA 4XX2A 4DR7C 3R9WA 5LMUC 1LQLA 3T1HC 3J80D 2YCBA 4JYAC 4DR3C 4LF8C 1HH2P 4LF5C 2BJOA 1MKYA 4JI4C 4DR1C 4DV3C 1NYEA 2JMPA 1WH9A 3J81D 2ONFA 1USPB 4DV4C 1L2FA 4BSZA 4DR2C 4GKKC 4JI8C 2PN2A 4X66C 4JI7C 1N32C 2HHHC 4DR4C 3I07A 4DV1C 1K0RA 2UUBC 4B3TC 4JI1C 1N33C 3J7AD 5LMNC 4MTNA 1VLAA 2VQFC 3JAMD 2UXDC 5A2QD 4B3RC 2ATWA 4DCSA 3EERA 4B3SC 4JI2C 4MH4A 3AF6A 4LF6C 2EGTA 1N34C 1XMOC 4DCUA 5IWAC 4JV5C 4KHPC 1HNXC 2KZFA 1PA4A 2VQEC 1USPA 4B3MC 1JOSA
chains in the Genus database with same CATH superfamily
1ZB9A 1WCJA 2CY1A 1MDFA 2ZZNA 4DV2C 2P2QA 3E7WA 1KKGA 2QL8A 1J5EC 4ISBA 1XMQC 2XR1A 4JI6C 1FUGA 3R9XA 4BC9A 4PUIA 1HNZC 4BC7A 3GKUA 3CQ3A 2P20A 1RG9A 3LUSA 5FLXD 1NY8A 5IFIA 4DCTA 1XNQC 2WP0C 2UUCC 1XNRC 1O9TA 4DV7C 3NYQA 4BBYA 2NCLA 4RM3A 4PHTA 5BSUA 2E7GA 2ASBA 2AYAA 2QVZX 2D27A 4K0KC 2E8FA 5BURA 4JI0C 4X65C 2MCQA 4LF9C 1WF3A 5IT9D 4XX2A 1MXCA 1VEHA 3UX3A 2P2MA 3DAYA 4LF5C 5BSVA 4G37A 4L7IA 4DV3C 2JMPA 1YJ7A 3UEBA 3CW8X 4DV4C 5A19A 5GTDA 4JI8C 3TDEA 1P4EA 1O92A 2HHHC 4B3TC 4JI1C 1N33C 4EATA 1BA3A 1XS3A 5LCIA 2ATWA 4DCSA 2Y4OA 2OBVA 4MH4A 4GS5A 4LF6C 4RVNA 5BSTA 2M5HA 4ZLPA 4I9FA 1IB8A 1USPA 3FCEA 3A9VA 1PU1A 2OPLB 4AQYC 1QWIA 4R1LA 3NI2A 3AF5A 3T1YC 3IPLA 4KTTA 3EQ6A 4IR7A 4DG8A 1PG3A 3DHVA 2V7BA 4DG9A 5T8TA 2E8EA 2UUAC 1ULTA 4PZPA 5CZXA 4GXRA 4X64C 4DUZC 4OXIA 2E5LC 3SO4A 5BSWA 2OO4A 4ODJA 3IEVA 4DV6C 2WD9A 2Z51A 4DUYC 4JI3C 2QVXX 4YY3C 2F4VC 4GKJC 2P2JA 4KTVA 4K0BA 1I94C 5BR8C 4DV5C 3UX2A 1N2FA 3N54B 1PG4A 3PESA 1ML8A 4FTFA 4HPVA 1XRCA 3K6RA 3LNOA 4DV0C 5KEIA 1XRAA 2PROA 5BUSA 4DR7C 3NYRA 3PBKA 4RM2A 2BJOA 2VZEA 4JI4C 1FLOA 3A9UA 1MDBA 2ONFA 1L2FA 5JRHA 4GKKC 4X66C 1MXBA 4NDNA 3UOWA 3I07A 5DV9A 3J7AD 5LMNC 4MTNA 2VQFC 3N2QA 3CQ1A 4RLFA 4B3SC 3AF6A 1N34C 4PUHA 1XMOC 4LE5A 4R1MA 3FM7A 5IWAC 4FUTA 4BCAA 5KYVA 1T5HX 1UWDA 1JOSA 2D28C 3TR3A 1YGTA 4X62C 3RV2A 2P2FA 2OPLA 3GPCA 3VNSA 4LFBC 2CXCA 4G36A 4LF7C 3L95X 4OX9C 4DCVA 4LFAC 4JI5C 1O93A 5BSRA 3O2EA 2ZM6C 3KXWA 5KYTA 1M6XC 3PROC 4PUGA 5A1GA 2E0GA 4L2ZA 3CJEA 3LGXA 1LCIA 1N36C 4D4IA 3RG2A 4NXMC 2P2BA 4D4GA 1MD9A 1IBLC 5K85A 3ETCA 2DYJA 1FJGC 2ZTBA 3IEUA 2Y27A 2D1SA 3L8CA 2YWCA 3I08A 4RMNA 2P02A 2DHMA 1XHJA 3R44A 2UXBC 4GXQA 2PT7G 2QVYX 2MMAB 3FCCA 1IBKC 2E8CA 5BUQA 2YWBA 3GR1A 3LAXA 5E7QA 3T1HC 3A26A 2D1RA 2YCBA 3J80D 4LF8C 1HH2P 5AE1A 1MKYA 1M6XA 2PG1E 4DR1C 1NYEA 3E7XA 2MM9A 1WH9A 1USPB 2BH1X 4BSZA 5AE3A 1T5DX 4OYCA 2D1QA 2PN2A 4JI7C 4U5YD 1N32C 4ZJZA 5T8SA 2CU6A 4DR4C 2KZ0A 3LNVA 4FUQA 2UXDC 1XDXA 4L4QA 5A2QD 4B3RC 1O90A 3CQ2A 4TPSB 3EERA 3S82A 4JI2C 2M5OA 4G1IA 5H9UA 4I9GA 4KHPC 1AMUA 4WS9A 2VQEC 3AY0A 4B3MC 3NPDA 1V26A 1XRBA 3GR0A 1P4EC 4R0MA 1IBMC 1GPMA 3VNQA 5BSMA 2DPLA 2UU9C 1ZB8A 2HJGA 3A4IA 1V60A 4DR6C 1EGAA 4LF4C 4NOZA 4WV3A 3OTOC 5K8FA 1UKKA 5CZVA 3DLPX 4D56A 4PROC 2UXCC 3C5EA 4NXNC 4YHHC 4DR5C 1V25A 1RY2A 3TQIA 4LFCC 2QW0X 1MXAA 1HNWC 1HR0C 2D7VA 3G7SA 3UZ0A 3TUFA 3VNRA 2Y4NA 3R9WA 1TH5A 5LMUC 1LQLA 2JNVA 5ADZA 4JYAC 1P7LA 4DR3C 2YX1A 3H2TA 5AE2A 2D1TA 3ETOA 3J81D 2ZZMA 4RVOA 4DR2C 2KDNA 4JM1A 1QM4A 3IMLA 3B7WA 4DV1C 1K0RA 2UUBC 1VLAA 3CW9A 3JAMD 2VSQA 4IZ6A 5A1IA 2EGTA 4D57A 3A25A 4DCUA 4JV5C 1HNXC 2KZFA 1PA4A 4RLQA
chains in the Genus database with same CATH topology
1ZB9A 2CY1A 1MDFA 4DV2C 2P2QA 3E7WA 1KKGA 2QL8A 1J5EC 4ISBA 1XMQC 2XR1A 4JI6C 1FUGA 3R9XA 4BC9A 1HNZC 4BC7A 3GKUA 2P20A 1RG9A 3LUSA 5FLXD 5IFIA 4DCTA 1XNQC 2WP0C 2UUCC 1XNRC 1O9TA 4DV7C 3NYQA 4BBYA 4RM3A 4PHTA 5BSUA 2E7GA 2ASBA 2AYAA 2QVZX 2D27A 4K0KC 2E8FA 5BURA 4JI0C 4X65C 4LF9C 1WF3A 5IT9D 4XX2A 1MXCA 2P2MA 3DAYA 4LF5C 5BSVA 4G37A 4L7IA 4DV3C 2JMPA 1YJ7A 3CW8X 4DV4C 5A19A 5GTDA 4JI8C 3TDEA 1O92A 2HHHC 4B3TC 4JI1C 1N33C 4EATA 1BA3A 2ATWA 4DCSA 2Y4OA 2OBVA 4MH4A 4GS5A 4LF6C 4RVNA 5BSTA 4ZLPA 4I9FA 1USPA 3FCEA 3A9VA 2OPLB 4AQYC 1QWIA 4R1LA 3NI2A 3AF5A 3T1YC 3IPLA 4KTTA 3EQ6A 4IR7A 4DG8A 1PG3A 3DHVA 2V7BA 4DG9A 5T8TA 2E8EA 2UUAC 1ULTA 4PZPA 5CZXA 4GXRA 4X64C 4DUZC 4OXIA 2E5LC 3SO4A 5BSWA 2OO4A 4ODJA 3IEVA 4DV6C 2WD9A 4DUYC 4JI3C 2QVXX 4YY3C 2F4VC 4GKJC 2P2JA 4KTVA 4K0BA 1I94C 5BR8C 4DV5C 3N54B 1N2FA 1PG4A 3PESA 1ML8A 4FTFA 4HPVA 1XRCA 4DV0C 5KEIA 1XRAA 2PROA 5BUSA 4DR7C 3NYRA 3PBKA 4RM2A 2BJOA 2VZEA 4JI4C 3A9UA 1MDBA 2ONFA 1L2FA 5JRHA 4GKKC 4X66C 1MXBA 4NDNA 3UOWA 3I07A 5DV9A 3J7AD 5LMNC 4MTNA 2VQFC 3N2QA 4RLFA 4B3SC 3AF6A 1N34C 1XMOC 4LE5A 4R1MA 5IWAC 4FUTA 4BCAA 5KYVA 1T5HX 1JOSA 2D28C 4X62C 3RV2A 2P2FA 2OPLA 3GPCA 3VNSA 4LFBC 2CXCA 4G36A 4LF7C 3L95X 4OX9C 4DCVA 4LFAC 4JI5C 1O93A 5BSRA 2ZM6C 3KXWA 5KYTA 3PROC 5A1GA 2E0GA 4L2ZA 3CJEA 3LGXA 1LCIA 1N36C 4D4IA 3RG2A 4NXMC 2P2BA 4D4GA 1MD9A 1IBLC 5K85A 3ETCA 2DYJA 1FJGC 3IEUA 2Y27A 2D1SA 3L8CA 2YWCA 3I08A 4RMNA 2P02A 3R44A 2UXBC 4GXQA 2PT7G 2QVYX 3FCCA 1IBKC 2E8CA 5BUQA 2YWBA 3GR1A 3LAXA 5E7QA 3T1HC 2D1RA 2YCBA 3J80D 4LF8C 1HH2P 5AE1A 1MKYA 4DR1C 1NYEA 3E7XA 1WH9A 1USPB 2BH1X 4BSZA 5AE3A 1T5DX 4OYCA 2D1QA 2PN2A 4JI7C 4U5YD 1N32C 4ZJZA 5T8SA 4DR4C 3LNVA 4FUQA 2UXDC 4L4QA 5A2QD 4B3RC 1O90A 4TPSB 3EERA 3S82A 4JI2C 4G1IA 5H9UA 4I9GA 4KHPC 1AMUA 4WS9A 2VQEC 4B3MC 3NPDA 1V26A 1XRBA 3GR0A 4R0MA 1IBMC 1GPMA 3VNQA 5BSMA 2DPLA 2UU9C 1ZB8A 2HJGA 3A4IA 4DR6C 1EGAA 4LF4C 4NOZA 4WV3A 3OTOC 5K8FA 1UKKA 5CZVA 3DLPX 4D56A 4PROC 2UXCC 3C5EA 4NXNC 4YHHC 4DR5C 1V25A 1RY2A 3TQIA 4LFCC 2QW0X 1MXAA 1HNWC 1HR0C 2D7VA 3G7SA 3UZ0A 3TUFA 3VNRA 2Y4NA 3R9WA 5LMUC 1LQLA 5ADZA 4JYAC 1P7LA 4DR3C 3H2TA 5AE2A 2D1TA 3ETOA 3J81D 4RVOA 4DR2C 4JM1A 1QM4A 3IMLA 3B7WA 4DV1C 1K0RA 2UUBC 1VLAA 3CW9A 3JAMD 2VSQA 4IZ6A 5A1IA 2EGTA 4D57A 4DCUA 4JV5C 1HNXC 2KZFA 1PA4A 4RLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZB9 A;  4X62 C;  2OPL A;  2OPL B;  2CY1 A;  4AQY C;  1QWI A;  4LFB C;  2CXC A;  4OX9 C;  4LF7 C;  3AF5 A;  3T1Y C;  4DCV A;  4DV2 C;  4LFA C;  1IBM C;  4JI5 C;  1KKG A;  2QL8 A;  1J5E C;  1XMQ C;  2UU9 C;  1ZB8 A;  2HJG A;  2E8E A;  2ZM6 C;  2UUA C;  2XR1 A;  4JI6 C;  4DR6 C;  1EGA A;  4X64 C;  3R9X A;  4DUZ C;  4LF4 C;  4NOZ A;  2E5L C;  1HNZ C;  3OTO C;  3CJE A;  1N36 C;  3GKU A;  1UKK A;  4NXM C;  3IEV A;  3LUS A;  5FLX D;  1IBL C;  4DV6 C;  2UXC C;  2DYJ A;  4DUY C;  1FJG C;  4NXN C;  1XNQ C;  4DCT A;  4JI3 C;  4YHH C;  4DR5 C;  4YY3 C;  2F4V C;  3IEU A;  2UUC C;  4GKJ C;  4LFC C;  1XNR C;  4DV7 C;  1I94 C;  5BR8 C;  4DV5 C;  1N2F A;  1HNW C;  2E7G A;  2ASB A;  1HR0 C;  2UXB C;  2D7V A;  2PT7 G;  1ML8 A;  4K0K C;  2E8F A;  4JI0 C;  1IBK C;  4X65 C;  4DV0 C;  4LF9 C;  1WF3 A;  5IT9 D;  2E8C A;  4XX2 A;  4DR7 C;  3R9W A;  5LMU C;  1LQL A;  3T1H C;  3J80 D;  2YCB A;  4JYA C;  4DR3 C;  4LF8 C;  1HH2 P;  4LF5 C;  2BJO A;  1MKY A;  4JI4 C;  4DR1 C;  4DV3 C;  1NYE A;  2JMP A;  1WH9 A;  3J81 D;  2ONF A;  1USP B;  4DV4 C;  1L2F A;  4BSZ A;  4DR2 C;  4GKK C;  4JI8 C;  2PN2 A;  4X66 C;  4JI7 C;  1N32 C;  2HHH C;  4DR4 C;  3I07 A;  4DV1 C;  1K0R A;  2UUB C;  4B3T C;  4JI1 C;  1N33 C;  3J7A D;  5LMN C;  4MTN A;  1VLA A;  2VQF C;  3JAM D;  2UXD C;  5A2Q D;  4B3R C;  2ATW A;  4DCS A;  3EER A;  4B3S C;  4JI2 C;  4MH4 A;  3AF6 A;  4LF6 C;  2EGT A;  1N34 C;  1XMO C;  4DCU A;  5IWA C;  4JV5 C;  4KHP C;  1HNX C;  2KZF A;  1PA4 A;  2VQE C;  1USP A;  4B3M C;  1JOS A; 
#chains in the Genus database with same CATH topology
 1ZB9 A;  1WCJ A;  2CY1 A;  1MDF A;  2ZZN A;  4DV2 C;  2P2Q A;  3E7W A;  1KKG A;  2QL8 A;  1J5E C;  4ISB A;  1XMQ C;  2XR1 A;  4JI6 C;  1FUG A;  3R9X A;  4BC9 A;  4PUI A;  1HNZ C;  4BC7 A;  3GKU A;  3CQ3 A;  2P20 A;  1RG9 A;  3LUS A;  5FLX D;  1NY8 A;  5IFI A;  4DCT A;  1XNQ C;  2WP0 C;  2UUC C;  1XNR C;  1O9T A;  4DV7 C;  3NYQ A;  4BBY A;  2NCL A;  4RM3 A;  4PHT A;  5BSU A;  2E7G A;  2ASB A;  2AYA A;  2QVZ X;  2D27 A;  4K0K C;  2E8F A;  5BUR A;  4JI0 C;  4X65 C;  2MCQ A;  4LF9 C;  1WF3 A;  5IT9 D;  4XX2 A;  1MXC A;  1VEH A;  3UX3 A;  2P2M A;  3DAY A;  4LF5 C;  5BSV A;  4G37 A;  4L7I A;  4DV3 C;  2JMP A;  1YJ7 A;  3UEB A;  3CW8 X;  4DV4 C;  5A19 A;  5GTD A;  4JI8 C;  3TDE A;  1P4E A;  1O92 A;  2HHH C;  4B3T C;  4JI1 C;  1N33 C;  4EAT A;  1BA3 A;  1XS3 A;  5LCI A;  2ATW A;  4DCS A;  2Y4O A;  2OBV A;  4MH4 A;  4GS5 A;  4LF6 C;  4RVN A;  5BST A;  2M5H A;  4ZLP A;  4I9F A;  1IB8 A;  1USP A;  3FCE A;  3A9V A;  1PU1 A;  2OPL B;  4AQY C;  1QWI A;  4R1L A;  3NI2 A;  3AF5 A;  3T1Y C;  3IPL A;  4KTT A;  3EQ6 A;  4IR7 A;  4DG8 A;  1PG3 A;  3DHV A;  2V7B A;  4DG9 A;  5T8T A;  2E8E A;  2UUA C;  1ULT A;  4PZP A;  5CZX A;  4GXR A;  4X64 C;  4DUZ C;  4OXI A;  2E5L C;  3SO4 A;  5BSW A;  2OO4 A;  4ODJ A;  3IEV A;  4DV6 C;  2WD9 A;  2Z51 A;  4DUY C;  4JI3 C;  2QVX X;  4YY3 C;  2F4V C;  4GKJ C;  2P2J A;  4KTV A;  4K0B A;  1I94 C;  5BR8 C;  4DV5 C;  3UX2 A;  1N2F A;  3N54 B;  1PG4 A;  3PES A;  1ML8 A;  4FTF A;  4HPV A;  1XRC A;  3K6R A;  3LNO A;  4DV0 C;  5KEI A;  1XRA A;  2PRO A;  5BUS A;  4DR7 C;  3NYR A;  3PBK A;  4RM2 A;  2BJO A;  2VZE A;  4JI4 C;  1FLO A;  3A9U A;  1MDB A;  2ONF A;  1L2F A;  5JRH A;  4GKK C;  4X66 C;  1MXB A;  4NDN A;  3UOW A;  3I07 A;  5DV9 A;  3J7A D;  5LMN C;  4MTN A;  2VQF C;  3N2Q A;  3CQ1 A;  4RLF A;  4B3S C;  3AF6 A;  1N34 C;  4PUH A;  1XMO C;  4LE5 A;  4R1M A;  3FM7 A;  5IWA C;  4FUT A;  4BCA A;  5KYV A;  1T5H X;  1UWD A;  1JOS A;  2D28 C;  3TR3 A;  1YGT A;  4X62 C;  3RV2 A;  2P2F A;  2OPL A;  3GPC A;  3VNS A;  4LFB C;  2CXC A;  4G36 A;  4LF7 C;  3L95 X;  4OX9 C;  4DCV A;  4LFA C;  4JI5 C;  1O93 A;  5BSR A;  3O2E A;  2ZM6 C;  3KXW A;  5KYT A;  1M6X C;  3PRO C;  4PUG A;  5A1G A;  2E0G A;  4L2Z A;  3CJE A;  3LGX A;  1LCI A;  1N36 C;  4D4I A;  3RG2 A;  4NXM C;  2P2B A;  4D4G A;  1MD9 A;  1IBL C;  5K85 A;  3ETC A;  2DYJ A;  1FJG C;  2ZTB A;  3IEU A;  2Y27 A;  2D1S A;  3L8C A;  2YWC A;  3I08 A;  4RMN A;  2P02 A;  2DHM A;  1XHJ A;  3R44 A;  2UXB C;  4GXQ A;  2PT7 G;  2QVY X;  2MMA B;  3FCC A;  1IBK C;  2E8C A;  5BUQ A;  2YWB A;  3GR1 A;  3LAX A;  5E7Q A;  3T1H C;  3A26 A;  2D1R A;  2YCB A;  3J80 D;  4LF8 C;  1HH2 P;  5AE1 A;  1MKY A;  1M6X A;  2PG1 E;  4DR1 C;  1NYE A;  3E7X A;  2MM9 A;  1WH9 A;  1USP B;  2BH1 X;  4BSZ A;  5AE3 A;  1T5D X;  4OYC A;  2D1Q A;  2PN2 A;  4JI7 C;  4U5Y D;  1N32 C;  4ZJZ A;  5T8S A;  2CU6 A;  4DR4 C;  2KZ0 A;  3LNV A;  4FUQ A;  2UXD C;  1XDX A;  4L4Q A;  5A2Q D;  4B3R C;  1O90 A;  3CQ2 A;  4TPS B;  3EER A;  3S82 A;  4JI2 C;  2M5O A;  4G1I A;  5H9U A;  4I9G A;  4KHP C;  1AMU A;  4WS9 A;  2VQE C;  3AY0 A;  4B3M C;  3NPD A;  1V26 A;  1XRB A;  3GR0 A;  1P4E C;  4R0M A;  1IBM C;  1GPM A;  3VNQ A;  5BSM A;  2DPL A;  2UU9 C;  1ZB8 A;  2HJG A;  3A4I A;  1V60 A;  4DR6 C;  1EGA A;  4LF4 C;  4NOZ A;  4WV3 A;  3OTO C;  5K8F A;  1UKK A;  5CZV A;  3DLP X;  4D56 A;  4PRO C;  2UXC C;  3C5E A;  4NXN C;  4YHH C;  4DR5 C;  1V25 A;  1RY2 A;  3TQI A;  4LFC C;  2QW0 X;  1MXA A;  1HNW C;  1HR0 C;  2D7V A;  3G7S A;  3UZ0 A;  3TUF A;  3VNR A;  2Y4N A;  3R9W A;  1TH5 A;  5LMU C;  1LQL A;  2JNV A;  5ADZ A;  4JYA C;  1P7L A;  4DR3 C;  2YX1 A;  3H2T A;  5AE2 A;  2D1T A;  3ETO A;  3J81 D;  2ZZM A;  4RVO A;  4DR2 C;  2KDN A;  4JM1 A;  1QM4 A;  3IML A;  3B7W A;  4DV1 C;  1K0R A;  2UUB C;  1VLA A;  3CW9 A;  3JAM D;  2VSQ A;  4IZ6 A;  5A1I A;  2EGT A;  4D57 A;  3A25 A;  4DCU A;  4JV5 C;  1HNX C;  2KZF A;  1PA4 A;  4RLQ A; 
#chains in the Genus database with same CATH homology
 1ZB9 A;  2CY1 A;  1MDF A;  4DV2 C;  2P2Q A;  3E7W A;  1KKG A;  2QL8 A;  1J5E C;  4ISB A;  1XMQ C;  2XR1 A;  4JI6 C;  1FUG A;  3R9X A;  4BC9 A;  1HNZ C;  4BC7 A;  3GKU A;  2P20 A;  1RG9 A;  3LUS A;  5FLX D;  5IFI A;  4DCT A;  1XNQ C;  2WP0 C;  2UUC C;  1XNR C;  1O9T A;  4DV7 C;  3NYQ A;  4BBY A;  4RM3 A;  4PHT A;  5BSU A;  2E7G A;  2ASB A;  2AYA A;  2QVZ X;  2D27 A;  4K0K C;  2E8F A;  5BUR A;  4JI0 C;  4X65 C;  4LF9 C;  1WF3 A;  5IT9 D;  4XX2 A;  1MXC A;  2P2M A;  3DAY A;  4LF5 C;  5BSV A;  4G37 A;  4L7I A;  4DV3 C;  2JMP A;  1YJ7 A;  3CW8 X;  4DV4 C;  5A19 A;  5GTD A;  4JI8 C;  3TDE A;  1O92 A;  2HHH C;  4B3T C;  4JI1 C;  1N33 C;  4EAT A;  1BA3 A;  2ATW A;  4DCS A;  2Y4O A;  2OBV A;  4MH4 A;  4GS5 A;  4LF6 C;  4RVN A;  5BST A;  4ZLP A;  4I9F A;  1USP A;  3FCE A;  3A9V A;  2OPL B;  4AQY C;  1QWI A;  4R1L A;  3NI2 A;  3AF5 A;  3T1Y C;  3IPL A;  4KTT A;  3EQ6 A;  4IR7 A;  4DG8 A;  1PG3 A;  3DHV A;  2V7B A;  4DG9 A;  5T8T A;  2E8E A;  2UUA C;  1ULT A;  4PZP A;  5CZX A;  4GXR A;  4X64 C;  4DUZ C;  4OXI A;  2E5L C;  3SO4 A;  5BSW A;  2OO4 A;  4ODJ A;  3IEV A;  4DV6 C;  2WD9 A;  4DUY C;  4JI3 C;  2QVX X;  4YY3 C;  2F4V C;  4GKJ C;  2P2J A;  4KTV A;  4K0B A;  1I94 C;  5BR8 C;  4DV5 C;  3N54 B;  1N2F A;  1PG4 A;  3PES A;  1ML8 A;  4FTF A;  4HPV A;  1XRC A;  4DV0 C;  5KEI A;  1XRA A;  2PRO A;  5BUS A;  4DR7 C;  3NYR A;  3PBK A;  4RM2 A;  2BJO A;  2VZE A;  4JI4 C;  3A9U A;  1MDB A;  2ONF A;  1L2F A;  5JRH A;  4GKK C;  4X66 C;  1MXB A;  4NDN A;  3UOW A;  3I07 A;  5DV9 A;  3J7A D;  5LMN C;  4MTN A;  2VQF C;  3N2Q A;  4RLF A;  4B3S C;  3AF6 A;  1N34 C;  1XMO C;  4LE5 A;  4R1M A;  5IWA C;  4FUT A;  4BCA A;  5KYV A;  1T5H X;  1JOS A;  2D28 C;  4X62 C;  3RV2 A;  2P2F A;  2OPL A;  3GPC A;  3VNS A;  4LFB C;  2CXC A;  4G36 A;  4LF7 C;  3L95 X;  4OX9 C;  4DCV A;  4LFA C;  4JI5 C;  1O93 A;  5BSR A;  2ZM6 C;  3KXW A;  5KYT A;  3PRO C;  5A1G A;  2E0G A;  4L2Z A;  3CJE A;  3LGX A;  1LCI A;  1N36 C;  4D4I A;  3RG2 A;  4NXM C;  2P2B A;  4D4G A;  1MD9 A;  1IBL C;  5K85 A;  3ETC A;  2DYJ A;  1FJG C;  3IEU A;  2Y27 A;  2D1S A;  3L8C A;  2YWC A;  3I08 A;  4RMN A;  2P02 A;  3R44 A;  2UXB C;  4GXQ A;  2PT7 G;  2QVY X;  3FCC A;  1IBK C;  2E8C A;  5BUQ A;  2YWB A;  3GR1 A;  3LAX A;  5E7Q A;  3T1H C;  2D1R A;  2YCB A;  3J80 D;  4LF8 C;  1HH2 P;  5AE1 A;  1MKY A;  4DR1 C;  1NYE A;  3E7X A;  1WH9 A;  1USP B;  2BH1 X;  4BSZ A;  5AE3 A;  1T5D X;  4OYC A;  2D1Q A;  2PN2 A;  4JI7 C;  4U5Y D;  1N32 C;  4ZJZ A;  5T8S A;  4DR4 C;  3LNV A;  4FUQ A;  2UXD C;  4L4Q A;  5A2Q D;  4B3R C;  1O90 A;  4TPS B;  3EER A;  3S82 A;  4JI2 C;  4G1I A;  5H9U A;  4I9G A;  4KHP C;  1AMU A;  4WS9 A;  2VQE C;  4B3M C;  3NPD A;  1V26 A;  1XRB A;  3GR0 A;  4R0M A;  1IBM C;  1GPM A;  3VNQ A;  5BSM A;  2DPL A;  2UU9 C;  1ZB8 A;  2HJG A;  3A4I A;  4DR6 C;  1EGA A;  4LF4 C;  4NOZ A;  4WV3 A;  3OTO C;  5K8F A;  1UKK A;  5CZV A;  3DLP X;  4D56 A;  4PRO C;  2UXC C;  3C5E A;  4NXN C;  4YHH C;  4DR5 C;  1V25 A;  1RY2 A;  3TQI A;  4LFC C;  2QW0 X;  1MXA A;  1HNW C;  1HR0 C;  2D7V A;  3G7S A;  3UZ0 A;  3TUF A;  3VNR A;  2Y4N A;  3R9W A;  5LMU C;  1LQL A;  5ADZ A;  4JYA C;  1P7L A;  4DR3 C;  3H2T A;  5AE2 A;  2D1T A;  3ETO A;  3J81 D;  4RVO A;  4DR2 C;  4JM1 A;  1QM4 A;  3IML A;  3B7W A;  4DV1 C;  1K0R A;  2UUB C;  1VLA A;  3CW9 A;  3JAM D;  2VSQ A;  4IZ6 A;  5A1I A;  2EGT A;  4D57 A;  4DCU A;  4JV5 C;  1HNX C;  2KZF A;  1PA4 A;  4RLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...