1J5EC

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1j5eC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1j5eC02
3T1YC 2ONFA 3I07A 4DR4C 1N33C 4AQYC 1LQLA 5FLXD 4JI3C 4DR1C 3J7AD 1HNWC 3GKUA 4B3TC 4LFAC 1HH2P 2E8FA 4DV7C 2F4VC 4DV2C 2PN2A 4LF4C 5LMUC 4DUYC 1HNXC 4XX2A 4LF9C 4LF8C 3AF6A 2HJGA 1WF3A 2E8EA 2D7VA 2DYJA 4JI0C 1I94C 4GKKC 1IBMC 4JI6C 1XMOC 3JAMD 2ZM6C 3OTOC 1ML8A 1XNQC 4B3MC 2XR1A 3R9WA 1IBLC 2QL8A 4DV5C 2VQFC 4DCVA 1N32C 1N34C 1N36C 4X65C 5A2QD 4JI8C 2UXBC 4YHHC 5LMNC 1FJGC 3CJEA 4GKJC 4DCUA 2OPLB 1USPA 1EGAA 4DUZC 4DV3C 4JI7C 1N2FA 1JOSA 4DV4C 4JI5C 4JI1C 2VQEC 3IEVA 2CXCA 4LF5C 2JMPA 4K0KC 4DR3C 4LFBC 4X62C 1VLAA 2UU9C 2UUAC 1J5EC 2E7GA 2KZFA 2UUBC 4X64C 4DV0C 1XNRC 4KHPC 4DV1C 3AF5A 1NYEA 3R9XA 2YCBA 3LUSA 2OPLA 4DR2C 2EGTA 1KKGA 4YY3C 1HR0C 2E8CA 2ATWA 3J81D 2UXDC 4JI2C 3IEUA 1QWIA 3J80D 1K0RA 1ZB8A 2HHHC 4DV6C 4DR6C 4B3SC 1PA4A 4DCTA 2E5LC 2UUCC 4JI4C 4B3RC 4MTNA 1HNZC 4LF6C 2CY1A 4LFCC 3T1HC 4NXMC 4OX9C 2UXCC 2PT7G 1L2FA 1MKYA 1IBKC 4JV5C 2BJOA 3EERA 4NXNC 1ZB9A 4DR5C 1UKKA 1USPB 4BSZA 1WH9A 1XMQC 4LF7C 5IWAC 4JYAC 4DR7C 4X66C 5BR8C 4MH4A 5IT9D 4DCSA 2ASBA 4NOZA
chains in the Genus database with same CATH superfamily
2ONFA 4DR4C 1P7LA 2MCQA 4ISBA 4LFAC 3VNRA 4DV7C 1MXAA 3PESA 2M5OA 5BURA 2E0GA 1WF3A 2Y4NA 2E8EA 1XHJA 4JI6C 2KDNA 2ZZMA 2BH1X 4NDNA 5KYVA 1T5HX 4B3MC 3R9WA 4DV5C 2VQFC 1VEHA 4X65C 5A2QD 1O9TA 4YHHC 2UXBC 3CJEA 4IZ6A 1USPA 2ZZNA 4DV3C 4JI7C 1MDBA 1JOSA 2VQEC 4FUTA 2CXCA 4K0BA 4K0KC 1M6XA 4D4GA 2WD9A 2UUAC 1J5EC 5BSMA 4X64C 1NYEA 3L8CA 4WS9A 3CQ1A 4JM1A 2ATWA 2QVZX 3UZ0A 3IEUA 4DG8A 3GPCA 2VSQA 1QWIA 1K0RA 1ZB8A 1O93A 5A19A 2HHHC 3UEBA 3CQ3A 4FUQA 2P02A 2CY1A 2JNVA 4LFCC 4BC7A 3T1HC 4NXMC 2Y4OA 1IBKC 2KZ0A 1ZB9A 1QM4A 3PBKA 2WP0C 4X66C 1XRAA 3UX3A 3CQ2A 2E8CA 2D1RA 3T1YC 3TR3A 3E7WA 4JI3C 2CU6A 4DR1C 4B3TC 1HH2P 2E8FA 1FLOA 4DV2C 2D27A 4LF4C 3ETOA 4DUYC 3RG2A 3C5EA 4LF9C 4D4IA 4LF8C 4G1IA 2HJGA 3AF6A 4R1LA 4RMNA 2QW0X 2DYJA 3EQ6A 3N54B 4GKKC 1IBMC 1PG4A 1XMOC 3OTOC 1ML8A 3GR1A 1XNQC 3IPLA 1XDXA 1N32C 1N34C 1M6XC 4GKJC 1XRBA 4DCUA 4DG9A 2OPLB 3K6RA 1N2FA 5IFIA 4JI5C 2P2FA 2PG1E 4L4QA 4ZJZA 4LF5C 2JMPA 4D56A 5BUQA 3FCCA 4DR3C 2QVXX 2KZFA 2UUBC 4R1MA 4DV1C 5T8TA 2OPLA 3CW8X 1XS3A 1KKGA 1HR0C 3J81D 1O92A 1MDFA 4LE5A 3R44A 3A9VA 1P4EA 5BSVA 1PA4A 4PZPA 4DCTA 2E5LC 2DPLA 4G37A 4B3RC 4MTNA 4LF6C 2P20A 3NYRA 5AE3A 4RLQA 2PT7G 3A25A 2D1TA 4BSZA 1MD9A 4OYCA 4OXIA 4LF7C 5IWAC 4RM3A 3H2TA 4DR7C 2D1SA 4BC9A 1UWDA 5K8FA 2QVYX 1MXBA 1GPMA 4NOZA 4I9GA 1N33C 1LQLA 2Y27A 1HNWC 3GKUA 4PUIA 5LMUC 1HNXC 1LCIA 3O2EA 4XX2A 4PUGA 5CZXA 2D7VA 5KEIA 3LAXA 4GXQA 1PU1A 3A9UA 3JAMD 4RVOA 2ZM6C 4G36A 1RG9A 1WCJA 4WV3A 5BSTA 1IBLC 2QL8A 2VZEA 4IR7A 3L95X 2NCLA 1N36C 3N2QA 5LMNC 3VNSA 1FJGC 1BA3A 3DAYA 1V25A 2YX1A 4RVNA 3I08A 4DV4C 3IEVA 4ODJA 4ZLPA 4BBYA 3FCEA 2Z51A 4X62C 4LFBC 3FM7A 2UU9C 3LNOA 2MMAB 3LNVA 2DHMA 4PROC 1P4EC 3PROC 3R9XA 2YCBA 4DR2C 3IMLA 4I9FA 3TUFA 2M5HA 1PG3A 3E7XA 3A4IA 4TPSB 2P2QA 5BUSA 4EATA 3VNQA 3UX2A 4B3SC 2UUCC 4JI4C 1IB8A 1HNZC 5K85A 4OX9C 2D28C 1MKYA 3UOWA 2BJOA 2P2MA 4PUHA 4NXNC 1UKKA 2P2BA 1USPB 1WH9A 1XMQC 3DLPX 4JYAC 4MH4A 1V60A 5IT9D 1XRCA 4HPVA 1FUGA 4DCSA 2ASBA 3I07A 4R0MA 4AQYC 5FLXD 3J7AD 3NPDA 3KXWA 2F4VC 1ULTA 2PN2A 3LGXA 5DV9A 5GTDA 5BSUA 5LCIA 5T8SA 4BCAA 3B7WA 4GS5A 4JI0C 1I94C 2OO4A 3GR0A 3A26A 4KTTA 4GXRA 2YWCA 5AE2A 3SO4A 2XR1A 1O90A 4DCVA 5ADZA 5KYTA 4FTFA 4JI8C 3CW9A 4D57A 4L7IA 5AE1A 1EGAA 4DUZC 4JI1C 1NY8A 5BSRA 1V26A 3ETCA 4L2ZA 1YJ7A 1VLAA 3TDEA 5A1GA 1RY2A 1TH5A 2E7GA 3DHVA 4DV0C 1T5DX 1XNRC 2AYAA 4KHPC 1MXCA 3AF5A 4PHTA 3LUSA 2EGTA 2OBVA 4U5YD 4KTVA 3RV2A 4YY3C 3G7SA 2UXDC 4JI2C 3J80D 5JRHA 3NYQA 4DV6C 5BSWA 4DR6C 2D1QA 5E7QA 3AY0A 2YWBA 1YGTA 5H9UA 2V7BA 2UXCC 1L2FA 5CZVA 4JV5C 3EERA 5A1IA 2ZTBA 2PROA 1AMUA 4RM2A 4DR5C 4RLFA 5BR8C 3TQIA 2P2JA 3NI2A 3S82A 2MM9A
chains in the Genus database with same CATH topology
2ONFA 4DR4C 1P7LA 4ISBA 4LFAC 3VNRA 4DV7C 1MXAA 3PESA 5BURA 2E0GA 1WF3A 2Y4NA 2E8EA 4JI6C 2BH1X 4NDNA 5KYVA 1T5HX 4B3MC 3R9WA 4DV5C 2VQFC 4X65C 5A2QD 1O9TA 4YHHC 2UXBC 3CJEA 4IZ6A 1USPA 4DV3C 4JI7C 1MDBA 1JOSA 2VQEC 4FUTA 2CXCA 4K0BA 4K0KC 4D4GA 2WD9A 2UUAC 1J5EC 5BSMA 4X64C 1NYEA 3L8CA 4WS9A 4JM1A 2ATWA 2QVZX 3UZ0A 3IEUA 4DG8A 3GPCA 2VSQA 1QWIA 1K0RA 1ZB8A 1O93A 5A19A 2HHHC 4FUQA 2P02A 2CY1A 4LFCC 4BC7A 3T1HC 4NXMC 2Y4OA 1IBKC 1ZB9A 1QM4A 3PBKA 2WP0C 4X66C 1XRAA 2E8CA 2D1RA 3T1YC 3E7WA 4JI3C 4DR1C 4B3TC 1HH2P 2E8FA 4DV2C 2D27A 4LF4C 3ETOA 4DUYC 3RG2A 3C5EA 4LF9C 4D4IA 4LF8C 4G1IA 2HJGA 3AF6A 4R1LA 4RMNA 2QW0X 2DYJA 3EQ6A 3N54B 4GKKC 1IBMC 1PG4A 1XMOC 3OTOC 1ML8A 3GR1A 1XNQC 3IPLA 1N32C 1N34C 4GKJC 1XRBA 4DCUA 4DG9A 2OPLB 1N2FA 5IFIA 4JI5C 2P2FA 4L4QA 4ZJZA 4LF5C 2JMPA 4D56A 5BUQA 3FCCA 4DR3C 2QVXX 2KZFA 2UUBC 4R1MA 4DV1C 5T8TA 2OPLA 3CW8X 1KKGA 1HR0C 3J81D 1O92A 1MDFA 4LE5A 3R44A 3A9VA 5BSVA 1PA4A 4PZPA 4DCTA 2E5LC 2DPLA 4G37A 4B3RC 4MTNA 4LF6C 2P20A 3NYRA 5AE3A 4RLQA 2PT7G 2D1TA 4BSZA 1MD9A 4OYCA 4OXIA 4LF7C 5IWAC 4RM3A 3H2TA 4DR7C 2D1SA 4BC9A 5K8FA 2QVYX 1MXBA 1GPMA 4NOZA 4I9GA 1N33C 1LQLA 2Y27A 1HNWC 3GKUA 5LMUC 1HNXC 1LCIA 4XX2A 5CZXA 2D7VA 5KEIA 3LAXA 4GXQA 3A9UA 3JAMD 4RVOA 2ZM6C 4G36A 1RG9A 4WV3A 5BSTA 1IBLC 2QL8A 2VZEA 4IR7A 3L95X 1N36C 3N2QA 5LMNC 3VNSA 1FJGC 1BA3A 3DAYA 1V25A 4RVNA 3I08A 4DV4C 3IEVA 4ODJA 4ZLPA 4BBYA 3FCEA 4LFBC 4X62C 2UU9C 3LNVA 4PROC 3PROC 3R9XA 2YCBA 4DR2C 3IMLA 4I9FA 3TUFA 1PG3A 3E7XA 3A4IA 4TPSB 2P2QA 5BUSA 4EATA 3VNQA 4B3SC 2UUCC 4JI4C 1HNZC 5K85A 4OX9C 2D28C 1MKYA 3UOWA 2BJOA 2P2MA 4NXNC 1UKKA 2P2BA 1USPB 1WH9A 1XMQC 3DLPX 4JYAC 4MH4A 5IT9D 1XRCA 4HPVA 1FUGA 4DCSA 2ASBA 3I07A 4R0MA 4AQYC 5FLXD 3J7AD 3NPDA 3KXWA 2F4VC 1ULTA 2PN2A 3LGXA 5DV9A 5GTDA 5BSUA 5T8SA 4BCAA 3B7WA 4GS5A 4JI0C 1I94C 2OO4A 3GR0A 4KTTA 4GXRA 2YWCA 5AE2A 3SO4A 2XR1A 1O90A 4DCVA 5ADZA 5KYTA 4FTFA 4JI8C 3CW9A 4D57A 4L7IA 5AE1A 1EGAA 4DUZC 4JI1C 5BSRA 1V26A 3ETCA 4L2ZA 1YJ7A 1VLAA 3TDEA 5A1GA 1RY2A 3DHVA 2E7GA 4DV0C 1T5DX 1XNRC 2AYAA 4KHPC 1MXCA 3AF5A 4PHTA 3LUSA 2EGTA 2OBVA 4U5YD 4KTVA 3RV2A 4YY3C 3G7SA 2UXDC 4JI2C 3J80D 5JRHA 3NYQA 4DV6C 5BSWA 4DR6C 2D1QA 5E7QA 2YWBA 5H9UA 2V7BA 2UXCC 1L2FA 5CZVA 4JV5C 3EERA 5A1IA 2PROA 1AMUA 4RM2A 4DR5C 4RLFA 5BR8C 3TQIA 2P2JA 3NI2A 3S82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y C;  2ONF A;  3I07 A;  4DR4 C;  1N33 C;  4AQY C;  1LQL A;  5FLX D;  4JI3 C;  4DR1 C;  3J7A D;  1HNW C;  3GKU A;  4B3T C;  4LFA C;  1HH2 P;  2E8F A;  4DV7 C;  2F4V C;  4DV2 C;  2PN2 A;  4LF4 C;  5LMU C;  4DUY C;  1HNX C;  4XX2 A;  4LF9 C;  4LF8 C;  3AF6 A;  2HJG A;  1WF3 A;  2E8E A;  2D7V A;  2DYJ A;  4JI0 C;  1I94 C;  4GKK C;  1IBM C;  4JI6 C;  1XMO C;  3JAM D;  2ZM6 C;  3OTO C;  1ML8 A;  1XNQ C;  4B3M C;  2XR1 A;  3R9W A;  1IBL C;  2QL8 A;  4DV5 C;  2VQF C;  4DCV A;  1N32 C;  1N34 C;  1N36 C;  4X65 C;  5A2Q D;  4JI8 C;  2UXB C;  4YHH C;  5LMN C;  1FJG C;  3CJE A;  4GKJ C;  4DCU A;  2OPL B;  1USP A;  1EGA A;  4DUZ C;  4DV3 C;  4JI7 C;  1N2F A;  1JOS A;  4DV4 C;  4JI5 C;  4JI1 C;  2VQE C;  3IEV A;  2CXC A;  4LF5 C;  2JMP A;  4K0K C;  4DR3 C;  4LFB C;  4X62 C;  1VLA A;  2UU9 C;  2UUA C;  1J5E C;  2E7G A;  2KZF A;  2UUB C;  4X64 C;  4DV0 C;  1XNR C;  4KHP C;  4DV1 C;  3AF5 A;  1NYE A;  3R9X A;  2YCB A;  3LUS A;  2OPL A;  4DR2 C;  2EGT A;  1KKG A;  4YY3 C;  1HR0 C;  2E8C A;  2ATW A;  3J81 D;  2UXD C;  4JI2 C;  3IEU A;  1QWI A;  3J80 D;  1K0R A;  1ZB8 A;  2HHH C;  4DV6 C;  4DR6 C;  4B3S C;  1PA4 A;  4DCT A;  2E5L C;  2UUC C;  4JI4 C;  4B3R C;  4MTN A;  1HNZ C;  4LF6 C;  2CY1 A;  4LFC C;  3T1H C;  4NXM C;  4OX9 C;  2UXC C;  2PT7 G;  1L2F A;  1MKY A;  1IBK C;  4JV5 C;  2BJO A;  3EER A;  4NXN C;  1ZB9 A;  4DR5 C;  1UKK A;  1USP B;  4BSZ A;  1WH9 A;  1XMQ C;  4LF7 C;  5IWA C;  4JYA C;  4DR7 C;  4X66 C;  5BR8 C;  4MH4 A;  5IT9 D;  4DCS A;  2ASB A;  4NOZ A; 
#chains in the Genus database with same CATH topology
 2ONF A;  4DR4 C;  1P7L A;  2MCQ A;  4ISB A;  4LFA C;  3VNR A;  4DV7 C;  1MXA A;  3PES A;  2M5O A;  5BUR A;  2E0G A;  1WF3 A;  2Y4N A;  2E8E A;  1XHJ A;  4JI6 C;  2KDN A;  2ZZM A;  2BH1 X;  4NDN A;  5KYV A;  1T5H X;  4B3M C;  3R9W A;  4DV5 C;  2VQF C;  1VEH A;  4X65 C;  5A2Q D;  1O9T A;  4YHH C;  2UXB C;  3CJE A;  4IZ6 A;  1USP A;  2ZZN A;  4DV3 C;  4JI7 C;  1MDB A;  1JOS A;  2VQE C;  4FUT A;  2CXC A;  4K0B A;  4K0K C;  1M6X A;  4D4G A;  2WD9 A;  2UUA C;  1J5E C;  5BSM A;  4X64 C;  1NYE A;  3L8C A;  4WS9 A;  3CQ1 A;  4JM1 A;  2ATW A;  2QVZ X;  3UZ0 A;  3IEU A;  4DG8 A;  3GPC A;  2VSQ A;  1QWI A;  1K0R A;  1ZB8 A;  1O93 A;  5A19 A;  2HHH C;  3UEB A;  3CQ3 A;  4FUQ A;  2P02 A;  2CY1 A;  2JNV A;  4LFC C;  4BC7 A;  3T1H C;  4NXM C;  2Y4O A;  1IBK C;  2KZ0 A;  1ZB9 A;  1QM4 A;  3PBK A;  2WP0 C;  4X66 C;  1XRA A;  3UX3 A;  3CQ2 A;  2E8C A;  2D1R A;  3T1Y C;  3TR3 A;  3E7W A;  4JI3 C;  2CU6 A;  4DR1 C;  4B3T C;  1HH2 P;  2E8F A;  1FLO A;  4DV2 C;  2D27 A;  4LF4 C;  3ETO A;  4DUY C;  3RG2 A;  3C5E A;  4LF9 C;  4D4I A;  4LF8 C;  4G1I A;  2HJG A;  3AF6 A;  4R1L A;  4RMN A;  2QW0 X;  2DYJ A;  3EQ6 A;  3N54 B;  4GKK C;  1IBM C;  1PG4 A;  1XMO C;  3OTO C;  1ML8 A;  3GR1 A;  1XNQ C;  3IPL A;  1XDX A;  1N32 C;  1N34 C;  1M6X C;  4GKJ C;  1XRB A;  4DCU A;  4DG9 A;  2OPL B;  3K6R A;  1N2F A;  5IFI A;  4JI5 C;  2P2F A;  2PG1 E;  4L4Q A;  4ZJZ A;  4LF5 C;  2JMP A;  4D56 A;  5BUQ A;  3FCC A;  4DR3 C;  2QVX X;  2KZF A;  2UUB C;  4R1M A;  4DV1 C;  5T8T A;  2OPL A;  3CW8 X;  1XS3 A;  1KKG A;  1HR0 C;  3J81 D;  1O92 A;  1MDF A;  4LE5 A;  3R44 A;  3A9V A;  1P4E A;  5BSV A;  1PA4 A;  4PZP A;  4DCT A;  2E5L C;  2DPL A;  4G37 A;  4B3R C;  4MTN A;  4LF6 C;  2P20 A;  3NYR A;  5AE3 A;  4RLQ A;  2PT7 G;  3A25 A;  2D1T A;  4BSZ A;  1MD9 A;  4OYC A;  4OXI A;  4LF7 C;  5IWA C;  4RM3 A;  3H2T A;  4DR7 C;  2D1S A;  4BC9 A;  1UWD A;  5K8F A;  2QVY X;  1MXB A;  1GPM A;  4NOZ A;  4I9G A;  1N33 C;  1LQL A;  2Y27 A;  1HNW C;  3GKU A;  4PUI A;  5LMU C;  1HNX C;  1LCI A;  3O2E A;  4XX2 A;  4PUG A;  5CZX A;  2D7V A;  5KEI A;  3LAX A;  4GXQ A;  1PU1 A;  3A9U A;  3JAM D;  4RVO A;  2ZM6 C;  4G36 A;  1RG9 A;  1WCJ A;  4WV3 A;  5BST A;  1IBL C;  2QL8 A;  2VZE A;  4IR7 A;  3L95 X;  2NCL A;  1N36 C;  3N2Q A;  5LMN C;  3VNS A;  1FJG C;  1BA3 A;  3DAY A;  1V25 A;  2YX1 A;  4RVN A;  3I08 A;  4DV4 C;  3IEV A;  4ODJ A;  4ZLP A;  4BBY A;  3FCE A;  2Z51 A;  4X62 C;  4LFB C;  3FM7 A;  2UU9 C;  3LNO A;  2MMA B;  3LNV A;  2DHM A;  4PRO C;  1P4E C;  3PRO C;  3R9X A;  2YCB A;  4DR2 C;  3IML A;  4I9F A;  3TUF A;  2M5H A;  1PG3 A;  3E7X A;  3A4I A;  4TPS B;  2P2Q A;  5BUS A;  4EAT A;  3VNQ A;  3UX2 A;  4B3S C;  2UUC C;  4JI4 C;  1IB8 A;  1HNZ C;  5K85 A;  4OX9 C;  2D28 C;  1MKY A;  3UOW A;  2BJO A;  2P2M A;  4PUH A;  4NXN C;  1UKK A;  2P2B A;  1USP B;  1WH9 A;  1XMQ C;  3DLP X;  4JYA C;  4MH4 A;  1V60 A;  5IT9 D;  1XRC A;  4HPV A;  1FUG A;  4DCS A;  2ASB A;  3I07 A;  4R0M A;  4AQY C;  5FLX D;  3J7A D;  3NPD A;  3KXW A;  2F4V C;  1ULT A;  2PN2 A;  3LGX A;  5DV9 A;  5GTD A;  5BSU A;  5LCI A;  5T8S A;  4BCA A;  3B7W A;  4GS5 A;  4JI0 C;  1I94 C;  2OO4 A;  3GR0 A;  3A26 A;  4KTT A;  4GXR A;  2YWC A;  5AE2 A;  3SO4 A;  2XR1 A;  1O90 A;  4DCV A;  5ADZ A;  5KYT A;  4FTF A;  4JI8 C;  3CW9 A;  4D57 A;  4L7I A;  5AE1 A;  1EGA A;  4DUZ C;  4JI1 C;  1NY8 A;  5BSR A;  1V26 A;  3ETC A;  4L2Z A;  1YJ7 A;  1VLA A;  3TDE A;  5A1G A;  1RY2 A;  1TH5 A;  2E7G A;  3DHV A;  4DV0 C;  1T5D X;  1XNR C;  2AYA A;  4KHP C;  1MXC A;  3AF5 A;  4PHT A;  3LUS A;  2EGT A;  2OBV A;  4U5Y D;  4KTV A;  3RV2 A;  4YY3 C;  3G7S A;  2UXD C;  4JI2 C;  3J80 D;  5JRH A;  3NYQ A;  4DV6 C;  5BSW A;  4DR6 C;  2D1Q A;  5E7Q A;  3AY0 A;  2YWB A;  1YGT A;  5H9U A;  2V7B A;  2UXC C;  1L2F A;  5CZV A;  4JV5 C;  3EER A;  5A1I A;  2ZTB A;  2PRO A;  1AMU A;  4RM2 A;  4DR5 C;  4RLF A;  5BR8 C;  3TQI A;  2P2J A;  3NI2 A;  3S82 A;  2MM9 A; 
#chains in the Genus database with same CATH homology
 2ONF A;  4DR4 C;  1P7L A;  4ISB A;  4LFA C;  3VNR A;  4DV7 C;  1MXA A;  3PES A;  5BUR A;  2E0G A;  1WF3 A;  2Y4N A;  2E8E A;  4JI6 C;  2BH1 X;  4NDN A;  5KYV A;  1T5H X;  4B3M C;  3R9W A;  4DV5 C;  2VQF C;  4X65 C;  5A2Q D;  1O9T A;  4YHH C;  2UXB C;  3CJE A;  4IZ6 A;  1USP A;  4DV3 C;  4JI7 C;  1MDB A;  1JOS A;  2VQE C;  4FUT A;  2CXC A;  4K0B A;  4K0K C;  4D4G A;  2WD9 A;  2UUA C;  1J5E C;  5BSM A;  4X64 C;  1NYE A;  3L8C A;  4WS9 A;  4JM1 A;  2ATW A;  2QVZ X;  3UZ0 A;  3IEU A;  4DG8 A;  3GPC A;  2VSQ A;  1QWI A;  1K0R A;  1ZB8 A;  1O93 A;  5A19 A;  2HHH C;  4FUQ A;  2P02 A;  2CY1 A;  4LFC C;  4BC7 A;  3T1H C;  4NXM C;  2Y4O A;  1IBK C;  1ZB9 A;  1QM4 A;  3PBK A;  2WP0 C;  4X66 C;  1XRA A;  2E8C A;  2D1R A;  3T1Y C;  3E7W A;  4JI3 C;  4DR1 C;  4B3T C;  1HH2 P;  2E8F A;  4DV2 C;  2D27 A;  4LF4 C;  3ETO A;  4DUY C;  3RG2 A;  3C5E A;  4LF9 C;  4D4I A;  4LF8 C;  4G1I A;  2HJG A;  3AF6 A;  4R1L A;  4RMN A;  2QW0 X;  2DYJ A;  3EQ6 A;  3N54 B;  4GKK C;  1IBM C;  1PG4 A;  1XMO C;  3OTO C;  1ML8 A;  3GR1 A;  1XNQ C;  3IPL A;  1N32 C;  1N34 C;  4GKJ C;  1XRB A;  4DCU A;  4DG9 A;  2OPL B;  1N2F A;  5IFI A;  4JI5 C;  2P2F A;  4L4Q A;  4ZJZ A;  4LF5 C;  2JMP A;  4D56 A;  5BUQ A;  3FCC A;  4DR3 C;  2QVX X;  2KZF A;  2UUB C;  4R1M A;  4DV1 C;  5T8T A;  2OPL A;  3CW8 X;  1KKG A;  1HR0 C;  3J81 D;  1O92 A;  1MDF A;  4LE5 A;  3R44 A;  3A9V A;  5BSV A;  1PA4 A;  4PZP A;  4DCT A;  2E5L C;  2DPL A;  4G37 A;  4B3R C;  4MTN A;  4LF6 C;  2P20 A;  3NYR A;  5AE3 A;  4RLQ A;  2PT7 G;  2D1T A;  4BSZ A;  1MD9 A;  4OYC A;  4OXI A;  4LF7 C;  5IWA C;  4RM3 A;  3H2T A;  4DR7 C;  2D1S A;  4BC9 A;  5K8F A;  2QVY X;  1MXB A;  1GPM A;  4NOZ A;  4I9G A;  1N33 C;  1LQL A;  2Y27 A;  1HNW C;  3GKU A;  5LMU C;  1HNX C;  1LCI A;  4XX2 A;  5CZX A;  2D7V A;  5KEI A;  3LAX A;  4GXQ A;  3A9U A;  3JAM D;  4RVO A;  2ZM6 C;  4G36 A;  1RG9 A;  4WV3 A;  5BST A;  1IBL C;  2QL8 A;  2VZE A;  4IR7 A;  3L95 X;  1N36 C;  3N2Q A;  5LMN C;  3VNS A;  1FJG C;  1BA3 A;  3DAY A;  1V25 A;  4RVN A;  3I08 A;  4DV4 C;  3IEV A;  4ODJ A;  4ZLP A;  4BBY A;  3FCE A;  4LFB C;  4X62 C;  2UU9 C;  3LNV A;  4PRO C;  3PRO C;  3R9X A;  2YCB A;  4DR2 C;  3IML A;  4I9F A;  3TUF A;  1PG3 A;  3E7X A;  3A4I A;  4TPS B;  2P2Q A;  5BUS A;  4EAT A;  3VNQ A;  4B3S C;  2UUC C;  4JI4 C;  1HNZ C;  5K85 A;  4OX9 C;  2D28 C;  1MKY A;  3UOW A;  2BJO A;  2P2M A;  4NXN C;  1UKK A;  2P2B A;  1USP B;  1WH9 A;  1XMQ C;  3DLP X;  4JYA C;  4MH4 A;  5IT9 D;  1XRC A;  4HPV A;  1FUG A;  4DCS A;  2ASB A;  3I07 A;  4R0M A;  4AQY C;  5FLX D;  3J7A D;  3NPD A;  3KXW A;  2F4V C;  1ULT A;  2PN2 A;  3LGX A;  5DV9 A;  5GTD A;  5BSU A;  5T8S A;  4BCA A;  3B7W A;  4GS5 A;  4JI0 C;  1I94 C;  2OO4 A;  3GR0 A;  4KTT A;  4GXR A;  2YWC A;  5AE2 A;  3SO4 A;  2XR1 A;  1O90 A;  4DCV A;  5ADZ A;  5KYT A;  4FTF A;  4JI8 C;  3CW9 A;  4D57 A;  4L7I A;  5AE1 A;  1EGA A;  4DUZ C;  4JI1 C;  5BSR A;  1V26 A;  3ETC A;  4L2Z A;  1YJ7 A;  1VLA A;  3TDE A;  5A1G A;  1RY2 A;  3DHV A;  2E7G A;  4DV0 C;  1T5D X;  1XNR C;  2AYA A;  4KHP C;  1MXC A;  3AF5 A;  4PHT A;  3LUS A;  2EGT A;  2OBV A;  4U5Y D;  4KTV A;  3RV2 A;  4YY3 C;  3G7S A;  2UXD C;  4JI2 C;  3J80 D;  5JRH A;  3NYQ A;  4DV6 C;  5BSW A;  4DR6 C;  2D1Q A;  5E7Q A;  2YWB A;  5H9U A;  2V7B A;  2UXC C;  1L2F A;  5CZV A;  4JV5 C;  3EER A;  5A1I A;  2PRO A;  1AMU A;  4RM2 A;  4DR5 C;  4RLF A;  5BR8 C;  3TQI A;  2P2J A;  3NI2 A;  3S82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...