4DUYC

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 50
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4duyC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4duyC02
4DV0C 2CXCA 3CJEA 1ML8A 4DCVA 2E8CA 4NOZA 1JOSA 4DV1C 3J7AD 4NXMC 4DR7C 4DV2C 1HNZC 3T1HC 2UUCC 5A2QD 1HR0C 2DYJA 4DV3C 1HNWC 2ONFA 4X65C 3IEVA 4LF6C 2OPLB 1ZB9A 2VQEC 2ASBA 4LFBC 2ZM6C 1UKKA 3LUSA 4MH4A 4DCTA 4DR1C 1XMOC 2EGTA 4JI1C 2UXBC 5BR8C 4JI0C 4JYAC 4JI3C 5IT9D 4LF5C 4JI4C 1HNXC 2VQFC 2D7VA 2BJOA 5IWAC 4X62C 4JI7C 1ZB8A 5LMUC 2UUAC 1PA4A 1HH2P 2HJGA 3AF6A 4BSZA 3IEUA 1NYEA 4B3MC 3J80D 4X66C 4KHPC 1N2FA 1USPB 4GKJC 1LQLA 4DR4C 4DR3C 4DR2C 4DV5C 4B3SC 3AF5A 4X64C 1XMQC 2E8FA 1N33C 4XX2A 4B3TC 2F4VC 2KZFA 1N36C 2PT7G 1XNQC 4JI8C 4DV4C 1IBMC 4DCUA 4YHHC 1J5EC 4LFAC 4GKKC 4JI6C 1WH9A 4DR6C 4DCSA 2E7GA 4AQYC 4LFCC 4DV6C 3OTOC 3R9XA 3I07A 1KKGA 3JAMD 2HHHC 2OPLA 4YY3C 1K0RA 1EGAA 2E8EA 3EERA 4DR5C 3GKUA 1VLAA 4JI5C 3T1YC 2ATWA 1N34C 4DUYC 2PN2A 1FJGC 4JI2C 1I94C 4LF9C 2UXCC 4MTNA 4DUZC 5FLXD 2UUBC 4JV5C 1USPA 4K0KC 2YCBA 3J81D 4B3RC 1QWIA 1XNRC 4LF4C 4NXNC 4DV7C 2UXDC 2JMPA 1IBLC 1L2FA 3R9WA 2CY1A 2QL8A 1MKYA 4LF8C 5LMNC 4LF7C 1N32C 2XR1A 4OX9C 1WF3A 1IBKC 2UU9C 2E5LC
chains in the Genus database with same CATH superfamily
3FCEA 3CJEA 4DCVA 2E8CA 4NOZA 4PHTA 4DV1C 2VSQA 1YJ7A 5CZXA 4DV3C 4RLQA 1UWDA 3GPCA 4LFBC 1UKKA 4DR1C 2EGTA 4JI0C 4R0MA 4BC7A 4JI3C 5IT9D 4D57A 1MDFA 3ETOA 2Y4OA 3NYRA 2VQFC 2D7VA 3DAYA 3L95X 3UZ0A 5LMUC 1VEHA 4BSZA 5DV9A 4B3MC 3J80D 1N2FA 3S82A 3A4IA 2QW0X 4DR4C 4L7IA 4D56A 1O90A 4R1MA 4B3SC 2E8FA 5AE1A 3DLPX 2YX1A 3PROC 4WV3A 2F4VC 1N36C 4PUHA 1WCJA 4JI8C 1IBMC 4DCUA 3GR0A 4GKKC 1P7LA 2MM9A 1XRAA 3RG2A 4K0BA 4DV6C 4OXIA 3R9XA 3I07A 4R1LA 4RM3A 4PROC 1K0RA 5JRHA 4RLFA 4HPVA 3EERA 5K85A 4DR5C 4JI5C 1ULTA 1N34C 2NCLA 4DUYC 2M5OA 1I94C 2ZZMA 4DUZC 3AY0A 5A1IA 4LF4C 4NDNA 3CQ1A 4NXNC 3UOWA 2D28C 3R9WA 1MKYA 5LMNC 4LF7C 1IBKC 3IMLA 1P4EA 3LGXA 3RV2A 4NXMC 3UX3A 3FCCA 4DV2C 1HNZC 2WD9A 5KEIA 5CZVA 1HR0C 2DYJA 1HNWC 3IEVA 1FLOA 2OPLB 3LUSA 4MH4A 4G1IA 2Y4NA 2P2FA 1M6XA 2KDNA 4RMNA 5LCIA 4OYCA 2E0GA 2KZ0A 5IWAC 2UUAC 1HH2P 3EQ6A 3N54B 2HJGA 1NYEA 1RG9A 1FUGA 4X66C 4RVOA 4GKJC 3LAXA 3VNRA 4DR3C 5BUSA 3AF5A 3I08A 4XX2A 1MXAA 4B3TC 2JNVA 3G7SA 4DG8A 4YHHC 5BSRA 3VNQA 1J5EC 2OO4A 4JI6C 1WH9A 4DR6C 1MDBA 1XS3A 4DCSA 2E7GA 4LFCC 4FTFA 1XDXA 1V26A 1KKGA 3TQIA 1LCIA 2OPLA 2MMAB 5A19A 1EGAA 3CW9A 2QVZX 1VLAA 3C5EA 3FM7A 3A25A 5BSUA 5AE2A 1MXBA 4RM2A 1FJGC 4LF9C 2UXCC 4MTNA 1BA3A 2UUBC 4K0KC 2YCBA 4ODJA 3LNOA 3J81D 4B3RC 1QWIA 4BCAA 4KTVA 5A1GA 5BUQA 5BSMA 2XR1A 4OX9C 4DV0C 2P2BA 2CXCA 2P20A 2VZEA 3VNSA 1XRBA 5E7QA 3UEBA 3T1HC 2UUCC 3TDEA 5IFIA 4FUQA 2ONFA 4FUTA 4X65C 2VQEC 4DCTA 1XMOC 5BR8C 1O92A 4JYAC 4BC9A 4LF5C 2ZTBA 4JI4C 2YWBA 2BJOA 3SO4A 4X62C 5T8SA 1ZB8A 4KTTA 1PA4A 3R44A 3AF6A 4KHPC 4ZJZA 2OBVA 3NYQA 2AYAA 3LNVA 5H9UA 1N33C 5BSVA 4G37A 3GR1A 1XHJA 2WP0C 4PUGA 3TR3A 1T5DX 3TUFA 2KZFA 3CW8X 4IZ6A 4EATA 1QM4A 4LFAC 2V7BA 4GS5A 4AQYC 2QVXX 1V25A 2QVYX 2D1SA 3NPDA 5GTDA 2YWCA 3KXWA 2E8EA 2BH1X 5AE3A 1XRCA 1O93A 3ETCA 1P4EC 3T1YC 3K6RA 3IPLA 3CQ3A 2CU6A 3CQ2A 3A9UA 4JV5C 4TPSB 1PG3A 1YGTA 2JMPA 1M6XC 1IBLC 5ADZA 1L2FA 3A26A 2QL8A 4ZLPA 4LF8C 3N2QA 4L4QA 2ZZNA 2DHMA 5K8FA 4GXQA 1ML8A 3PBKA 2DPLA 4I9GA 3A9VA 1IB8A 1JOSA 3J7AD 3B7WA 4DR7C 2PROA 3DHVA 4GXRA 4D4IA 5KYTA 5A2QD 4IR7A 3NI2A 4LF6C 2ASBA 1ZB9A 4D4GA 2D1QA 2ZM6C 4JI1C 4L2ZA 2UXBC 2PG1E 1RY2A 4ISBA 4BBYA 2P2QA 1V60A 1PG4A 3PESA 1HNXC 1PU1A 2P02A 4JI7C 3UX2A 4I9FA 1NY8A 1T5HX 3H2TA 2D1TA 1MD9A 1MXCA 3IEUA 1USPB 5BSTA 1LQLA 5KYVA 2P2JA 4DR2C 4DV5C 4X64C 1XMQC 2MCQA 4PZPA 4DG9A 2PT7G 1XNQC 1AMUA 4DV4C 5BSWA 2D27A 1O9TA 4LE5A 3O2EA 2Z51A 3OTOC 4U5YD 2P2MA 4RVNA 3JAMD 2HHHC 4YY3C 1GPMA 4PUIA 2D1RA 3GKUA 2Y27A 2ATWA 5BURA 5T8TA 3E7WA 3E7XA 2PN2A 1TH5A 2M5HA 4JI2C 5FLXD 1USPA 4WS9A 1XNRC 4G36A 2UXDC 4DV7C 2CY1A 1N32C 1WF3A 4JM1A 3L8CA 2UU9C 2E5LC
chains in the Genus database with same CATH topology
3FCEA 3CJEA 4DCVA 2E8CA 4NOZA 4PHTA 4DV1C 2VSQA 1YJ7A 5CZXA 4DV3C 4RLQA 3GPCA 4LFBC 1UKKA 4DR1C 2EGTA 4JI0C 4R0MA 4BC7A 4JI3C 5IT9D 4D57A 1MDFA 3ETOA 2Y4OA 3NYRA 2VQFC 2D7VA 3DAYA 3L95X 3UZ0A 5LMUC 4BSZA 5DV9A 4B3MC 3J80D 1N2FA 3S82A 3A4IA 2QW0X 4DR4C 4L7IA 4D56A 1O90A 4R1MA 4B3SC 2E8FA 5AE1A 3DLPX 3PROC 4WV3A 2F4VC 1N36C 4JI8C 1IBMC 4DCUA 3GR0A 4GKKC 1P7LA 1XRAA 3RG2A 4K0BA 4DV6C 4OXIA 3R9XA 3I07A 4R1LA 4RM3A 4PROC 1K0RA 5JRHA 4RLFA 4HPVA 3EERA 5K85A 4DR5C 4JI5C 1ULTA 1N34C 4DUYC 1I94C 4DUZC 5A1IA 4LF4C 4NDNA 4NXNC 3UOWA 2D28C 3R9WA 1MKYA 5LMNC 4LF7C 1IBKC 3IMLA 3LGXA 3RV2A 4NXMC 3FCCA 4DV2C 1HNZC 2WD9A 5KEIA 5CZVA 1HR0C 2DYJA 1HNWC 3IEVA 2OPLB 3LUSA 4MH4A 4G1IA 2Y4NA 2P2FA 4RMNA 4OYCA 2E0GA 5IWAC 2UUAC 1HH2P 3EQ6A 3N54B 2HJGA 1NYEA 1RG9A 1FUGA 4X66C 4RVOA 4GKJC 3LAXA 3VNRA 4DR3C 5BUSA 3AF5A 3I08A 4XX2A 1MXAA 4B3TC 3G7SA 4DG8A 4YHHC 5BSRA 3VNQA 1J5EC 2OO4A 4JI6C 1WH9A 4DR6C 1MDBA 4DCSA 2E7GA 4LFCC 4FTFA 1V26A 1KKGA 3TQIA 1LCIA 2OPLA 5A19A 1EGAA 3CW9A 2QVZX 1VLAA 3C5EA 5BSUA 5AE2A 1MXBA 4RM2A 1FJGC 4LF9C 2UXCC 4MTNA 1BA3A 2UUBC 4K0KC 2YCBA 4ODJA 3J81D 4B3RC 1QWIA 4BCAA 4KTVA 5A1GA 5BUQA 5BSMA 2XR1A 4OX9C 4DV0C 2P2BA 2CXCA 2P20A 2VZEA 3VNSA 1XRBA 5E7QA 3T1HC 2UUCC 3TDEA 5IFIA 4FUQA 2ONFA 4FUTA 4X65C 2VQEC 4DCTA 1XMOC 5BR8C 1O92A 4JYAC 4BC9A 4LF5C 4JI4C 2YWBA 2BJOA 3SO4A 4X62C 5T8SA 1ZB8A 4KTTA 1PA4A 3R44A 3AF6A 4KHPC 4ZJZA 2OBVA 3NYQA 2AYAA 3LNVA 5H9UA 1N33C 5BSVA 4G37A 3GR1A 2WP0C 1T5DX 3TUFA 2KZFA 3CW8X 4IZ6A 4EATA 1QM4A 4LFAC 2V7BA 4GS5A 4AQYC 2QVXX 1V25A 2QVYX 2D1SA 3NPDA 5GTDA 2YWCA 3KXWA 2E8EA 2BH1X 5AE3A 1XRCA 1O93A 3ETCA 3T1YC 3IPLA 3A9UA 4JV5C 4TPSB 1PG3A 2JMPA 1IBLC 5ADZA 1L2FA 2QL8A 4ZLPA 4LF8C 3N2QA 4L4QA 5K8FA 4GXQA 1ML8A 3PBKA 2DPLA 4I9GA 3A9VA 1JOSA 3J7AD 3B7WA 4DR7C 2PROA 3DHVA 4GXRA 4D4IA 5KYTA 5A2QD 4IR7A 3NI2A 4LF6C 2ASBA 1ZB9A 4D4GA 2D1QA 2ZM6C 4JI1C 4L2ZA 2UXBC 1RY2A 4ISBA 4BBYA 2P2QA 1PG4A 3PESA 1HNXC 2P02A 4JI7C 4I9FA 1T5HX 3H2TA 2D1TA 1MD9A 1MXCA 3IEUA 1USPB 5BSTA 1LQLA 5KYVA 2P2JA 4DR2C 4DV5C 4X64C 1XMQC 4PZPA 4DG9A 2PT7G 1XNQC 1AMUA 4DV4C 5BSWA 2D27A 1O9TA 4LE5A 3OTOC 4U5YD 2P2MA 4RVNA 3JAMD 2HHHC 4YY3C 1GPMA 2D1RA 3GKUA 2Y27A 2ATWA 5BURA 5T8TA 3E7WA 3E7XA 2PN2A 4JI2C 5FLXD 1USPA 4WS9A 1XNRC 4G36A 2UXDC 4DV7C 2CY1A 1N32C 1WF3A 4JM1A 3L8CA 2UU9C 2E5LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 C;  2CXC A;  3CJE A;  1ML8 A;  4DCV A;  2E8C A;  4NOZ A;  1JOS A;  4DV1 C;  3J7A D;  4NXM C;  4DR7 C;  4DV2 C;  1HNZ C;  3T1H C;  2UUC C;  5A2Q D;  1HR0 C;  2DYJ A;  4DV3 C;  1HNW C;  2ONF A;  4X65 C;  3IEV A;  4LF6 C;  2OPL B;  1ZB9 A;  2VQE C;  2ASB A;  4LFB C;  2ZM6 C;  1UKK A;  3LUS A;  4MH4 A;  4DCT A;  4DR1 C;  1XMO C;  2EGT A;  4JI1 C;  2UXB C;  5BR8 C;  4JI0 C;  4JYA C;  4JI3 C;  5IT9 D;  4LF5 C;  4JI4 C;  1HNX C;  2VQF C;  2D7V A;  2BJO A;  5IWA C;  4X62 C;  4JI7 C;  1ZB8 A;  5LMU C;  2UUA C;  1PA4 A;  1HH2 P;  2HJG A;  3AF6 A;  4BSZ A;  3IEU A;  1NYE A;  4B3M C;  3J80 D;  4X66 C;  4KHP C;  1N2F A;  1USP B;  4GKJ C;  1LQL A;  4DR4 C;  4DR3 C;  4DR2 C;  4DV5 C;  4B3S C;  3AF5 A;  4X64 C;  1XMQ C;  2E8F A;  1N33 C;  4XX2 A;  4B3T C;  2F4V C;  2KZF A;  1N36 C;  2PT7 G;  1XNQ C;  4JI8 C;  4DV4 C;  1IBM C;  4DCU A;  4YHH C;  1J5E C;  4LFA C;  4GKK C;  4JI6 C;  1WH9 A;  4DR6 C;  4DCS A;  2E7G A;  4AQY C;  4LFC C;  4DV6 C;  3OTO C;  3R9X A;  3I07 A;  1KKG A;  3JAM D;  2HHH C;  2OPL A;  4YY3 C;  1K0R A;  1EGA A;  2E8E A;  3EER A;  4DR5 C;  3GKU A;  1VLA A;  4JI5 C;  3T1Y C;  2ATW A;  1N34 C;  4DUY C;  2PN2 A;  1FJG C;  4JI2 C;  1I94 C;  4LF9 C;  2UXC C;  4MTN A;  4DUZ C;  5FLX D;  2UUB C;  4JV5 C;  1USP A;  4K0K C;  2YCB A;  3J81 D;  4B3R C;  1QWI A;  1XNR C;  4LF4 C;  4NXN C;  4DV7 C;  2UXD C;  2JMP A;  1IBL C;  1L2F A;  3R9W A;  2CY1 A;  2QL8 A;  1MKY A;  4LF8 C;  5LMN C;  4LF7 C;  1N32 C;  2XR1 A;  4OX9 C;  1WF3 A;  1IBK C;  2UU9 C;  2E5L C; 
#chains in the Genus database with same CATH topology
 3FCE A;  3CJE A;  4DCV A;  2E8C A;  4NOZ A;  4PHT A;  4DV1 C;  2VSQ A;  1YJ7 A;  5CZX A;  4DV3 C;  4RLQ A;  1UWD A;  3GPC A;  4LFB C;  1UKK A;  4DR1 C;  2EGT A;  4JI0 C;  4R0M A;  4BC7 A;  4JI3 C;  5IT9 D;  4D57 A;  1MDF A;  3ETO A;  2Y4O A;  3NYR A;  2VQF C;  2D7V A;  3DAY A;  3L95 X;  3UZ0 A;  5LMU C;  1VEH A;  4BSZ A;  5DV9 A;  4B3M C;  3J80 D;  1N2F A;  3S82 A;  3A4I A;  2QW0 X;  4DR4 C;  4L7I A;  4D56 A;  1O90 A;  4R1M A;  4B3S C;  2E8F A;  5AE1 A;  3DLP X;  2YX1 A;  3PRO C;  4WV3 A;  2F4V C;  1N36 C;  4PUH A;  1WCJ A;  4JI8 C;  1IBM C;  4DCU A;  3GR0 A;  4GKK C;  1P7L A;  2MM9 A;  1XRA A;  3RG2 A;  4K0B A;  4DV6 C;  4OXI A;  3R9X A;  3I07 A;  4R1L A;  4RM3 A;  4PRO C;  1K0R A;  5JRH A;  4RLF A;  4HPV A;  3EER A;  5K85 A;  4DR5 C;  4JI5 C;  1ULT A;  1N34 C;  2NCL A;  4DUY C;  2M5O A;  1I94 C;  2ZZM A;  4DUZ C;  3AY0 A;  5A1I A;  4LF4 C;  4NDN A;  3CQ1 A;  4NXN C;  3UOW A;  2D28 C;  3R9W A;  1MKY A;  5LMN C;  4LF7 C;  1IBK C;  3IML A;  1P4E A;  3LGX A;  3RV2 A;  4NXM C;  3UX3 A;  3FCC A;  4DV2 C;  1HNZ C;  2WD9 A;  5KEI A;  5CZV A;  1HR0 C;  2DYJ A;  1HNW C;  3IEV A;  1FLO A;  2OPL B;  3LUS A;  4MH4 A;  4G1I A;  2Y4N A;  2P2F A;  1M6X A;  2KDN A;  4RMN A;  5LCI A;  4OYC A;  2E0G A;  2KZ0 A;  5IWA C;  2UUA C;  1HH2 P;  3EQ6 A;  3N54 B;  2HJG A;  1NYE A;  1RG9 A;  1FUG A;  4X66 C;  4RVO A;  4GKJ C;  3LAX A;  3VNR A;  4DR3 C;  5BUS A;  3AF5 A;  3I08 A;  4XX2 A;  1MXA A;  4B3T C;  2JNV A;  3G7S A;  4DG8 A;  4YHH C;  5BSR A;  3VNQ A;  1J5E C;  2OO4 A;  4JI6 C;  1WH9 A;  4DR6 C;  1MDB A;  1XS3 A;  4DCS A;  2E7G A;  4LFC C;  4FTF A;  1XDX A;  1V26 A;  1KKG A;  3TQI A;  1LCI A;  2OPL A;  2MMA B;  5A19 A;  1EGA A;  3CW9 A;  2QVZ X;  1VLA A;  3C5E A;  3FM7 A;  3A25 A;  5BSU A;  5AE2 A;  1MXB A;  4RM2 A;  1FJG C;  4LF9 C;  2UXC C;  4MTN A;  1BA3 A;  2UUB C;  4K0K C;  2YCB A;  4ODJ A;  3LNO A;  3J81 D;  4B3R C;  1QWI A;  4BCA A;  4KTV A;  5A1G A;  5BUQ A;  5BSM A;  2XR1 A;  4OX9 C;  4DV0 C;  2P2B A;  2CXC A;  2P20 A;  2VZE A;  3VNS A;  1XRB A;  5E7Q A;  3UEB A;  3T1H C;  2UUC C;  3TDE A;  5IFI A;  4FUQ A;  2ONF A;  4FUT A;  4X65 C;  2VQE C;  4DCT A;  1XMO C;  5BR8 C;  1O92 A;  4JYA C;  4BC9 A;  4LF5 C;  2ZTB A;  4JI4 C;  2YWB A;  2BJO A;  3SO4 A;  4X62 C;  5T8S A;  1ZB8 A;  4KTT A;  1PA4 A;  3R44 A;  3AF6 A;  4KHP C;  4ZJZ A;  2OBV A;  3NYQ A;  2AYA A;  3LNV A;  5H9U A;  1N33 C;  5BSV A;  4G37 A;  3GR1 A;  1XHJ A;  2WP0 C;  4PUG A;  3TR3 A;  1T5D X;  3TUF A;  2KZF A;  3CW8 X;  4IZ6 A;  4EAT A;  1QM4 A;  4LFA C;  2V7B A;  4GS5 A;  4AQY C;  2QVX X;  1V25 A;  2QVY X;  2D1S A;  3NPD A;  5GTD A;  2YWC A;  3KXW A;  2E8E A;  2BH1 X;  5AE3 A;  1XRC A;  1O93 A;  3ETC A;  1P4E C;  3T1Y C;  3K6R A;  3IPL A;  3CQ3 A;  2CU6 A;  3CQ2 A;  3A9U A;  4JV5 C;  4TPS B;  1PG3 A;  1YGT A;  2JMP A;  1M6X C;  1IBL C;  5ADZ A;  1L2F A;  3A26 A;  2QL8 A;  4ZLP A;  4LF8 C;  3N2Q A;  4L4Q A;  2ZZN A;  2DHM A;  5K8F A;  4GXQ A;  1ML8 A;  3PBK A;  2DPL A;  4I9G A;  3A9V A;  1IB8 A;  1JOS A;  3J7A D;  3B7W A;  4DR7 C;  2PRO A;  3DHV A;  4GXR A;  4D4I A;  5KYT A;  5A2Q D;  4IR7 A;  3NI2 A;  4LF6 C;  2ASB A;  1ZB9 A;  4D4G A;  2D1Q A;  2ZM6 C;  4JI1 C;  4L2Z A;  2UXB C;  2PG1 E;  1RY2 A;  4ISB A;  4BBY A;  2P2Q A;  1V60 A;  1PG4 A;  3PES A;  1HNX C;  1PU1 A;  2P02 A;  4JI7 C;  3UX2 A;  4I9F A;  1NY8 A;  1T5H X;  3H2T A;  2D1T A;  1MD9 A;  1MXC A;  3IEU A;  1USP B;  5BST A;  1LQL A;  5KYV A;  2P2J A;  4DR2 C;  4DV5 C;  4X64 C;  1XMQ C;  2MCQ A;  4PZP A;  4DG9 A;  2PT7 G;  1XNQ C;  1AMU A;  4DV4 C;  5BSW A;  2D27 A;  1O9T A;  4LE5 A;  3O2E A;  2Z51 A;  3OTO C;  4U5Y D;  2P2M A;  4RVN A;  3JAM D;  2HHH C;  4YY3 C;  1GPM A;  4PUI A;  2D1R A;  3GKU A;  2Y27 A;  2ATW A;  5BUR A;  5T8T A;  3E7W A;  3E7X A;  2PN2 A;  1TH5 A;  2M5H A;  4JI2 C;  5FLX D;  1USP A;  4WS9 A;  1XNR C;  4G36 A;  2UXD C;  4DV7 C;  2CY1 A;  1N32 C;  1WF3 A;  4JM1 A;  3L8C A;  2UU9 C;  2E5L C; 
#chains in the Genus database with same CATH homology
 3FCE A;  3CJE A;  4DCV A;  2E8C A;  4NOZ A;  4PHT A;  4DV1 C;  2VSQ A;  1YJ7 A;  5CZX A;  4DV3 C;  4RLQ A;  3GPC A;  4LFB C;  1UKK A;  4DR1 C;  2EGT A;  4JI0 C;  4R0M A;  4BC7 A;  4JI3 C;  5IT9 D;  4D57 A;  1MDF A;  3ETO A;  2Y4O A;  3NYR A;  2VQF C;  2D7V A;  3DAY A;  3L95 X;  3UZ0 A;  5LMU C;  4BSZ A;  5DV9 A;  4B3M C;  3J80 D;  1N2F A;  3S82 A;  3A4I A;  2QW0 X;  4DR4 C;  4L7I A;  4D56 A;  1O90 A;  4R1M A;  4B3S C;  2E8F A;  5AE1 A;  3DLP X;  3PRO C;  4WV3 A;  2F4V C;  1N36 C;  4JI8 C;  1IBM C;  4DCU A;  3GR0 A;  4GKK C;  1P7L A;  1XRA A;  3RG2 A;  4K0B A;  4DV6 C;  4OXI A;  3R9X A;  3I07 A;  4R1L A;  4RM3 A;  4PRO C;  1K0R A;  5JRH A;  4RLF A;  4HPV A;  3EER A;  5K85 A;  4DR5 C;  4JI5 C;  1ULT A;  1N34 C;  4DUY C;  1I94 C;  4DUZ C;  5A1I A;  4LF4 C;  4NDN A;  4NXN C;  3UOW A;  2D28 C;  3R9W A;  1MKY A;  5LMN C;  4LF7 C;  1IBK C;  3IML A;  3LGX A;  3RV2 A;  4NXM C;  3FCC A;  4DV2 C;  1HNZ C;  2WD9 A;  5KEI A;  5CZV A;  1HR0 C;  2DYJ A;  1HNW C;  3IEV A;  2OPL B;  3LUS A;  4MH4 A;  4G1I A;  2Y4N A;  2P2F A;  4RMN A;  4OYC A;  2E0G A;  5IWA C;  2UUA C;  1HH2 P;  3EQ6 A;  3N54 B;  2HJG A;  1NYE A;  1RG9 A;  1FUG A;  4X66 C;  4RVO A;  4GKJ C;  3LAX A;  3VNR A;  4DR3 C;  5BUS A;  3AF5 A;  3I08 A;  4XX2 A;  1MXA A;  4B3T C;  3G7S A;  4DG8 A;  4YHH C;  5BSR A;  3VNQ A;  1J5E C;  2OO4 A;  4JI6 C;  1WH9 A;  4DR6 C;  1MDB A;  4DCS A;  2E7G A;  4LFC C;  4FTF A;  1V26 A;  1KKG A;  3TQI A;  1LCI A;  2OPL A;  5A19 A;  1EGA A;  3CW9 A;  2QVZ X;  1VLA A;  3C5E A;  5BSU A;  5AE2 A;  1MXB A;  4RM2 A;  1FJG C;  4LF9 C;  2UXC C;  4MTN A;  1BA3 A;  2UUB C;  4K0K C;  2YCB A;  4ODJ A;  3J81 D;  4B3R C;  1QWI A;  4BCA A;  4KTV A;  5A1G A;  5BUQ A;  5BSM A;  2XR1 A;  4OX9 C;  4DV0 C;  2P2B A;  2CXC A;  2P20 A;  2VZE A;  3VNS A;  1XRB A;  5E7Q A;  3T1H C;  2UUC C;  3TDE A;  5IFI A;  4FUQ A;  2ONF A;  4FUT A;  4X65 C;  2VQE C;  4DCT A;  1XMO C;  5BR8 C;  1O92 A;  4JYA C;  4BC9 A;  4LF5 C;  4JI4 C;  2YWB A;  2BJO A;  3SO4 A;  4X62 C;  5T8S A;  1ZB8 A;  4KTT A;  1PA4 A;  3R44 A;  3AF6 A;  4KHP C;  4ZJZ A;  2OBV A;  3NYQ A;  2AYA A;  3LNV A;  5H9U A;  1N33 C;  5BSV A;  4G37 A;  3GR1 A;  2WP0 C;  1T5D X;  3TUF A;  2KZF A;  3CW8 X;  4IZ6 A;  4EAT A;  1QM4 A;  4LFA C;  2V7B A;  4GS5 A;  4AQY C;  2QVX X;  1V25 A;  2QVY X;  2D1S A;  3NPD A;  5GTD A;  2YWC A;  3KXW A;  2E8E A;  2BH1 X;  5AE3 A;  1XRC A;  1O93 A;  3ETC A;  3T1Y C;  3IPL A;  3A9U A;  4JV5 C;  4TPS B;  1PG3 A;  2JMP A;  1IBL C;  5ADZ A;  1L2F A;  2QL8 A;  4ZLP A;  4LF8 C;  3N2Q A;  4L4Q A;  5K8F A;  4GXQ A;  1ML8 A;  3PBK A;  2DPL A;  4I9G A;  3A9V A;  1JOS A;  3J7A D;  3B7W A;  4DR7 C;  2PRO A;  3DHV A;  4GXR A;  4D4I A;  5KYT A;  5A2Q D;  4IR7 A;  3NI2 A;  4LF6 C;  2ASB A;  1ZB9 A;  4D4G A;  2D1Q A;  2ZM6 C;  4JI1 C;  4L2Z A;  2UXB C;  1RY2 A;  4ISB A;  4BBY A;  2P2Q A;  1PG4 A;  3PES A;  1HNX C;  2P02 A;  4JI7 C;  4I9F A;  1T5H X;  3H2T A;  2D1T A;  1MD9 A;  1MXC A;  3IEU A;  1USP B;  5BST A;  1LQL A;  5KYV A;  2P2J A;  4DR2 C;  4DV5 C;  4X64 C;  1XMQ C;  4PZP A;  4DG9 A;  2PT7 G;  1XNQ C;  1AMU A;  4DV4 C;  5BSW A;  2D27 A;  1O9T A;  4LE5 A;  3OTO C;  4U5Y D;  2P2M A;  4RVN A;  3JAM D;  2HHH C;  4YY3 C;  1GPM A;  2D1R A;  3GKU A;  2Y27 A;  2ATW A;  5BUR A;  5T8T A;  3E7W A;  3E7X A;  2PN2 A;  4JI2 C;  5FLX D;  1USP A;  4WS9 A;  1XNR C;  4G36 A;  2UXD C;  4DV7 C;  2CY1 A;  1N32 C;  1WF3 A;  4JM1 A;  3L8C A;  2UU9 C;  2E5L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...