1J5EC

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 45
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1j5eC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1j5eC02
3J80D 4LF7C 2ATWA 4DR7C 1N2FA 4DUYC 1IBMC 2UXBC 4XX2A 1N34C 4DR6C 3IEUA 2UUAC 2QL8A 4NXMC 5LMNC 1XNQC 4DR2C 4LF5C 3R9WA 4LF4C 3GKUA 1ML8A 1KKGA 4BSZA 4X66C 5FLXD 2YCBA 2VQFC 1ZB9A 4DV6C 1HNZC 2E8EA 1PA4A 1N36C 4LF9C 3IEVA 2UXDC 2OPLA 4LFBC 4JI3C 4JV5C 2CXCA 4DR3C 2PT7G 4DV1C 3CJEA 1WF3A 2PN2A 4MTNA 4DV7C 1NYEA 4OX9C 1N32C 2UU9C 2E5LC 2HJGA 1JOSA 2CY1A 2UUCC 4KHPC 4MH4A 4DV2C 4JI1C 2ONFA 4JI5C 3EERA 4DR1C 4B3RC 2OPLB 3AF6A 1USPB 3R9XA 4NXNC 1QWIA 2E8FA 1HNWC 1I94C 1WH9A 4LFAC 4JI7C 1LQLA 4B3TC 4YHHC 1N33C 2UXCC 1HH2P 1EGAA 2EGTA 3OTOC 2BJOA 4LF6C 4GKJC 1IBLC 4DUZC 4B3SC 1IBKC 1USPA 1MKYA 4NOZA 2E7GA 3I07A 1HR0C 4X65C 1XNRC 4GKKC 1ZB8A 2DYJA 2VQEC 4DCUA 1XMQC 1XMOC 2HHHC 4K0KC 5IWAC 4DCTA 4X62C 1J5EC 4DCVA 3J7AD 2D7VA 2KZFA 5A2QD 2UUBC 4B3MC 3LUSA 3AF5A 4DCSA 1K0RA 4JI0C 3JAMD 2ZM6C 4DR5C 1FJGC 1VLAA 4DV0C 2JMPA 4DV4C 1L2FA 4JI6C 1UKKA 4YY3C 3J81D 4DV3C 3T1HC 4JI2C 4LF8C 5BR8C 2ASBA 5LMUC 4JI4C 2E8CA 4X64C 3T1YC 4DV5C 4DR4C 4JYAC 2F4VC 4AQYC 5IT9D 2XR1A 1HNXC 4JI8C 4LFCC
chains in the Genus database with same CATH superfamily
3B7WA 3KXWA 4DUYC 2UXBC 2P20A 4GXRA 4NXMC 4LF5C 4LF4C 5K85A 4OXIA 1KKGA 2PG1E 4BSZA 5CZVA 3LAXA 2YCBA 3NPDA 4IR7A 2E8EA 1PA4A 1N36C 4LF9C 3K6RA 4LFBC 2JNVA 4JI3C 4JV5C 4DG9A 4DV1C 1WF3A 2PN2A 4IZ6A 3NI2A 1VEHA 5T8SA 4DV7C 2D1QA 1MXBA 5KEIA 1NY8A 4LE5A 3VNQA 2MCQA 1N33C 2UXCC 1RG9A 1V25A 2E7GA 1XNRC 2D1TA 3CQ1A 2MM9A 1O92A 5A1GA 3E7WA 4X62C 2AYAA 5A2QD 1IB8A 3LUSA 3AF5A 4DCSA 4PROC 1FJGC 4ISBA 5BURA 1M6XC 3FCCA 3A9VA 3LNVA 5KYTA 2ASBA 5KYVA 2MMAB 4DR4C 4L2ZA 4DV5C 3VNSA 1MDFA 4JI8C 4LFCC 5JRHA 4DR7C 5H9UA 1UWDA 3L95X 4WS9A 4XX2A 4DR6C 1O93A 2QL8A 5LMNC 1MD9A 4DR2C 3CW8X 1O9TA 3TR3A 4D4IA 1ZB9A 2QVXX 3PROC 3A9UA 4BBYA 2P02A 2UXDC 1GPMA 3G7SA 4FTFA 4DR3C 2D1RA 2P2BA 4RVNA 1M6XA 4RLFA 4RVOA 2Z51A 4ZLPA 3VNRA 2QW0X 4JI5C 3C5EA 4B3RC 3H2TA 4OYCA 2BH1X 3AF6A 5BSRA 3UX2A 1LCIA 3N2QA 4PUIA 4R1LA 1V60A 4JI7C 1AMUA 3TDEA 3SO4A 4I9FA 1XRCA 3A4IA 2EGTA 5BUSA 2E0GA 5BUQA 3A25A 4LF6C 4GKJC 4B3SC 1IBKC 5E7QA 4KTVA 1PU1A 4NOZA 4ODJA 4L4QA 3E7XA 2ZZNA 1YJ7A 4DCUA 4RLQA 1QM4A 2DPLA 4K0KC 3UEBA 4DCTA 1J5EC 4DCVA 1FUGA 2KZFA 5GTDA 4D4GA 1PG4A 5CZXA 1K0RA 4DV0C 1P4EC 2JMPA 1WCJA 1XDXA 4JYAC 4JI4C 4X64C 2YWCA 3ETOA 4AQYC 2YX1A 2XR1A 4K0BA 3R44A 4RM2A 4L7IA 3IPLA 1XRBA 1PG3A 4U5YD 1MXCA 4WV3A 3IEUA 2UUAC 4TPSB 3A26A 3GKUA 5K8FA 1ML8A 2OBVA 4RMNA 4X66C 5FLXD 2P2JA 5BSVA 2VQFC 4DV6C 5AE2A 4BCAA 2CXCA 3GR1A 4PUHA 4MTNA 4RM3A 2P2MA 4OX9C 2UU9C 2E5LC 2HJGA 2UUCC 2CY1A 4GXQA 2D28C 4JI1C 1T5DX 4GS5A 2OPLB 1USPB 3DHVA 3R9XA 1XRAA 4NXNC 4HPVA 3EQ6A 1YGTA 1HNWC 4LFAC 1T5HX 1LQLA 4B3TC 4YHHC 3LGXA 2QVYX 1MDBA 2P2QA 2KZ0A 2M5OA 3CQ3A 3OTOC 2BJOA 2Y4NA 3CW9A 2YWBA 5LCIA 1USPA 1HR0C 2QVZX 3I07A 1V26A 3S82A 5A19A 4GKKC 5BSTA 1ZB8A 3O2EA 4FUTA 1XMOC 3GPCA 2HHHC 3TQIA 3GR0A 5BSUA 2V7BA 5IWAC 3FM7A 2D7VA 4B3MC 3PESA 4G36A 3JAMD 4JI0C 2ZM6C 2WP0C 1VLAA 4DV4C 1L2FA 4JI6C 4PUGA 1UKKA 4YY3C 3J81D 4LF8C 3N54B 2OO4A 1ULTA 5DV9A 3NYQA 3I08A 2M5HA 5A1IA 5IT9D 1HNXC 3J80D 4LF7C 2ATWA 4NDNA 1N2FA 1IBMC 3DLPX 3LNOA 1TH5A 5ADZA 1N34C 2VZEA 2Y4OA 4R1MA 1XNQC 1O90A 3UZ0A 3R9WA 5AE3A 1HNZC 1FLOA 4ZJZA 2D1SA 3IEVA 2OPLA 3UOWA 2PROA 3PBKA 2PT7G 1P7LA 3CJEA 3RV2A 4G1IA 2D27A 1NYEA 3L8CA 1N32C 3RG2A 1JOSA 4KHPC 4MH4A 4DV2C 2NCLA 3DAYA 2ONFA 4PHTA 3EERA 4DR1C 4JM1A 3AY0A 3IMLA 5BSMA 2WD9A 1QWIA 2DHMA 3NYRA 2ZTBA 2E8FA 1I94C 1WH9A 1XS3A 1HH2P 1EGAA 1RY2A 4D56A 3TUFA 2KDNA 4D57A 4G37A 1XHJA 5T8TA 1IBLC 4DUZC 4I9GA 1MKYA 4X65C 3ETCA 5IFIA 2CU6A 2DYJA 2VQEC 4PZPA 3UX3A 2VSQA 4BC9A 4DG8A 1XMQC 1BA3A 1MXAA 3J7AD 2UUBC 4BC7A 4DR5C 4R0MA 2ZZMA 3CQ2A 3FCEA 4DV3C 3T1HC 4JI2C 5BR8C 4EATA 2Y27A 4KTTA 5BSWA 5AE1A 5LMUC 2E8CA 3T1YC 1P4EA 2F4VC 2P2FA 4FUQA
chains in the Genus database with same CATH topology
3B7WA 3KXWA 4DUYC 2UXBC 2P20A 4GXRA 4NXMC 4LF5C 4LF4C 5K85A 4OXIA 1KKGA 4BSZA 5CZVA 3LAXA 2YCBA 3NPDA 4IR7A 2E8EA 1PA4A 1N36C 4LF9C 4LFBC 4JI3C 4JV5C 4DG9A 4DV1C 1WF3A 2PN2A 4IZ6A 3NI2A 5T8SA 4DV7C 2D1QA 1MXBA 5KEIA 4LE5A 3VNQA 1N33C 2UXCC 1RG9A 1V25A 2E7GA 1XNRC 2D1TA 1O92A 5A1GA 3E7WA 4X62C 2AYAA 5A2QD 3LUSA 3AF5A 4DCSA 4PROC 1FJGC 4ISBA 5BURA 3FCCA 3A9VA 3LNVA 5KYTA 2ASBA 5KYVA 4DR4C 4L2ZA 4DV5C 3VNSA 1MDFA 4JI8C 4LFCC 5JRHA 4DR7C 5H9UA 3L95X 4WS9A 4XX2A 4DR6C 1O93A 2QL8A 5LMNC 1MD9A 4DR2C 3CW8X 1O9TA 4D4IA 1ZB9A 2QVXX 3PROC 3A9UA 4BBYA 2P02A 2UXDC 1GPMA 3G7SA 4FTFA 4DR3C 2D1RA 2P2BA 4RVNA 4RLFA 4RVOA 4ZLPA 3VNRA 2QW0X 4JI5C 3C5EA 4B3RC 3H2TA 4OYCA 2BH1X 3AF6A 5BSRA 1LCIA 3N2QA 4R1LA 4JI7C 1AMUA 3TDEA 3SO4A 4I9FA 1XRCA 3A4IA 2EGTA 5BUSA 2E0GA 5BUQA 4LF6C 4GKJC 4B3SC 1IBKC 5E7QA 4KTVA 4NOZA 4ODJA 4L4QA 3E7XA 1YJ7A 4DCUA 4RLQA 1QM4A 2DPLA 4K0KC 4DCTA 1J5EC 4DCVA 1FUGA 2KZFA 5GTDA 4D4GA 1PG4A 5CZXA 1K0RA 4DV0C 2JMPA 4JYAC 4JI4C 4X64C 2YWCA 3ETOA 4AQYC 2XR1A 4K0BA 3R44A 4RM2A 4L7IA 3IPLA 1XRBA 1PG3A 4U5YD 1MXCA 4WV3A 3IEUA 2UUAC 4TPSB 3GKUA 5K8FA 1ML8A 2OBVA 4RMNA 4X66C 5FLXD 2P2JA 5BSVA 2VQFC 4DV6C 5AE2A 4BCAA 2CXCA 3GR1A 4MTNA 4RM3A 2P2MA 4OX9C 2UU9C 2E5LC 2HJGA 2UUCC 2CY1A 4GXQA 2D28C 4JI1C 1T5DX 4GS5A 2OPLB 1USPB 3DHVA 3R9XA 1XRAA 4NXNC 4HPVA 3EQ6A 1HNWC 4LFAC 1T5HX 1LQLA 4B3TC 4YHHC 3LGXA 2QVYX 1MDBA 2P2QA 3OTOC 2BJOA 2Y4NA 3CW9A 2YWBA 1USPA 1HR0C 2QVZX 3I07A 1V26A 3S82A 5A19A 4GKKC 5BSTA 1ZB8A 4FUTA 1XMOC 3GPCA 2HHHC 3TQIA 3GR0A 5BSUA 2V7BA 5IWAC 2D7VA 4B3MC 3PESA 4G36A 3JAMD 4JI0C 2ZM6C 2WP0C 1VLAA 4DV4C 1L2FA 4JI6C 1UKKA 4YY3C 3J81D 4LF8C 3N54B 2OO4A 1ULTA 5DV9A 3NYQA 3I08A 5A1IA 5IT9D 1HNXC 3J80D 4LF7C 2ATWA 4NDNA 1N2FA 1IBMC 3DLPX 5ADZA 1N34C 2VZEA 2Y4OA 4R1MA 1XNQC 1O90A 3UZ0A 3R9WA 5AE3A 1HNZC 4ZJZA 2D1SA 3IEVA 2OPLA 3UOWA 2PROA 3PBKA 2PT7G 1P7LA 3CJEA 3RV2A 4G1IA 2D27A 1NYEA 3L8CA 1N32C 3RG2A 1JOSA 4KHPC 4MH4A 4DV2C 3DAYA 2ONFA 4PHTA 3EERA 4DR1C 4JM1A 3IMLA 5BSMA 2WD9A 1QWIA 3NYRA 2E8FA 1I94C 1WH9A 1HH2P 1EGAA 1RY2A 4D56A 3TUFA 4D57A 4G37A 5T8TA 1IBLC 4DUZC 4I9GA 1MKYA 4X65C 3ETCA 5IFIA 2DYJA 2VQEC 4PZPA 2VSQA 4BC9A 4DG8A 1XMQC 1BA3A 1MXAA 3J7AD 2UUBC 4BC7A 4DR5C 4R0MA 3FCEA 4DV3C 3T1HC 4JI2C 5BR8C 4EATA 2Y27A 4KTTA 5BSWA 5AE1A 5LMUC 2E8CA 3T1YC 2F4VC 2P2FA 4FUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 D;  4LF7 C;  2ATW A;  4DR7 C;  1N2F A;  4DUY C;  1IBM C;  2UXB C;  4XX2 A;  1N34 C;  4DR6 C;  3IEU A;  2UUA C;  2QL8 A;  4NXM C;  5LMN C;  1XNQ C;  4DR2 C;  4LF5 C;  3R9W A;  4LF4 C;  3GKU A;  1ML8 A;  1KKG A;  4BSZ A;  4X66 C;  5FLX D;  2YCB A;  2VQF C;  1ZB9 A;  4DV6 C;  1HNZ C;  2E8E A;  1PA4 A;  1N36 C;  4LF9 C;  3IEV A;  2UXD C;  2OPL A;  4LFB C;  4JI3 C;  4JV5 C;  2CXC A;  4DR3 C;  2PT7 G;  4DV1 C;  3CJE A;  1WF3 A;  2PN2 A;  4MTN A;  4DV7 C;  1NYE A;  4OX9 C;  1N32 C;  2UU9 C;  2E5L C;  2HJG A;  1JOS A;  2CY1 A;  2UUC C;  4KHP C;  4MH4 A;  4DV2 C;  4JI1 C;  2ONF A;  4JI5 C;  3EER A;  4DR1 C;  4B3R C;  2OPL B;  3AF6 A;  1USP B;  3R9X A;  4NXN C;  1QWI A;  2E8F A;  1HNW C;  1I94 C;  1WH9 A;  4LFA C;  4JI7 C;  1LQL A;  4B3T C;  4YHH C;  1N33 C;  2UXC C;  1HH2 P;  1EGA A;  2EGT A;  3OTO C;  2BJO A;  4LF6 C;  4GKJ C;  1IBL C;  4DUZ C;  4B3S C;  1IBK C;  1USP A;  1MKY A;  4NOZ A;  2E7G A;  3I07 A;  1HR0 C;  4X65 C;  1XNR C;  4GKK C;  1ZB8 A;  2DYJ A;  2VQE C;  4DCU A;  1XMQ C;  1XMO C;  2HHH C;  4K0K C;  5IWA C;  4DCT A;  4X62 C;  1J5E C;  4DCV A;  3J7A D;  2D7V A;  2KZF A;  5A2Q D;  2UUB C;  4B3M C;  3LUS A;  3AF5 A;  4DCS A;  1K0R A;  4JI0 C;  3JAM D;  2ZM6 C;  4DR5 C;  1FJG C;  1VLA A;  4DV0 C;  2JMP A;  4DV4 C;  1L2F A;  4JI6 C;  1UKK A;  4YY3 C;  3J81 D;  4DV3 C;  3T1H C;  4JI2 C;  4LF8 C;  5BR8 C;  2ASB A;  5LMU C;  4JI4 C;  2E8C A;  4X64 C;  3T1Y C;  4DV5 C;  4DR4 C;  4JYA C;  2F4V C;  4AQY C;  5IT9 D;  2XR1 A;  1HNX C;  4JI8 C;  4LFC C; 
#chains in the Genus database with same CATH topology
 3B7W A;  3KXW A;  4DUY C;  2UXB C;  2P20 A;  4GXR A;  4NXM C;  4LF5 C;  4LF4 C;  5K85 A;  4OXI A;  1KKG A;  2PG1 E;  4BSZ A;  5CZV A;  3LAX A;  2YCB A;  3NPD A;  4IR7 A;  2E8E A;  1PA4 A;  1N36 C;  4LF9 C;  3K6R A;  4LFB C;  2JNV A;  4JI3 C;  4JV5 C;  4DG9 A;  4DV1 C;  1WF3 A;  2PN2 A;  4IZ6 A;  3NI2 A;  1VEH A;  5T8S A;  4DV7 C;  2D1Q A;  1MXB A;  5KEI A;  1NY8 A;  4LE5 A;  3VNQ A;  2MCQ A;  1N33 C;  2UXC C;  1RG9 A;  1V25 A;  2E7G A;  1XNR C;  2D1T A;  3CQ1 A;  2MM9 A;  1O92 A;  5A1G A;  3E7W A;  4X62 C;  2AYA A;  5A2Q D;  1IB8 A;  3LUS A;  3AF5 A;  4DCS A;  4PRO C;  1FJG C;  4ISB A;  5BUR A;  1M6X C;  3FCC A;  3A9V A;  3LNV A;  5KYT A;  2ASB A;  5KYV A;  2MMA B;  4DR4 C;  4L2Z A;  4DV5 C;  3VNS A;  1MDF A;  4JI8 C;  4LFC C;  5JRH A;  4DR7 C;  5H9U A;  1UWD A;  3L95 X;  4WS9 A;  4XX2 A;  4DR6 C;  1O93 A;  2QL8 A;  5LMN C;  1MD9 A;  4DR2 C;  3CW8 X;  1O9T A;  3TR3 A;  4D4I A;  1ZB9 A;  2QVX X;  3PRO C;  3A9U A;  4BBY A;  2P02 A;  2UXD C;  1GPM A;  3G7S A;  4FTF A;  4DR3 C;  2D1R A;  2P2B A;  4RVN A;  1M6X A;  4RLF A;  4RVO A;  2Z51 A;  4ZLP A;  3VNR A;  2QW0 X;  4JI5 C;  3C5E A;  4B3R C;  3H2T A;  4OYC A;  2BH1 X;  3AF6 A;  5BSR A;  3UX2 A;  1LCI A;  3N2Q A;  4PUI A;  4R1L A;  1V60 A;  4JI7 C;  1AMU A;  3TDE A;  3SO4 A;  4I9F A;  1XRC A;  3A4I A;  2EGT A;  5BUS A;  2E0G A;  5BUQ A;  3A25 A;  4LF6 C;  4GKJ C;  4B3S C;  1IBK C;  5E7Q A;  4KTV A;  1PU1 A;  4NOZ A;  4ODJ A;  4L4Q A;  3E7X A;  2ZZN A;  1YJ7 A;  4DCU A;  4RLQ A;  1QM4 A;  2DPL A;  4K0K C;  3UEB A;  4DCT A;  1J5E C;  4DCV A;  1FUG A;  2KZF A;  5GTD A;  4D4G A;  1PG4 A;  5CZX A;  1K0R A;  4DV0 C;  1P4E C;  2JMP A;  1WCJ A;  1XDX A;  4JYA C;  4JI4 C;  4X64 C;  2YWC A;  3ETO A;  4AQY C;  2YX1 A;  2XR1 A;  4K0B A;  3R44 A;  4RM2 A;  4L7I A;  3IPL A;  1XRB A;  1PG3 A;  4U5Y D;  1MXC A;  4WV3 A;  3IEU A;  2UUA C;  4TPS B;  3A26 A;  3GKU A;  5K8F A;  1ML8 A;  2OBV A;  4RMN A;  4X66 C;  5FLX D;  2P2J A;  5BSV A;  2VQF C;  4DV6 C;  5AE2 A;  4BCA A;  2CXC A;  3GR1 A;  4PUH A;  4MTN A;  4RM3 A;  2P2M A;  4OX9 C;  2UU9 C;  2E5L C;  2HJG A;  2UUC C;  2CY1 A;  4GXQ A;  2D28 C;  4JI1 C;  1T5D X;  4GS5 A;  2OPL B;  1USP B;  3DHV A;  3R9X A;  1XRA A;  4NXN C;  4HPV A;  3EQ6 A;  1YGT A;  1HNW C;  4LFA C;  1T5H X;  1LQL A;  4B3T C;  4YHH C;  3LGX A;  2QVY X;  1MDB A;  2P2Q A;  2KZ0 A;  2M5O A;  3CQ3 A;  3OTO C;  2BJO A;  2Y4N A;  3CW9 A;  2YWB A;  5LCI A;  1USP A;  1HR0 C;  2QVZ X;  3I07 A;  1V26 A;  3S82 A;  5A19 A;  4GKK C;  5BST A;  1ZB8 A;  3O2E A;  4FUT A;  1XMO C;  3GPC A;  2HHH C;  3TQI A;  3GR0 A;  5BSU A;  2V7B A;  5IWA C;  3FM7 A;  2D7V A;  4B3M C;  3PES A;  4G36 A;  3JAM D;  4JI0 C;  2ZM6 C;  2WP0 C;  1VLA A;  4DV4 C;  1L2F A;  4JI6 C;  4PUG A;  1UKK A;  4YY3 C;  3J81 D;  4LF8 C;  3N54 B;  2OO4 A;  1ULT A;  5DV9 A;  3NYQ A;  3I08 A;  2M5H A;  5A1I A;  5IT9 D;  1HNX C;  3J80 D;  4LF7 C;  2ATW A;  4NDN A;  1N2F A;  1IBM C;  3DLP X;  3LNO A;  1TH5 A;  5ADZ A;  1N34 C;  2VZE A;  2Y4O A;  4R1M A;  1XNQ C;  1O90 A;  3UZ0 A;  3R9W A;  5AE3 A;  1HNZ C;  1FLO A;  4ZJZ A;  2D1S A;  3IEV A;  2OPL A;  3UOW A;  2PRO A;  3PBK A;  2PT7 G;  1P7L A;  3CJE A;  3RV2 A;  4G1I A;  2D27 A;  1NYE A;  3L8C A;  1N32 C;  3RG2 A;  1JOS A;  4KHP C;  4MH4 A;  4DV2 C;  2NCL A;  3DAY A;  2ONF A;  4PHT A;  3EER A;  4DR1 C;  4JM1 A;  3AY0 A;  3IML A;  5BSM A;  2WD9 A;  1QWI A;  2DHM A;  3NYR A;  2ZTB A;  2E8F A;  1I94 C;  1WH9 A;  1XS3 A;  1HH2 P;  1EGA A;  1RY2 A;  4D56 A;  3TUF A;  2KDN A;  4D57 A;  4G37 A;  1XHJ A;  5T8T A;  1IBL C;  4DUZ C;  4I9G A;  1MKY A;  4X65 C;  3ETC A;  5IFI A;  2CU6 A;  2DYJ A;  2VQE C;  4PZP A;  3UX3 A;  2VSQ A;  4BC9 A;  4DG8 A;  1XMQ C;  1BA3 A;  1MXA A;  3J7A D;  2UUB C;  4BC7 A;  4DR5 C;  4R0M A;  2ZZM A;  3CQ2 A;  3FCE A;  4DV3 C;  3T1H C;  4JI2 C;  5BR8 C;  4EAT A;  2Y27 A;  4KTT A;  5BSW A;  5AE1 A;  5LMU C;  2E8C A;  3T1Y C;  1P4E A;  2F4V C;  2P2F A;  4FUQ A; 
#chains in the Genus database with same CATH homology
 3B7W A;  3KXW A;  4DUY C;  2UXB C;  2P20 A;  4GXR A;  4NXM C;  4LF5 C;  4LF4 C;  5K85 A;  4OXI A;  1KKG A;  4BSZ A;  5CZV A;  3LAX A;  2YCB A;  3NPD A;  4IR7 A;  2E8E A;  1PA4 A;  1N36 C;  4LF9 C;  4LFB C;  4JI3 C;  4JV5 C;  4DG9 A;  4DV1 C;  1WF3 A;  2PN2 A;  4IZ6 A;  3NI2 A;  5T8S A;  4DV7 C;  2D1Q A;  1MXB A;  5KEI A;  4LE5 A;  3VNQ A;  1N33 C;  2UXC C;  1RG9 A;  1V25 A;  2E7G A;  1XNR C;  2D1T A;  1O92 A;  5A1G A;  3E7W A;  4X62 C;  2AYA A;  5A2Q D;  3LUS A;  3AF5 A;  4DCS A;  4PRO C;  1FJG C;  4ISB A;  5BUR A;  3FCC A;  3A9V A;  3LNV A;  5KYT A;  2ASB A;  5KYV A;  4DR4 C;  4L2Z A;  4DV5 C;  3VNS A;  1MDF A;  4JI8 C;  4LFC C;  5JRH A;  4DR7 C;  5H9U A;  3L95 X;  4WS9 A;  4XX2 A;  4DR6 C;  1O93 A;  2QL8 A;  5LMN C;  1MD9 A;  4DR2 C;  3CW8 X;  1O9T A;  4D4I A;  1ZB9 A;  2QVX X;  3PRO C;  3A9U A;  4BBY A;  2P02 A;  2UXD C;  1GPM A;  3G7S A;  4FTF A;  4DR3 C;  2D1R A;  2P2B A;  4RVN A;  4RLF A;  4RVO A;  4ZLP A;  3VNR A;  2QW0 X;  4JI5 C;  3C5E A;  4B3R C;  3H2T A;  4OYC A;  2BH1 X;  3AF6 A;  5BSR A;  1LCI A;  3N2Q A;  4R1L A;  4JI7 C;  1AMU A;  3TDE A;  3SO4 A;  4I9F A;  1XRC A;  3A4I A;  2EGT A;  5BUS A;  2E0G A;  5BUQ A;  4LF6 C;  4GKJ C;  4B3S C;  1IBK C;  5E7Q A;  4KTV A;  4NOZ A;  4ODJ A;  4L4Q A;  3E7X A;  1YJ7 A;  4DCU A;  4RLQ A;  1QM4 A;  2DPL A;  4K0K C;  4DCT A;  1J5E C;  4DCV A;  1FUG A;  2KZF A;  5GTD A;  4D4G A;  1PG4 A;  5CZX A;  1K0R A;  4DV0 C;  2JMP A;  4JYA C;  4JI4 C;  4X64 C;  2YWC A;  3ETO A;  4AQY C;  2XR1 A;  4K0B A;  3R44 A;  4RM2 A;  4L7I A;  3IPL A;  1XRB A;  1PG3 A;  4U5Y D;  1MXC A;  4WV3 A;  3IEU A;  2UUA C;  4TPS B;  3GKU A;  5K8F A;  1ML8 A;  2OBV A;  4RMN A;  4X66 C;  5FLX D;  2P2J A;  5BSV A;  2VQF C;  4DV6 C;  5AE2 A;  4BCA A;  2CXC A;  3GR1 A;  4MTN A;  4RM3 A;  2P2M A;  4OX9 C;  2UU9 C;  2E5L C;  2HJG A;  2UUC C;  2CY1 A;  4GXQ A;  2D28 C;  4JI1 C;  1T5D X;  4GS5 A;  2OPL B;  1USP B;  3DHV A;  3R9X A;  1XRA A;  4NXN C;  4HPV A;  3EQ6 A;  1HNW C;  4LFA C;  1T5H X;  1LQL A;  4B3T C;  4YHH C;  3LGX A;  2QVY X;  1MDB A;  2P2Q A;  3OTO C;  2BJO A;  2Y4N A;  3CW9 A;  2YWB A;  1USP A;  1HR0 C;  2QVZ X;  3I07 A;  1V26 A;  3S82 A;  5A19 A;  4GKK C;  5BST A;  1ZB8 A;  4FUT A;  1XMO C;  3GPC A;  2HHH C;  3TQI A;  3GR0 A;  5BSU A;  2V7B A;  5IWA C;  2D7V A;  4B3M C;  3PES A;  4G36 A;  3JAM D;  4JI0 C;  2ZM6 C;  2WP0 C;  1VLA A;  4DV4 C;  1L2F A;  4JI6 C;  1UKK A;  4YY3 C;  3J81 D;  4LF8 C;  3N54 B;  2OO4 A;  1ULT A;  5DV9 A;  3NYQ A;  3I08 A;  5A1I A;  5IT9 D;  1HNX C;  3J80 D;  4LF7 C;  2ATW A;  4NDN A;  1N2F A;  1IBM C;  3DLP X;  5ADZ A;  1N34 C;  2VZE A;  2Y4O A;  4R1M A;  1XNQ C;  1O90 A;  3UZ0 A;  3R9W A;  5AE3 A;  1HNZ C;  4ZJZ A;  2D1S A;  3IEV A;  2OPL A;  3UOW A;  2PRO A;  3PBK A;  2PT7 G;  1P7L A;  3CJE A;  3RV2 A;  4G1I A;  2D27 A;  1NYE A;  3L8C A;  1N32 C;  3RG2 A;  1JOS A;  4KHP C;  4MH4 A;  4DV2 C;  3DAY A;  2ONF A;  4PHT A;  3EER A;  4DR1 C;  4JM1 A;  3IML A;  5BSM A;  2WD9 A;  1QWI A;  3NYR A;  2E8F A;  1I94 C;  1WH9 A;  1HH2 P;  1EGA A;  1RY2 A;  4D56 A;  3TUF A;  4D57 A;  4G37 A;  5T8T A;  1IBL C;  4DUZ C;  4I9G A;  1MKY A;  4X65 C;  3ETC A;  5IFI A;  2DYJ A;  2VQE C;  4PZP A;  2VSQ A;  4BC9 A;  4DG8 A;  1XMQ C;  1BA3 A;  1MXA A;  3J7A D;  2UUB C;  4BC7 A;  4DR5 C;  4R0M A;  3FCE A;  4DV3 C;  3T1H C;  4JI2 C;  5BR8 C;  4EAT A;  2Y27 A;  4KTT A;  5BSW A;  5AE1 A;  5LMU C;  2E8C A;  3T1Y C;  2F4V C;  2P2F A;  4FUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...