4DUYC

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 50
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4duyC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4duyC02
4GKKC 3GKUA 1NYEA 2OPLB 4X65C 5A2QD 2DYJA 4DUYC 2VQFC 1JOSA 2ONFA 4X66C 4JV5C 4JI8C 1FJGC 1ML8A 4DV6C 1HR0C 4B3RC 4LFAC 4JI2C 4DUZC 4JI5C 4DR1C 4BSZA 2UU9C 4NXNC 1N36C 3CJEA 4DR6C 4DR5C 4LF6C 1HNXC 2D7VA 2F4VC 1ZB9A 1USPB 1N32C 2EGTA 1ZB8A 2OPLA 3T1YC 2ZM6C 1N33C 2UXDC 3J80D 3T1HC 4DR2C 3IEUA 4B3MC 3EERA 4DR7C 1IBKC 1QWIA 3R9WA 3JAMD 4JI1C 4LFCC 1N2FA 3IEVA 2QL8A 1J5EC 2PN2A 5BR8C 4JI3C 1EGAA 4YHHC 4DV3C 1KKGA 4B3SC 4MTNA 4DV0C 4DV4C 2ASBA 4AQYC 4DCSA 4LF7C 4B3TC 1LQLA 4NXMC 2UUAC 5IWAC 5LMUC 2CY1A 4JYAC 4DR4C 1IBMC 1WF3A 4XX2A 2HHHC 2UXCC 1XNRC 1L2FA 1K0RA 2HJGA 4OX9C 2UXBC 2KZFA 3J81D 2E8EA 1WH9A 2E8FA 4LF8C 4GKJC 4DCVA 5IT9D 4LF9C 3R9XA 4KHPC 4DCTA 2E5LC 2PT7G 1VLAA 4JI6C 3AF5A 1USPA 2E8CA 3AF6A 3I07A 1XMQC 4LFBC 2JMPA 1I94C 2BJOA 5FLXD 1PA4A 4K0KC 5LMNC 2XR1A 1XMOC 4MH4A 1HNWC 4YY3C 4JI0C 1XNQC 3J7AD 3OTOC 4DR3C 4X62C 1N34C 1IBLC 4JI4C 4X64C 2UUCC 3LUSA 1MKYA 1UKKA 2ATWA 1HNZC 4DV1C 2YCBA 4DV7C 4DV5C 2VQEC 4LF4C 2CXCA 4JI7C 4LF5C 4DV2C 1HH2P 4DCUA 4NOZA 2UUBC 2E7GA
chains in the Genus database with same CATH superfamily
1XS3A 1NYEA 1XDXA 2OPLB 4DUYC 2VQFC 2ONFA 3CW9A 2YX1A 4JI2C 4DUZC 4BSZA 1IB8A 2MMAB 4DR5C 3A26A 1HNXC 5K85A 2P02A 1N32C 5GTDA 5T8SA 2UXDC 2Y4NA 4RVOA 4I9FA 4DR7C 3R9WA 1YJ7A 1N2FA 4KTVA 3LNVA 2DPLA 4PROC 2PN2A 5BR8C 4JI3C 1EGAA 4RM2A 2P2BA 3E7XA 1KKGA 4MTNA 2E0GA 2QVZX 2ZZNA 2QVYX 4DV4C 2ASBA 4DCSA 5BSTA 5BSRA 1QM4A 5AE3A 2UUAC 4PHTA 4RLFA 1P4EC 1FLOA 3N54B 4R1LA 1O93A 1XNRC 4FUQA 4G37A 4OX9C 3IPLA 3A25A 1WH9A 2E8FA 3CQ1A 4LF8C 4DCVA 5T8TA 4ISBA 2E5LC 2Y4OA 2VSQA 3GR1A 3I07A 3A9VA 2D28C 3DHVA 4K0KC 2XR1A 4MH4A 4YY3C 2ZZMA 3LAXA 4FUTA 4EATA 4X62C 5JRHA 5ADZA 1IBLC 1MD9A 5CZXA 2UUCC 1UKKA 2D27A 5A1IA 3ETCA 4BC7A 1HNZC 5LCIA 4L7IA 3S82A 2VQEC 4LF5C 4JI7C 3G7SA 5BSVA 4IR7A 1HH2P 4DCUA 3NYRA 4L4QA 2YWBA 5BUSA 1BA3A 4GKKC 2D1QA 2DYJA 1V25A 1ML8A 4G36A 4DR1C 2UU9C 2M5HA 4LF6C 4GXRA 2CU6A 3PBKA 3SO4A 1FUGA 1ZB8A 2OPLA 3GR0A 2OBVA 2P2MA 5BSMA 3T1YC 4B3MC 4L2ZA 3CW8X 1XRAA 3NPDA 3FM7A 4JI1C 4U5YD 4LFCC 1VEHA 3GPCA 4PUIA 4ZJZA 1PG3A 5KEIA 1RG9A 2WP0C 4D4IA 4AQYC 4I9GA 4B3TC 2YWCA 2P2JA 3CQ3A 5BUQA 5IWAC 5LMUC 3I08A 2PROA 2CY1A 1V26A 3C5EA 4DR4C 4G1IA 4LE5A 1IBMC 3DLPX 3TDEA 2HHHC 3K6RA 2HJGA 2UXBC 1T5DX 3RV2A 1XRBA 2BH1X 2D1RA 2PT7G 3AF5A 1P7LA 1USPA 1RY2A 2E8CA 4R0MA 4LFBC 1O90A 2P2FA 2QW0X 5LMNC 4WV3A 1HNWC 4RLQA 4ZLPA 4JI4C 4BCAA 3ETOA 4NDNA 1MXBA 1PU1A 1WCJA 4OXIA 2Y27A 4NOZA 1T5HX 5IFIA 2WD9A 1JOSA 4X66C 4JV5C 1XHJA 4DV6C 4GS5A 3PESA 4B3RC 4JI5C 4NXNC 3CJEA 3LNOA 5E7QA 2F4VC 2D1TA 1ZB9A 2EGTA 4BC9A 4WS9A 5DV9A 2P2QA 2ZM6C 1V60A 5BSUA 3T1HC 4DR2C 3IEUA 3EERA 1QWIA 1O92A 3IEVA 1MDFA 2P20A 1J5EC 1O9TA 1LCIA 4YHHC 4DV3C 1MDBA 3NYQA 4LF7C 1LQLA 4R1MA 4NXMC 2PG1E 2AYAA 4JYAC 5BURA 2UUBC 4XX2A 2UXCC 1K0RA 1L2FA 2KZFA 3E7WA 3R44A 3J81D 4GXQA 4GKJC 2QVXX 4KHPC 4DCTA 4PUHA 1VLAA 5KYVA 4IZ6A 3VNSA 3FCCA 3TUFA 2JMPA 5H9UA 1GPMA 4JI0C 3UX2A 3J7AD 2D1SA 3OTOC 3KXWA 1N34C 4X64C 3TQIA 2JNVA 3NI2A 1NY8A 1UWDA 4DV1C 4D57A 2YCBA 4DV7C 3H2TA 4LF4C 4PUGA 2Z51A 3L8CA 3GKUA 3UX3A 4X65C 5A2QD 2ZTBA 1YGTA 3VNQA 4FTFA 1FJGC 4JI8C 1HR0C 4LFAC 3TR3A 4DR6C 2VZEA 3EQ6A 4KTTA 1N36C 2DHMA 3L95X 3LGXA 5A19A 4DG9A 2D7VA 1XRCA 1USPB 2MCQA 1N33C 5K8FA 3J80D 3CQ2A 3PROC 4TPSB 4DG8A 5BSWA 1P4EA 2NCLA 1M6XA 1IBKC 2OO4A 3FCEA 3JAMD 5KYTA 2QL8A 2KZ0A 3UOWA 3O2EA 4RMNA 3DAYA 4B3SC 4DV0C 1TH5A 4HPVA 2MM9A 1AMUA 1MXAA 2KDNA 1WF3A 4K0BA 3UEBA 4BBYA 3UZ0A 4D56A 4PZPA 3B7WA 2E8EA 5IT9D 4LF9C 3R9XA 2V7BA 4ODJA 3RG2A 3N2QA 4JI6C 3IMLA 3AF6A 1XMQC 1I94C 2BJOA 5FLXD 1PA4A 4RVNA 1M6XC 1XMOC 4JM1A 3AY0A 1XNQC 5CZVA 1PG4A 4OYCA 4DR3C 4RM3A 5AE1A 1MXCA 3LUSA 5A1GA 1MKYA 5AE2A 3A4IA 2M5OA 2ATWA 3A9UA 4D4GA 4DV5C 2CXCA 1ULTA 4DV2C 3VNRA 2E7GA
chains in the Genus database with same CATH topology
1NYEA 2OPLB 4DUYC 2VQFC 2ONFA 3CW9A 4JI2C 4DUZC 4BSZA 4DR5C 1HNXC 5K85A 2P02A 1N32C 5GTDA 5T8SA 2UXDC 2Y4NA 4RVOA 4I9FA 4DR7C 3R9WA 1YJ7A 1N2FA 4KTVA 3LNVA 2DPLA 4PROC 2PN2A 5BR8C 4JI3C 1EGAA 4RM2A 2P2BA 3E7XA 1KKGA 4MTNA 2E0GA 2QVZX 2QVYX 4DV4C 2ASBA 4DCSA 5BSTA 5BSRA 1QM4A 5AE3A 2UUAC 4PHTA 4RLFA 3N54B 4R1LA 1O93A 1XNRC 4FUQA 4G37A 4OX9C 3IPLA 1WH9A 2E8FA 4LF8C 4DCVA 5T8TA 4ISBA 2E5LC 2Y4OA 2VSQA 3GR1A 3I07A 3A9VA 2D28C 3DHVA 4K0KC 2XR1A 4MH4A 4YY3C 3LAXA 4FUTA 4EATA 4X62C 1IBLC 5JRHA 5ADZA 1MD9A 5CZXA 2UUCC 1UKKA 2D27A 5A1IA 3ETCA 4BC7A 1HNZC 4L7IA 3S82A 2VQEC 4LF5C 4JI7C 3G7SA 5BSVA 4IR7A 1HH2P 4DCUA 3NYRA 4L4QA 2YWBA 5BUSA 1BA3A 4GKKC 2D1QA 2DYJA 1V25A 1ML8A 4G36A 4DR1C 2UU9C 4LF6C 4GXRA 3PBKA 3SO4A 1FUGA 1ZB8A 2OPLA 3GR0A 2OBVA 2P2MA 5BSMA 3T1YC 4B3MC 4L2ZA 3CW8X 1XRAA 3NPDA 4JI1C 4U5YD 4LFCC 3GPCA 4ZJZA 1PG3A 5KEIA 1RG9A 2WP0C 4D4IA 4AQYC 4I9GA 4B3TC 2YWCA 2P2JA 5BUQA 5IWAC 5LMUC 3I08A 2PROA 2CY1A 1V26A 3C5EA 4DR4C 4G1IA 4LE5A 1IBMC 3DLPX 3TDEA 2HHHC 2HJGA 2UXBC 1T5DX 3RV2A 1XRBA 2BH1X 2D1RA 2PT7G 3AF5A 1P7LA 1USPA 1RY2A 2E8CA 4R0MA 4LFBC 1O90A 2P2FA 2QW0X 5LMNC 4WV3A 1HNWC 4RLQA 4ZLPA 4JI4C 4BCAA 3ETOA 4NDNA 1MXBA 4OXIA 2Y27A 4NOZA 1T5HX 5IFIA 2WD9A 1JOSA 4X66C 4JV5C 4DV6C 4GS5A 3PESA 4B3RC 4JI5C 4NXNC 3CJEA 5E7QA 2F4VC 2D1TA 1ZB9A 2EGTA 4BC9A 4WS9A 5DV9A 2P2QA 2ZM6C 5BSUA 3T1HC 4DR2C 3IEUA 3EERA 1QWIA 1O92A 3IEVA 1MDFA 2P20A 1J5EC 1O9TA 1LCIA 4YHHC 4DV3C 1MDBA 3NYQA 4LF7C 1LQLA 4R1MA 4NXMC 2AYAA 4JYAC 5BURA 4XX2A 2UXCC 1K0RA 1L2FA 2KZFA 3E7WA 3R44A 3J81D 4GXQA 4GKJC 2QVXX 4KHPC 4DCTA 1VLAA 5KYVA 4IZ6A 3VNSA 3FCCA 3TUFA 2JMPA 5H9UA 1GPMA 4JI0C 3J7AD 2D1SA 3OTOC 3KXWA 1N34C 4X64C 3TQIA 3NI2A 4DV1C 4D57A 2YCBA 4DV7C 3H2TA 4LF4C 3L8CA 3GKUA 4X65C 5A2QD 3VNQA 4FTFA 1FJGC 4JI8C 1HR0C 4LFAC 4DR6C 2VZEA 3EQ6A 4KTTA 1N36C 3L95X 3LGXA 5A19A 4DG9A 2D7VA 1XRCA 1USPB 1N33C 5K8FA 3J80D 4TPSB 3PROC 4DG8A 5BSWA 1IBKC 2OO4A 3FCEA 3JAMD 5KYTA 2QL8A 3UOWA 4RMNA 3DAYA 4B3SC 4DV0C 4HPVA 1AMUA 1MXAA 3VNRA 1WF3A 4K0BA 4BBYA 3UZ0A 4D56A 4PZPA 3B7WA 2E8EA 5IT9D 4LF9C 3R9XA 2V7BA 4ODJA 3RG2A 3N2QA 4JI6C 3IMLA 3AF6A 1XMQC 1I94C 2BJOA 5FLXD 1PA4A 4RVNA 1XMOC 4JM1A 1XNQC 5CZVA 1PG4A 4OYCA 4DR3C 4RM3A 5AE1A 1MXCA 3LUSA 5A1GA 1MKYA 5AE2A 3A4IA 2ATWA 3A9UA 4D4GA 4DV5C 2CXCA 1ULTA 4DV2C 2UUBC 2E7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK C;  3GKU A;  1NYE A;  2OPL B;  4X65 C;  5A2Q D;  2DYJ A;  4DUY C;  2VQF C;  1JOS A;  2ONF A;  4X66 C;  4JV5 C;  4JI8 C;  1FJG C;  1ML8 A;  4DV6 C;  1HR0 C;  4B3R C;  4LFA C;  4JI2 C;  4DUZ C;  4JI5 C;  4DR1 C;  4BSZ A;  2UU9 C;  4NXN C;  1N36 C;  3CJE A;  4DR6 C;  4DR5 C;  4LF6 C;  1HNX C;  2D7V A;  2F4V C;  1ZB9 A;  1USP B;  1N32 C;  2EGT A;  1ZB8 A;  2OPL A;  3T1Y C;  2ZM6 C;  1N33 C;  2UXD C;  3J80 D;  3T1H C;  4DR2 C;  3IEU A;  4B3M C;  3EER A;  4DR7 C;  1IBK C;  1QWI A;  3R9W A;  3JAM D;  4JI1 C;  4LFC C;  1N2F A;  3IEV A;  2QL8 A;  1J5E C;  2PN2 A;  5BR8 C;  4JI3 C;  1EGA A;  4YHH C;  4DV3 C;  1KKG A;  4B3S C;  4MTN A;  4DV0 C;  4DV4 C;  2ASB A;  4AQY C;  4DCS A;  4LF7 C;  4B3T C;  1LQL A;  4NXM C;  2UUA C;  5IWA C;  5LMU C;  2CY1 A;  4JYA C;  4DR4 C;  1IBM C;  1WF3 A;  4XX2 A;  2HHH C;  2UXC C;  1XNR C;  1L2F A;  1K0R A;  2HJG A;  4OX9 C;  2UXB C;  2KZF A;  3J81 D;  2E8E A;  1WH9 A;  2E8F A;  4LF8 C;  4GKJ C;  4DCV A;  5IT9 D;  4LF9 C;  3R9X A;  4KHP C;  4DCT A;  2E5L C;  2PT7 G;  1VLA A;  4JI6 C;  3AF5 A;  1USP A;  2E8C A;  3AF6 A;  3I07 A;  1XMQ C;  4LFB C;  2JMP A;  1I94 C;  2BJO A;  5FLX D;  1PA4 A;  4K0K C;  5LMN C;  2XR1 A;  1XMO C;  4MH4 A;  1HNW C;  4YY3 C;  4JI0 C;  1XNQ C;  3J7A D;  3OTO C;  4DR3 C;  4X62 C;  1N34 C;  1IBL C;  4JI4 C;  4X64 C;  2UUC C;  3LUS A;  1MKY A;  1UKK A;  2ATW A;  1HNZ C;  4DV1 C;  2YCB A;  4DV7 C;  4DV5 C;  2VQE C;  4LF4 C;  2CXC A;  4JI7 C;  4LF5 C;  4DV2 C;  1HH2 P;  4DCU A;  4NOZ A;  2UUB C;  2E7G A; 
#chains in the Genus database with same CATH topology
 1XS3 A;  1NYE A;  1XDX A;  2OPL B;  4DUY C;  2VQF C;  2ONF A;  3CW9 A;  2YX1 A;  4JI2 C;  4DUZ C;  4BSZ A;  1IB8 A;  2MMA B;  4DR5 C;  3A26 A;  1HNX C;  5K85 A;  2P02 A;  1N32 C;  5GTD A;  5T8S A;  2UXD C;  2Y4N A;  4RVO A;  4I9F A;  4DR7 C;  3R9W A;  1YJ7 A;  1N2F A;  4KTV A;  3LNV A;  2DPL A;  4PRO C;  2PN2 A;  5BR8 C;  4JI3 C;  1EGA A;  4RM2 A;  2P2B A;  3E7X A;  1KKG A;  4MTN A;  2E0G A;  2QVZ X;  2ZZN A;  2QVY X;  4DV4 C;  2ASB A;  4DCS A;  5BST A;  5BSR A;  1QM4 A;  5AE3 A;  2UUA C;  4PHT A;  4RLF A;  1P4E C;  1FLO A;  3N54 B;  4R1L A;  1O93 A;  1XNR C;  4FUQ A;  4G37 A;  4OX9 C;  3IPL A;  3A25 A;  1WH9 A;  2E8F A;  3CQ1 A;  4LF8 C;  4DCV A;  5T8T A;  4ISB A;  2E5L C;  2Y4O A;  2VSQ A;  3GR1 A;  3I07 A;  3A9V A;  2D28 C;  3DHV A;  4K0K C;  2XR1 A;  4MH4 A;  4YY3 C;  2ZZM A;  3LAX A;  4FUT A;  4EAT A;  4X62 C;  5JRH A;  5ADZ A;  1IBL C;  1MD9 A;  5CZX A;  2UUC C;  1UKK A;  2D27 A;  5A1I A;  3ETC A;  4BC7 A;  1HNZ C;  5LCI A;  4L7I A;  3S82 A;  2VQE C;  4LF5 C;  4JI7 C;  3G7S A;  5BSV A;  4IR7 A;  1HH2 P;  4DCU A;  3NYR A;  4L4Q A;  2YWB A;  5BUS A;  1BA3 A;  4GKK C;  2D1Q A;  2DYJ A;  1V25 A;  1ML8 A;  4G36 A;  4DR1 C;  2UU9 C;  2M5H A;  4LF6 C;  4GXR A;  2CU6 A;  3PBK A;  3SO4 A;  1FUG A;  1ZB8 A;  2OPL A;  3GR0 A;  2OBV A;  2P2M A;  5BSM A;  3T1Y C;  4B3M C;  4L2Z A;  3CW8 X;  1XRA A;  3NPD A;  3FM7 A;  4JI1 C;  4U5Y D;  4LFC C;  1VEH A;  3GPC A;  4PUI A;  4ZJZ A;  1PG3 A;  5KEI A;  1RG9 A;  2WP0 C;  4D4I A;  4AQY C;  4I9G A;  4B3T C;  2YWC A;  2P2J A;  3CQ3 A;  5BUQ A;  5IWA C;  5LMU C;  3I08 A;  2PRO A;  2CY1 A;  1V26 A;  3C5E A;  4DR4 C;  4G1I A;  4LE5 A;  1IBM C;  3DLP X;  3TDE A;  2HHH C;  3K6R A;  2HJG A;  2UXB C;  1T5D X;  3RV2 A;  1XRB A;  2BH1 X;  2D1R A;  2PT7 G;  3AF5 A;  1P7L A;  1USP A;  1RY2 A;  2E8C A;  4R0M A;  4LFB C;  1O90 A;  2P2F A;  2QW0 X;  5LMN C;  4WV3 A;  1HNW C;  4RLQ A;  4ZLP A;  4JI4 C;  4BCA A;  3ETO A;  4NDN A;  1MXB A;  1PU1 A;  1WCJ A;  4OXI A;  2Y27 A;  4NOZ A;  1T5H X;  5IFI A;  2WD9 A;  1JOS A;  4X66 C;  4JV5 C;  1XHJ A;  4DV6 C;  4GS5 A;  3PES A;  4B3R C;  4JI5 C;  4NXN C;  3CJE A;  3LNO A;  5E7Q A;  2F4V C;  2D1T A;  1ZB9 A;  2EGT A;  4BC9 A;  4WS9 A;  5DV9 A;  2P2Q A;  2ZM6 C;  1V60 A;  5BSU A;  3T1H C;  4DR2 C;  3IEU A;  3EER A;  1QWI A;  1O92 A;  3IEV A;  1MDF A;  2P20 A;  1J5E C;  1O9T A;  1LCI A;  4YHH C;  4DV3 C;  1MDB A;  3NYQ A;  4LF7 C;  1LQL A;  4R1M A;  4NXM C;  2PG1 E;  2AYA A;  4JYA C;  5BUR A;  2UUB C;  4XX2 A;  2UXC C;  1K0R A;  1L2F A;  2KZF A;  3E7W A;  3R44 A;  3J81 D;  4GXQ A;  4GKJ C;  2QVX X;  4KHP C;  4DCT A;  4PUH A;  1VLA A;  5KYV A;  4IZ6 A;  3VNS A;  3FCC A;  3TUF A;  2JMP A;  5H9U A;  1GPM A;  4JI0 C;  3UX2 A;  3J7A D;  2D1S A;  3OTO C;  3KXW A;  1N34 C;  4X64 C;  3TQI A;  2JNV A;  3NI2 A;  1NY8 A;  1UWD A;  4DV1 C;  4D57 A;  2YCB A;  4DV7 C;  3H2T A;  4LF4 C;  4PUG A;  2Z51 A;  3L8C A;  3GKU A;  3UX3 A;  4X65 C;  5A2Q D;  2ZTB A;  1YGT A;  3VNQ A;  4FTF A;  1FJG C;  4JI8 C;  1HR0 C;  4LFA C;  3TR3 A;  4DR6 C;  2VZE A;  3EQ6 A;  4KTT A;  1N36 C;  2DHM A;  3L95 X;  3LGX A;  5A19 A;  4DG9 A;  2D7V A;  1XRC A;  1USP B;  2MCQ A;  1N33 C;  5K8F A;  3J80 D;  3CQ2 A;  3PRO C;  4TPS B;  4DG8 A;  5BSW A;  1P4E A;  2NCL A;  1M6X A;  1IBK C;  2OO4 A;  3FCE A;  3JAM D;  5KYT A;  2QL8 A;  2KZ0 A;  3UOW A;  3O2E A;  4RMN A;  3DAY A;  4B3S C;  4DV0 C;  1TH5 A;  4HPV A;  2MM9 A;  1AMU A;  1MXA A;  2KDN A;  1WF3 A;  4K0B A;  3UEB A;  4BBY A;  3UZ0 A;  4D56 A;  4PZP A;  3B7W A;  2E8E A;  5IT9 D;  4LF9 C;  3R9X A;  2V7B A;  4ODJ A;  3RG2 A;  3N2Q A;  4JI6 C;  3IML A;  3AF6 A;  1XMQ C;  1I94 C;  2BJO A;  5FLX D;  1PA4 A;  4RVN A;  1M6X C;  1XMO C;  4JM1 A;  3AY0 A;  1XNQ C;  5CZV A;  1PG4 A;  4OYC A;  4DR3 C;  4RM3 A;  5AE1 A;  1MXC A;  3LUS A;  5A1G A;  1MKY A;  5AE2 A;  3A4I A;  2M5O A;  2ATW A;  3A9U A;  4D4G A;  4DV5 C;  2CXC A;  1ULT A;  4DV2 C;  3VNR A;  2E7G A; 
#chains in the Genus database with same CATH homology
 1NYE A;  2OPL B;  4DUY C;  2VQF C;  2ONF A;  3CW9 A;  4JI2 C;  4DUZ C;  4BSZ A;  4DR5 C;  1HNX C;  5K85 A;  2P02 A;  1N32 C;  5GTD A;  5T8S A;  2UXD C;  2Y4N A;  4RVO A;  4I9F A;  4DR7 C;  3R9W A;  1YJ7 A;  1N2F A;  4KTV A;  3LNV A;  2DPL A;  4PRO C;  2PN2 A;  5BR8 C;  4JI3 C;  1EGA A;  4RM2 A;  2P2B A;  3E7X A;  1KKG A;  4MTN A;  2E0G A;  2QVZ X;  2QVY X;  4DV4 C;  2ASB A;  4DCS A;  5BST A;  5BSR A;  1QM4 A;  5AE3 A;  2UUA C;  4PHT A;  4RLF A;  3N54 B;  4R1L A;  1O93 A;  1XNR C;  4FUQ A;  4G37 A;  4OX9 C;  3IPL A;  1WH9 A;  2E8F A;  4LF8 C;  4DCV A;  5T8T A;  4ISB A;  2E5L C;  2Y4O A;  2VSQ A;  3GR1 A;  3I07 A;  3A9V A;  2D28 C;  3DHV A;  4K0K C;  2XR1 A;  4MH4 A;  4YY3 C;  3LAX A;  4FUT A;  4EAT A;  4X62 C;  1IBL C;  5JRH A;  5ADZ A;  1MD9 A;  5CZX A;  2UUC C;  1UKK A;  2D27 A;  5A1I A;  3ETC A;  4BC7 A;  1HNZ C;  4L7I A;  3S82 A;  2VQE C;  4LF5 C;  4JI7 C;  3G7S A;  5BSV A;  4IR7 A;  1HH2 P;  4DCU A;  3NYR A;  4L4Q A;  2YWB A;  5BUS A;  1BA3 A;  4GKK C;  2D1Q A;  2DYJ A;  1V25 A;  1ML8 A;  4G36 A;  4DR1 C;  2UU9 C;  4LF6 C;  4GXR A;  3PBK A;  3SO4 A;  1FUG A;  1ZB8 A;  2OPL A;  3GR0 A;  2OBV A;  2P2M A;  5BSM A;  3T1Y C;  4B3M C;  4L2Z A;  3CW8 X;  1XRA A;  3NPD A;  4JI1 C;  4U5Y D;  4LFC C;  3GPC A;  4ZJZ A;  1PG3 A;  5KEI A;  1RG9 A;  2WP0 C;  4D4I A;  4AQY C;  4I9G A;  4B3T C;  2YWC A;  2P2J A;  5BUQ A;  5IWA C;  5LMU C;  3I08 A;  2PRO A;  2CY1 A;  1V26 A;  3C5E A;  4DR4 C;  4G1I A;  4LE5 A;  1IBM C;  3DLP X;  3TDE A;  2HHH C;  2HJG A;  2UXB C;  1T5D X;  3RV2 A;  1XRB A;  2BH1 X;  2D1R A;  2PT7 G;  3AF5 A;  1P7L A;  1USP A;  1RY2 A;  2E8C A;  4R0M A;  4LFB C;  1O90 A;  2P2F A;  2QW0 X;  5LMN C;  4WV3 A;  1HNW C;  4RLQ A;  4ZLP A;  4JI4 C;  4BCA A;  3ETO A;  4NDN A;  1MXB A;  4OXI A;  2Y27 A;  4NOZ A;  1T5H X;  5IFI A;  2WD9 A;  1JOS A;  4X66 C;  4JV5 C;  4DV6 C;  4GS5 A;  3PES A;  4B3R C;  4JI5 C;  4NXN C;  3CJE A;  5E7Q A;  2F4V C;  2D1T A;  1ZB9 A;  2EGT A;  4BC9 A;  4WS9 A;  5DV9 A;  2P2Q A;  2ZM6 C;  5BSU A;  3T1H C;  4DR2 C;  3IEU A;  3EER A;  1QWI A;  1O92 A;  3IEV A;  1MDF A;  2P20 A;  1J5E C;  1O9T A;  1LCI A;  4YHH C;  4DV3 C;  1MDB A;  3NYQ A;  4LF7 C;  1LQL A;  4R1M A;  4NXM C;  2AYA A;  4JYA C;  5BUR A;  4XX2 A;  2UXC C;  1K0R A;  1L2F A;  2KZF A;  3E7W A;  3R44 A;  3J81 D;  4GXQ A;  4GKJ C;  2QVX X;  4KHP C;  4DCT A;  1VLA A;  5KYV A;  4IZ6 A;  3VNS A;  3FCC A;  3TUF A;  2JMP A;  5H9U A;  1GPM A;  4JI0 C;  3J7A D;  2D1S A;  3OTO C;  3KXW A;  1N34 C;  4X64 C;  3TQI A;  3NI2 A;  4DV1 C;  4D57 A;  2YCB A;  4DV7 C;  3H2T A;  4LF4 C;  3L8C A;  3GKU A;  4X65 C;  5A2Q D;  3VNQ A;  4FTF A;  1FJG C;  4JI8 C;  1HR0 C;  4LFA C;  4DR6 C;  2VZE A;  3EQ6 A;  4KTT A;  1N36 C;  3L95 X;  3LGX A;  5A19 A;  4DG9 A;  2D7V A;  1XRC A;  1USP B;  1N33 C;  5K8F A;  3J80 D;  4TPS B;  3PRO C;  4DG8 A;  5BSW A;  1IBK C;  2OO4 A;  3FCE A;  3JAM D;  5KYT A;  2QL8 A;  3UOW A;  4RMN A;  3DAY A;  4B3S C;  4DV0 C;  4HPV A;  1AMU A;  1MXA A;  3VNR A;  1WF3 A;  4K0B A;  4BBY A;  3UZ0 A;  4D56 A;  4PZP A;  3B7W A;  2E8E A;  5IT9 D;  4LF9 C;  3R9X A;  2V7B A;  4ODJ A;  3RG2 A;  3N2Q A;  4JI6 C;  3IML A;  3AF6 A;  1XMQ C;  1I94 C;  2BJO A;  5FLX D;  1PA4 A;  4RVN A;  1XMO C;  4JM1 A;  1XNQ C;  5CZV A;  1PG4 A;  4OYC A;  4DR3 C;  4RM3 A;  5AE1 A;  1MXC A;  3LUS A;  5A1G A;  1MKY A;  5AE2 A;  3A4I A;  2ATW A;  3A9U A;  4D4G A;  4DV5 C;  2CXC A;  1ULT A;  4DV2 C;  2UUB C;  2E7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...