4DUYC

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 50
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4duyC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4duyC02
4KHPC 1JOSA 1LQLA 1ZB8A 2CY1A 2CXCA 5FLXD 1N34C 4LF8C 2ATWA 4GKJC 4DV0C 1MKYA 4LF9C 3J80D 4JI7C 3JAMD 1HNWC 4JI3C 4DR6C 4JI4C 5A2QD 4DR3C 1ML8A 4X62C 1KKGA 3T1YC 4AQYC 1IBLC 1HR0C 2HJGA 2UUBC 2DYJA 4JI6C 4YHHC 4JI5C 4B3MC 2PT7G 5IWAC 4XX2A 4DUZC 3J7AD 3CJEA 3T1HC 4LF5C 4DV1C 4DR4C 2UXDC 5BR8C 4JYAC 4LF7C 1VLAA 4JI1C 2KZFA 2UXCC 4NOZA 1HH2P 2VQFC 4JI2C 2F4VC 4DCUA 4BSZA 1NYEA 4DV4C 3R9WA 4JV5C 3IEUA 3IEVA 5IT9D 1QWIA 2UXBC 4NXMC 2E8CA 1XNQC 4MTNA 2UUAC 4B3TC 5LMNC 1N33C 3OTOC 4YY3C 4X65C 1IBMC 2UUCC 4GKKC 2XR1A 3AF5A 5LMUC 1ZB9A 4DR7C 1EGAA 2ASBA 4DR1C 1I94C 1HNZC 4DR5C 2OPLB 4DV3C 4MH4A 4OX9C 1N2FA 4DV6C 1FJGC 2ZM6C 4JI0C 3I07A 1J5EC 2BJOA 1USPB 2VQEC 2HHHC 4LF4C 2E7GA 2E8FA 2OPLA 1K0RA 1WF3A 4DV7C 3AF6A 1UKKA 2D7VA 2YCBA 3R9XA 2E5LC 1L2FA 2E8EA 1N32C 4LF6C 3LUSA 4K0KC 2UU9C 2ONFA 1USPA 4X66C 4X64C 2PN2A 4DV5C 4DUYC 2QL8A 1N36C 3GKUA 4LFBC 4DCSA 4DV2C 1WH9A 4B3RC 4DCTA 2EGTA 4B3SC 4LFAC 4JI8C 4LFCC 1IBKC 1XMQC 1PA4A 3EERA 1HNXC 4NXNC 4DCVA 3J81D 2JMPA 1XMOC 1XNRC 4DR2C
chains in the Genus database with same CATH superfamily
1JOSA 1RY2A 1XRBA 4BCAA 2P2QA 3C5EA 3TQIA 4LF9C 3K6RA 3ETOA 2KDNA 4JI7C 1HNWC 3PROC 3A9UA 5BSVA 4DR3C 3T1YC 2BH1X 2CU6A 4AQYC 1IBLC 3CW9A 1HR0C 4OXIA 4K0BA 3VNQA 3H2TA 2KZ0A 2PT7G 5IWAC 3T1HC 2D1SA 4BBYA 5BURA 4DR4C 3L8CA 3NYQA 5BR8C 2VQFC 2F4VC 4DCUA 1V26A 4BSZA 3R9WA 3E7XA 5BSWA 2MCQA 3TDEA 4NXMC 2UUAC 4B3TC 5LMNC 1P7LA 4ISBA 3IMLA 3GPCA 4GKKC 4RMNA 4PROC 4I9GA 1TH5A 2P02A 4TPSB 4DR1C 4DR5C 3I08A 1O9TA 4DV6C 1MD9A 2ZM6C 4JI0C 2P2JA 2BJOA 2QVYX 3CQ1A 2ZZNA 4LF4C 3NYRA 2Y4NA 3RV2A 1PG3A 2E8EA 3KXWA 4LF6C 4U5YD 2ONFA 1QM4A 3A25A 1T5DX 3TR3A 4FUQA 4NXNC 1PA4A 2JMPA 4DR2C 4KHPC 1ZB8A 5FLXD 2OO4A 4LF8C 2ATWA 2WD9A 1XRCA 3ETCA 4KTTA 1MKYA 5BSRA 1WCJA 3S82A 3FCCA 4FUTA 2JNVA 4DR6C 1M6XC 1RG9A 2YX1A 5A2QD 1XS3A 4X62C 4D4IA 1MXAA 2Y4OA 5DV9A 5K8FA 1LCIA 2HJGA 4G36A 3CQ3A 5A19A 2D1QA 2PG1E 4RLQA 2UXDC 2Y27A 2VZEA 2KZFA 2UXCC 1HH2P 3LNOA 3O2EA 3A9VA 4NDNA 1AMUA 2D28C 5IT9D 4GXQA 3EQ6A 2DHMA 1P4EA 2UUCC 4KTVA 1ZB9A 1EGAA 2QVZX 2ASBA 1I94C 1YJ7A 4DV3C 4MH4A 4OX9C 1T5HX 3SO4A 2P2BA 5K85A 1J5EC 2Z51A 1XRAA 3GR1A 5A1GA 4R1LA 4FTFA 1NY8A 4PUIA 5BSTA 3DAYA 2V7BA 1K0RA 1WF3A 3PBKA 2YCBA 4RLFA 3R9XA 2P2FA 4BC9A 4R0MA 2P2MA 4PUGA 1N32C 3LUSA 4K0KC 3A26A 4PZPA 1N36C 5ADZA 3GKUA 4DCSA 1WH9A 5T8TA 4LFAC 4LFCC 1VEHA 1IBKC 3EERA 3J81D 5CZVA 1O92A 1XNRC 1N34C 2CY1A 3N54B 2CXCA 4WV3A 3B7WA 4DV0C 4R1MA 1UWDA 4PUHA 3UX3A 3L95X 4ODJA 4JI3C 2PROA 3CQ2A 1IB8A 3LNVA 2D1RA 1MXCA 2DPLA 2VSQA 3FM7A 5BUSA 4ZJZA 2UUBC 1MDBA 2DYJA 1ULTA 4YHHC 3NI2A 4XX2A 4DUZC 3J7AD 5CZXA 4DG9A 1FUGA 3CJEA 4DV1C 4LF7C 1VLAA 4JI1C 4NOZA 2M5OA 2MM9A 4DV4C 1V60A 4JV5C 5AE1A 1QWIA 3DHVA 2E8CA 4WS9A 3PESA 3LGXA 4ZLPA 4D56A 5IFIA 1N33C 4X65C 4RM2A 2XR1A 4L4QA 4DR7C 1XDXA 4I9FA 1XHJA 2OPLB 3A4IA 5H9UA 5AE2A 4RM3A 3I07A 4EATA 5JRHA 5E7QA 2HHHC 1P4EC 4PHTA 5BSMA 3N2QA 4BC7A 2E8FA 2OPLA 4DV7C 3UOWA 3AF6A 3VNSA 1UKKA 2P20A 4OYCA 1L2FA 3G7SA 2YWCA 4RVOA 5KYVA 4X64C 2PN2A 2WP0C 5KEIA 4DV5C 2QL8A 4DV2C 4DCTA 2EGTA 1O93A 3VNRA 1XMQC 5BSUA 2OBVA 4DCVA 1XMOC 1O90A 1LQLA 2E0GA 3DLPX 4GKJC 2QW0X 3LAXA 4L7IA 3TUFA 3J80D 1PG4A 3NPDA 3JAMD 2D1TA 5T8SA 2AYAA 2D27A 4JI4C 4IR7A 1ML8A 1KKGA 1V25A 3R44A 4JI6C 3E7WA 4JI5C 4B3MC 5A1IA 4JM1A 4LF5C 4RVNA 4D4GA 2NCLA 4JYAC 4GXRA 5LCIA 4G37A 4JI2C 1NYEA 1MDFA 2ZTBA 3UZ0A 3IEUA 3IEVA 2YWBA 2UXBC 1XNQC 4MTNA 5GTDA 3OTOC 3GR0A 4YY3C 1IBMC 3AF5A 4IZ6A 5LMUC 2ZZMA 1HNZC 1GPMA 1N2FA 1FJGC 4D57A 1MXBA 3FCEA 1USPB 2VQEC 2E7GA 3AY0A 3UX2A 4GS5A 2QVXX 2M5HA 1YGTA 1BA3A 4HPVA 3IPLA 2D7VA 3UEBA 2E5LC 1PU1A 2UU9C 3CW8X 1FLOA 4LE5A 1USPA 4X66C 4L2ZA 5AE3A 5BUQA 1M6XA 4DUYC 4LFBC 4B3RC 4G1IA 4B3SC 4JI8C 4DG8A 1HNXC 2MMAB 5KYTA 3RG2A
chains in the Genus database with same CATH topology
1JOSA 1RY2A 1XRBA 4BCAA 2P2QA 3C5EA 3TQIA 4LF9C 3ETOA 4JI7C 1HNWC 3PROC 3A9UA 5BSVA 4DR3C 3T1YC 2BH1X 4AQYC 1IBLC 3CW9A 1HR0C 4OXIA 4K0BA 3VNQA 3H2TA 2PT7G 5IWAC 3T1HC 2D1SA 4BBYA 5BURA 4DR4C 3L8CA 3NYQA 5BR8C 2VQFC 2F4VC 4DCUA 1V26A 4BSZA 3R9WA 3E7XA 5BSWA 3TDEA 4NXMC 2UUAC 4B3TC 5LMNC 1P7LA 4ISBA 3IMLA 3GPCA 4GKKC 4RMNA 4PROC 4I9GA 2P02A 4TPSB 4DR1C 4DR5C 3I08A 1O9TA 4DV6C 1MD9A 2ZM6C 4JI0C 2P2JA 2BJOA 2QVYX 4LF4C 3NYRA 2Y4NA 3RV2A 1PG3A 2E8EA 3KXWA 4LF6C 4U5YD 2ONFA 1QM4A 1T5DX 4FUQA 4NXNC 1PA4A 2JMPA 4DR2C 4KHPC 1ZB8A 5FLXD 2OO4A 4LF8C 2ATWA 2WD9A 1XRCA 3ETCA 4KTTA 1MKYA 5BSRA 3S82A 3FCCA 4FUTA 4DR6C 1RG9A 5A2QD 4X62C 4D4IA 1MXAA 2Y4OA 5DV9A 5K8FA 1LCIA 2HJGA 4G36A 5A19A 2D1QA 4RLQA 2UXDC 2Y27A 2VZEA 2KZFA 2UXCC 1HH2P 3A9VA 4NDNA 1AMUA 2D28C 5IT9D 4GXQA 3EQ6A 2UUCC 4KTVA 1ZB9A 1EGAA 2QVZX 2ASBA 1I94C 1YJ7A 4DV3C 4MH4A 4OX9C 1T5HX 3SO4A 2P2BA 5K85A 1J5EC 1XRAA 3GR1A 5A1GA 4R1LA 4FTFA 5BSTA 3DAYA 2V7BA 1K0RA 1WF3A 3PBKA 2YCBA 4RLFA 3R9XA 2P2FA 4BC9A 4R0MA 2P2MA 1N32C 3LUSA 4K0KC 4PZPA 1N36C 5ADZA 3GKUA 4DCSA 1WH9A 5T8TA 4LFAC 4LFCC 1IBKC 3EERA 3J81D 5CZVA 1O92A 1XNRC 1N34C 2CY1A 3N54B 2CXCA 4WV3A 3B7WA 4DV0C 4R1MA 3L95X 4ODJA 4JI3C 2PROA 3LNVA 2D1RA 1MXCA 2DPLA 2VSQA 5BUSA 4ZJZA 2UUBC 1MDBA 2DYJA 1ULTA 4YHHC 3NI2A 4XX2A 4DUZC 3J7AD 5CZXA 4DG9A 1FUGA 3CJEA 4DV1C 4LF7C 1VLAA 4JI1C 4NOZA 4DV4C 4JV5C 5AE1A 1QWIA 3DHVA 2E8CA 4WS9A 3PESA 3LGXA 4ZLPA 4D56A 5IFIA 1N33C 4X65C 4RM2A 2XR1A 4L4QA 4DR7C 4I9FA 2OPLB 3A4IA 5H9UA 5AE2A 4RM3A 3I07A 4EATA 5JRHA 5E7QA 2HHHC 4PHTA 5BSMA 3N2QA 4BC7A 2E8FA 2OPLA 4DV7C 3UOWA 3AF6A 3VNSA 1UKKA 2P20A 4OYCA 1L2FA 3G7SA 2YWCA 4RVOA 5KYVA 4X64C 2PN2A 2WP0C 5KEIA 4DV5C 2QL8A 4DV2C 4DCTA 2EGTA 1O93A 3VNRA 1XMQC 5BSUA 2OBVA 4DCVA 1XMOC 1O90A 1LQLA 2E0GA 3DLPX 4GKJC 2QW0X 3LAXA 4L7IA 3TUFA 3J80D 1PG4A 3NPDA 3JAMD 2D1TA 5T8SA 2AYAA 2D27A 4JI4C 4IR7A 1ML8A 1KKGA 1V25A 3R44A 4JI6C 3E7WA 4JI5C 4B3MC 5A1IA 4JM1A 4LF5C 4RVNA 4D4GA 4JYAC 4GXRA 4G37A 4JI2C 1NYEA 1MDFA 3UZ0A 3IEUA 3IEVA 2YWBA 2UXBC 1XNQC 4MTNA 5GTDA 3OTOC 3GR0A 4YY3C 1IBMC 3AF5A 4IZ6A 5LMUC 1HNZC 1GPMA 1N2FA 1FJGC 4D57A 1MXBA 3FCEA 1USPB 2VQEC 2E7GA 4GS5A 2QVXX 1BA3A 4HPVA 3IPLA 2D7VA 2E5LC 2UU9C 3CW8X 4LE5A 1USPA 4X66C 4L2ZA 5AE3A 5BUQA 4DUYC 4LFBC 4B3RC 4G1IA 4B3SC 4JI8C 4DG8A 1HNXC 5KYTA 3RG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP C;  1JOS A;  1LQL A;  1ZB8 A;  2CY1 A;  2CXC A;  5FLX D;  1N34 C;  4LF8 C;  2ATW A;  4GKJ C;  4DV0 C;  1MKY A;  4LF9 C;  3J80 D;  4JI7 C;  3JAM D;  1HNW C;  4JI3 C;  4DR6 C;  4JI4 C;  5A2Q D;  4DR3 C;  1ML8 A;  4X62 C;  1KKG A;  3T1Y C;  4AQY C;  1IBL C;  1HR0 C;  2HJG A;  2UUB C;  2DYJ A;  4JI6 C;  4YHH C;  4JI5 C;  4B3M C;  2PT7 G;  5IWA C;  4XX2 A;  4DUZ C;  3J7A D;  3CJE A;  3T1H C;  4LF5 C;  4DV1 C;  4DR4 C;  2UXD C;  5BR8 C;  4JYA C;  4LF7 C;  1VLA A;  4JI1 C;  2KZF A;  2UXC C;  4NOZ A;  1HH2 P;  2VQF C;  4JI2 C;  2F4V C;  4DCU A;  4BSZ A;  1NYE A;  4DV4 C;  3R9W A;  4JV5 C;  3IEU A;  3IEV A;  5IT9 D;  1QWI A;  2UXB C;  4NXM C;  2E8C A;  1XNQ C;  4MTN A;  2UUA C;  4B3T C;  5LMN C;  1N33 C;  3OTO C;  4YY3 C;  4X65 C;  1IBM C;  2UUC C;  4GKK C;  2XR1 A;  3AF5 A;  5LMU C;  1ZB9 A;  4DR7 C;  1EGA A;  2ASB A;  4DR1 C;  1I94 C;  1HNZ C;  4DR5 C;  2OPL B;  4DV3 C;  4MH4 A;  4OX9 C;  1N2F A;  4DV6 C;  1FJG C;  2ZM6 C;  4JI0 C;  3I07 A;  1J5E C;  2BJO A;  1USP B;  2VQE C;  2HHH C;  4LF4 C;  2E7G A;  2E8F A;  2OPL A;  1K0R A;  1WF3 A;  4DV7 C;  3AF6 A;  1UKK A;  2D7V A;  2YCB A;  3R9X A;  2E5L C;  1L2F A;  2E8E A;  1N32 C;  4LF6 C;  3LUS A;  4K0K C;  2UU9 C;  2ONF A;  1USP A;  4X66 C;  4X64 C;  2PN2 A;  4DV5 C;  4DUY C;  2QL8 A;  1N36 C;  3GKU A;  4LFB C;  4DCS A;  4DV2 C;  1WH9 A;  4B3R C;  4DCT A;  2EGT A;  4B3S C;  4LFA C;  4JI8 C;  4LFC C;  1IBK C;  1XMQ C;  1PA4 A;  3EER A;  1HNX C;  4NXN C;  4DCV A;  3J81 D;  2JMP A;  1XMO C;  1XNR C;  4DR2 C; 
#chains in the Genus database with same CATH topology
 1JOS A;  1RY2 A;  1XRB A;  4BCA A;  2P2Q A;  3C5E A;  3TQI A;  4LF9 C;  3K6R A;  3ETO A;  2KDN A;  4JI7 C;  1HNW C;  3PRO C;  3A9U A;  5BSV A;  4DR3 C;  3T1Y C;  2BH1 X;  2CU6 A;  4AQY C;  1IBL C;  3CW9 A;  1HR0 C;  4OXI A;  4K0B A;  3VNQ A;  3H2T A;  2KZ0 A;  2PT7 G;  5IWA C;  3T1H C;  2D1S A;  4BBY A;  5BUR A;  4DR4 C;  3L8C A;  3NYQ A;  5BR8 C;  2VQF C;  2F4V C;  4DCU A;  1V26 A;  4BSZ A;  3R9W A;  3E7X A;  5BSW A;  2MCQ A;  3TDE A;  4NXM C;  2UUA C;  4B3T C;  5LMN C;  1P7L A;  4ISB A;  3IML A;  3GPC A;  4GKK C;  4RMN A;  4PRO C;  4I9G A;  1TH5 A;  2P02 A;  4TPS B;  4DR1 C;  4DR5 C;  3I08 A;  1O9T A;  4DV6 C;  1MD9 A;  2ZM6 C;  4JI0 C;  2P2J A;  2BJO A;  2QVY X;  3CQ1 A;  2ZZN A;  4LF4 C;  3NYR A;  2Y4N A;  3RV2 A;  1PG3 A;  2E8E A;  3KXW A;  4LF6 C;  4U5Y D;  2ONF A;  1QM4 A;  3A25 A;  1T5D X;  3TR3 A;  4FUQ A;  4NXN C;  1PA4 A;  2JMP A;  4DR2 C;  4KHP C;  1ZB8 A;  5FLX D;  2OO4 A;  4LF8 C;  2ATW A;  2WD9 A;  1XRC A;  3ETC A;  4KTT A;  1MKY A;  5BSR A;  1WCJ A;  3S82 A;  3FCC A;  4FUT A;  2JNV A;  4DR6 C;  1M6X C;  1RG9 A;  2YX1 A;  5A2Q D;  1XS3 A;  4X62 C;  4D4I A;  1MXA A;  2Y4O A;  5DV9 A;  5K8F A;  1LCI A;  2HJG A;  4G36 A;  3CQ3 A;  5A19 A;  2D1Q A;  2PG1 E;  4RLQ A;  2UXD C;  2Y27 A;  2VZE A;  2KZF A;  2UXC C;  1HH2 P;  3LNO A;  3O2E A;  3A9V A;  4NDN A;  1AMU A;  2D28 C;  5IT9 D;  4GXQ A;  3EQ6 A;  2DHM A;  1P4E A;  2UUC C;  4KTV A;  1ZB9 A;  1EGA A;  2QVZ X;  2ASB A;  1I94 C;  1YJ7 A;  4DV3 C;  4MH4 A;  4OX9 C;  1T5H X;  3SO4 A;  2P2B A;  5K85 A;  1J5E C;  2Z51 A;  1XRA A;  3GR1 A;  5A1G A;  4R1L A;  4FTF A;  1NY8 A;  4PUI A;  5BST A;  3DAY A;  2V7B A;  1K0R A;  1WF3 A;  3PBK A;  2YCB A;  4RLF A;  3R9X A;  2P2F A;  4BC9 A;  4R0M A;  2P2M A;  4PUG A;  1N32 C;  3LUS A;  4K0K C;  3A26 A;  4PZP A;  1N36 C;  5ADZ A;  3GKU A;  4DCS A;  1WH9 A;  5T8T A;  4LFA C;  4LFC C;  1VEH A;  1IBK C;  3EER A;  3J81 D;  5CZV A;  1O92 A;  1XNR C;  1N34 C;  2CY1 A;  3N54 B;  2CXC A;  4WV3 A;  3B7W A;  4DV0 C;  4R1M A;  1UWD A;  4PUH A;  3UX3 A;  3L95 X;  4ODJ A;  4JI3 C;  2PRO A;  3CQ2 A;  1IB8 A;  3LNV A;  2D1R A;  1MXC A;  2DPL A;  2VSQ A;  3FM7 A;  5BUS A;  4ZJZ A;  2UUB C;  1MDB A;  2DYJ A;  1ULT A;  4YHH C;  3NI2 A;  4XX2 A;  4DUZ C;  3J7A D;  5CZX A;  4DG9 A;  1FUG A;  3CJE A;  4DV1 C;  4LF7 C;  1VLA A;  4JI1 C;  4NOZ A;  2M5O A;  2MM9 A;  4DV4 C;  1V60 A;  4JV5 C;  5AE1 A;  1QWI A;  3DHV A;  2E8C A;  4WS9 A;  3PES A;  3LGX A;  4ZLP A;  4D56 A;  5IFI A;  1N33 C;  4X65 C;  4RM2 A;  2XR1 A;  4L4Q A;  4DR7 C;  1XDX A;  4I9F A;  1XHJ A;  2OPL B;  3A4I A;  5H9U A;  5AE2 A;  4RM3 A;  3I07 A;  4EAT A;  5JRH A;  5E7Q A;  2HHH C;  1P4E C;  4PHT A;  5BSM A;  3N2Q A;  4BC7 A;  2E8F A;  2OPL A;  4DV7 C;  3UOW A;  3AF6 A;  3VNS A;  1UKK A;  2P20 A;  4OYC A;  1L2F A;  3G7S A;  2YWC A;  4RVO A;  5KYV A;  4X64 C;  2PN2 A;  2WP0 C;  5KEI A;  4DV5 C;  2QL8 A;  4DV2 C;  4DCT A;  2EGT A;  1O93 A;  3VNR A;  1XMQ C;  5BSU A;  2OBV A;  4DCV A;  1XMO C;  1O90 A;  1LQL A;  2E0G A;  3DLP X;  4GKJ C;  2QW0 X;  3LAX A;  4L7I A;  3TUF A;  3J80 D;  1PG4 A;  3NPD A;  3JAM D;  2D1T A;  5T8S A;  2AYA A;  2D27 A;  4JI4 C;  4IR7 A;  1ML8 A;  1KKG A;  1V25 A;  3R44 A;  4JI6 C;  3E7W A;  4JI5 C;  4B3M C;  5A1I A;  4JM1 A;  4LF5 C;  4RVN A;  4D4G A;  2NCL A;  4JYA C;  4GXR A;  5LCI A;  4G37 A;  4JI2 C;  1NYE A;  1MDF A;  2ZTB A;  3UZ0 A;  3IEU A;  3IEV A;  2YWB A;  2UXB C;  1XNQ C;  4MTN A;  5GTD A;  3OTO C;  3GR0 A;  4YY3 C;  1IBM C;  3AF5 A;  4IZ6 A;  5LMU C;  2ZZM A;  1HNZ C;  1GPM A;  1N2F A;  1FJG C;  4D57 A;  1MXB A;  3FCE A;  1USP B;  2VQE C;  2E7G A;  3AY0 A;  3UX2 A;  4GS5 A;  2QVX X;  2M5H A;  1YGT A;  1BA3 A;  4HPV A;  3IPL A;  2D7V A;  3UEB A;  2E5L C;  1PU1 A;  2UU9 C;  3CW8 X;  1FLO A;  4LE5 A;  1USP A;  4X66 C;  4L2Z A;  5AE3 A;  5BUQ A;  1M6X A;  4DUY C;  4LFB C;  4B3R C;  4G1I A;  4B3S C;  4JI8 C;  4DG8 A;  1HNX C;  2MMA B;  5KYT A;  3RG2 A; 
#chains in the Genus database with same CATH homology
 1JOS A;  1RY2 A;  1XRB A;  4BCA A;  2P2Q A;  3C5E A;  3TQI A;  4LF9 C;  3ETO A;  4JI7 C;  1HNW C;  3PRO C;  3A9U A;  5BSV A;  4DR3 C;  3T1Y C;  2BH1 X;  4AQY C;  1IBL C;  3CW9 A;  1HR0 C;  4OXI A;  4K0B A;  3VNQ A;  3H2T A;  2PT7 G;  5IWA C;  3T1H C;  2D1S A;  4BBY A;  5BUR A;  4DR4 C;  3L8C A;  3NYQ A;  5BR8 C;  2VQF C;  2F4V C;  4DCU A;  1V26 A;  4BSZ A;  3R9W A;  3E7X A;  5BSW A;  3TDE A;  4NXM C;  2UUA C;  4B3T C;  5LMN C;  1P7L A;  4ISB A;  3IML A;  3GPC A;  4GKK C;  4RMN A;  4PRO C;  4I9G A;  2P02 A;  4TPS B;  4DR1 C;  4DR5 C;  3I08 A;  1O9T A;  4DV6 C;  1MD9 A;  2ZM6 C;  4JI0 C;  2P2J A;  2BJO A;  2QVY X;  4LF4 C;  3NYR A;  2Y4N A;  3RV2 A;  1PG3 A;  2E8E A;  3KXW A;  4LF6 C;  4U5Y D;  2ONF A;  1QM4 A;  1T5D X;  4FUQ A;  4NXN C;  1PA4 A;  2JMP A;  4DR2 C;  4KHP C;  1ZB8 A;  5FLX D;  2OO4 A;  4LF8 C;  2ATW A;  2WD9 A;  1XRC A;  3ETC A;  4KTT A;  1MKY A;  5BSR A;  3S82 A;  3FCC A;  4FUT A;  4DR6 C;  1RG9 A;  5A2Q D;  4X62 C;  4D4I A;  1MXA A;  2Y4O A;  5DV9 A;  5K8F A;  1LCI A;  2HJG A;  4G36 A;  5A19 A;  2D1Q A;  4RLQ A;  2UXD C;  2Y27 A;  2VZE A;  2KZF A;  2UXC C;  1HH2 P;  3A9V A;  4NDN A;  1AMU A;  2D28 C;  5IT9 D;  4GXQ A;  3EQ6 A;  2UUC C;  4KTV A;  1ZB9 A;  1EGA A;  2QVZ X;  2ASB A;  1I94 C;  1YJ7 A;  4DV3 C;  4MH4 A;  4OX9 C;  1T5H X;  3SO4 A;  2P2B A;  5K85 A;  1J5E C;  1XRA A;  3GR1 A;  5A1G A;  4R1L A;  4FTF A;  5BST A;  3DAY A;  2V7B A;  1K0R A;  1WF3 A;  3PBK A;  2YCB A;  4RLF A;  3R9X A;  2P2F A;  4BC9 A;  4R0M A;  2P2M A;  1N32 C;  3LUS A;  4K0K C;  4PZP A;  1N36 C;  5ADZ A;  3GKU A;  4DCS A;  1WH9 A;  5T8T A;  4LFA C;  4LFC C;  1IBK C;  3EER A;  3J81 D;  5CZV A;  1O92 A;  1XNR C;  1N34 C;  2CY1 A;  3N54 B;  2CXC A;  4WV3 A;  3B7W A;  4DV0 C;  4R1M A;  3L95 X;  4ODJ A;  4JI3 C;  2PRO A;  3LNV A;  2D1R A;  1MXC A;  2DPL A;  2VSQ A;  5BUS A;  4ZJZ A;  2UUB C;  1MDB A;  2DYJ A;  1ULT A;  4YHH C;  3NI2 A;  4XX2 A;  4DUZ C;  3J7A D;  5CZX A;  4DG9 A;  1FUG A;  3CJE A;  4DV1 C;  4LF7 C;  1VLA A;  4JI1 C;  4NOZ A;  4DV4 C;  4JV5 C;  5AE1 A;  1QWI A;  3DHV A;  2E8C A;  4WS9 A;  3PES A;  3LGX A;  4ZLP A;  4D56 A;  5IFI A;  1N33 C;  4X65 C;  4RM2 A;  2XR1 A;  4L4Q A;  4DR7 C;  4I9F A;  2OPL B;  3A4I A;  5H9U A;  5AE2 A;  4RM3 A;  3I07 A;  4EAT A;  5JRH A;  5E7Q A;  2HHH C;  4PHT A;  5BSM A;  3N2Q A;  4BC7 A;  2E8F A;  2OPL A;  4DV7 C;  3UOW A;  3AF6 A;  3VNS A;  1UKK A;  2P20 A;  4OYC A;  1L2F A;  3G7S A;  2YWC A;  4RVO A;  5KYV A;  4X64 C;  2PN2 A;  2WP0 C;  5KEI A;  4DV5 C;  2QL8 A;  4DV2 C;  4DCT A;  2EGT A;  1O93 A;  3VNR A;  1XMQ C;  5BSU A;  2OBV A;  4DCV A;  1XMO C;  1O90 A;  1LQL A;  2E0G A;  3DLP X;  4GKJ C;  2QW0 X;  3LAX A;  4L7I A;  3TUF A;  3J80 D;  1PG4 A;  3NPD A;  3JAM D;  2D1T A;  5T8S A;  2AYA A;  2D27 A;  4JI4 C;  4IR7 A;  1ML8 A;  1KKG A;  1V25 A;  3R44 A;  4JI6 C;  3E7W A;  4JI5 C;  4B3M C;  5A1I A;  4JM1 A;  4LF5 C;  4RVN A;  4D4G A;  4JYA C;  4GXR A;  4G37 A;  4JI2 C;  1NYE A;  1MDF A;  3UZ0 A;  3IEU A;  3IEV A;  2YWB A;  2UXB C;  1XNQ C;  4MTN A;  5GTD A;  3OTO C;  3GR0 A;  4YY3 C;  1IBM C;  3AF5 A;  4IZ6 A;  5LMU C;  1HNZ C;  1GPM A;  1N2F A;  1FJG C;  4D57 A;  1MXB A;  3FCE A;  1USP B;  2VQE C;  2E7G A;  4GS5 A;  2QVX X;  1BA3 A;  4HPV A;  3IPL A;  2D7V A;  2E5L C;  2UU9 C;  3CW8 X;  4LE5 A;  1USP A;  4X66 C;  4L2Z A;  5AE3 A;  5BUQ A;  4DUY C;  4LFB C;  4B3R C;  4G1I A;  4B3S C;  4JI8 C;  4DG8 A;  1HNX C;  5KYT A;  3RG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...