1J5EC

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 45
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1j5eC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1j5eC02
4DCVA 4DR7C 1HNWC 1IBLC 2HJGA 5IWAC 4X64C 1WF3A 4MH4A 2UXCC 1ML8A 3LUSA 2E8FA 3AF5A 4NOZA 4DR1C 3GKUA 4LFCC 4DV7C 4B3MC 2E8EA 4GKKC 4AQYC 4JI0C 1ZB9A 4BSZA 3J7AD 2D7VA 4LF6C 4DR6C 5BR8C 4DV5C 3R9WA 3T1YC 4DCSA 4JI2C 2CXCA 2YCBA 4DV0C 2DYJA 4YHHC 4DV2C 1N2FA 2XR1A 1KKGA 4DCUA 1USPA 4JI5C 1QWIA 3T1HC 4DV1C 2VQEC 2ASBA 4GKJC 1N34C 2QL8A 4JI7C 4JI4C 1MKYA 1K0RA 1I94C 2E8CA 3J81D 3CJEA 4LFAC 2JMPA 4DCTA 1HNZC 1JOSA 2E5LC 2PN2A 1HR0C 4K0KC 2CY1A 3IEUA 4X66C 1IBKC 2UUBC 4DV6C 3OTOC 1EGAA 2OPLA 4MTNA 4XX2A 3JAMD 2UXDC 1ZB8A 5LMUC 1XMQC 4LF4C 4DV3C 2KZFA 1XNQC 2UUAC 5A2QD 2HHHC 4LF5C 1VLAA 2E7GA 1N36C 5IT9D 4LF7C 4NXNC 1L2FA 1LQLA 2OPLB 3EERA 4LF8C 2PT7G 4X62C 1HNXC 4B3RC 4B3TC 2EGTA 2F4VC 1XMOC 3J80D 4DR2C 4DUYC 2VQFC 2ATWA 4DR3C 2UXBC 4DR4C 1NYEA 4YY3C 4DV4C 4NXMC 1FJGC 4B3SC 4JI1C 1XNRC 4DUZC 3IEVA 2ONFA 3I07A 4KHPC 3AF6A 4JYAC 1HH2P 2BJOA 5LMNC 1UKKA 1N32C 2ZM6C 5FLXD 4X65C 3R9XA 1USPB 2UU9C 4JV5C 4LFBC 4JI3C 4OX9C 1IBMC 4JI8C 1N33C 4DR5C 2UUCC 1WH9A 4JI6C 1J5EC 1PA4A 4LF9C
chains in the Genus database with same CATH superfamily
2M5OA 2MCQA 4R0MA 1VEHA 4MH4A 5AE2A 3LUSA 2ZZMA 4NOZA 4BCAA 4DV7C 4B3MC 4AQYC 3FCCA 5BSMA 3GPCA 1XRCA 4DV5C 5BUSA 3E7WA 2CXCA 4OYCA 4DV0C 2DYJA 1UWDA 4DV2C 3R44A 2DHMA 4FUTA 4DV1C 2VQEC 3S82A 4JI4C 1MKYA 3SO4A 2P2QA 2QVZX 3VNQA 4R1MA 1O92A 3NYRA 4X66C 1IBKC 3C5EA 2WD9A 4RVOA 4MTNA 1V60A 1V26A 2D1SA 1XMQC 1XNQC 2ZZNA 4LF5C 2E7GA 1N36C 5IT9D 4PUHA 2OPLB 3EERA 4X62C 4B3RC 3L8CA 5T8TA 3J80D 4DR2C 1PU1A 5BSTA 3UOWA 1NYEA 4DV4C 4DUZC 5DV9A 2ONFA 3I07A 2BJOA 2NCLA 1UKKA 4X65C 2P2MA 4ZJZA 2M5HA 1FLOA 4JV5C 1MDFA 4IR7A 4G1IA 5T8SA 1N33C 4DR5C 1J5EC 3ETOA 2V7BA 1MXBA 1BA3A 4DCVA 1IBLC 5IWAC 4X64C 4KTVA 4GXRA 4PHTA 4RMNA 3B7WA 2E0GA 3DLPX 2P2BA 1T5HX 4HPVA 2YWCA 4DR1C 2E8EA 4GKKC 4LE5A 2D7VA 3NI2A 4DR6C 3E7XA 1XRAA 4R1LA 2OO4A 5K8FA 5IFIA 4YHHC 1IB8A 4JI5C 4D57A 3RG2A 4GKJC 2MM9A 1K0RA 3CW9A 2E8CA 1I94C 5JRHA 2D1TA 2JMPA 1O90A 4DCTA 1P4EA 2PN2A 4FUQA 1MXCA 3GR0A 2UUBC 4DV6C 4G36A 4IZ6A 2VSQA 3JAMD 2OPLA 4XX2A 2DPLA 2PG1E 5BSUA 2KZFA 1GPMA 2HHHC 1VLAA 4LF7C 2QVYX 1L2FA 4LF8C 2PT7G 1TH5A 4GXQA 3K6RA 4DR3C 1XHJA 4WS9A 4NXMC 1FJGC 1V25A 4JI1C 2PROA 4ZLPA 3EQ6A 4KHPC 3N54B 1HH2P 4JYAC 3R9XA 3I08A 5K85A 2CU6A 4OX9C 1IBMC 4U5YD 4JI8C 2UUCC 1T5DX 1O93A 2OBVA 4TPSB 4LF9C 3UZ0A 3AY0A 3CQ2A 4JM1A 5GTDA 4DR7C 1YJ7A 4KTTA 2HJGA 2Y4OA 3G7SA 1WF3A 2UXCC 1ML8A 2VZEA 3NPDA 4L4QA 2QVXX 3TUFA 3ETCA 3GKUA 4LFCC 1AMUA 2D27A 4FTFA 3J7AD 3A4IA 1LCIA 3T1YC 4PUIA 2BH1X 3LGXA 2D28C 4BC7A 3TQIA 3H2TA 3A9VA 3TDEA 1MD9A 4PUGA 2MMAB 4DCUA 1USPA 2ZTBA 1QWIA 2KDNA 3T1HC 5CZXA 5AE3A 1N34C 1M6XC 2QL8A 2Y27A 2Z51A 2AYAA 4D4IA 1XDXA 3J81D 1FUGA 1JOSA 2E5LC 1HR0C 4K0KC 2CY1A 5BSWA 4L7IA 4D4GA 4G37A 1EGAA 3LAXA 3LNOA 4PROC 5LMUC 4LF4C 1QM4A 4I9FA 3LNVA 3UX2A 5BSVA 2UUAC 4GS5A 2WP0C 5H9UA 3A25A 3N2QA 1LQLA 3DAYA 4B3TC 3GR1A 2EGTA 4RLQA 4DUYC 2UXBC 4DR4C 4BC9A 1P7LA 1YGTA 1RY2A 5LMNC 1N32C 5BSRA 4RM2A 5BURA 2UU9C 1RG9A 4LFBC 3NYQA 4JI3C 4K0BA 3TR3A 4WV3A 4RLFA 5E7QA 4BBYA 1MXAA 1HNWC 2D1RA 4RM3A 2QW0X 2E8FA 2KZ0A 1PG4A 3AF5A 3O2EA 3PESA 3VNRA 1PG3A 4JI0C 1ZB9A 4ISBA 4BSZA 4LF6C 1XRBA 3UX3A 5BR8C 5A19A 3R9WA 4DCSA 3FM7A 4JI2C 2YCBA 3A9UA 3A26A 2Y4NA 1N2FA 2XR1A 4OXIA 5KYVA 1XS3A 1KKGA 2P20A 1P4EC 3IPLA 2ASBA 5KYTA 1WCJA 3PBKA 3PROC 5A1IA 4JI7C 3CJEA 4LFAC 3KXWA 1HNZC 1NY8A 3IEUA 4L2ZA 3OTOC 4PZPA 5ADZA 3CQ3A 2UXDC 5BUQA 4NDNA 1ZB8A 3VNSA 3IMLA 4RVNA 4DG8A 5A1GA 4DV3C 3CQ1A 5A2QD 4NXNC 1MDBA 2D1QA 3RV2A 1HNXC 3CW8X 4D56A 2F4VC 1XMOC 1ULTA 1M6XA 4I9GA 5CZVA 2VQFC 2ATWA 2YWBA 4EATA 3UEBA 4YY3C 4B3SC 1XNRC 3IEVA 3AF6A 2P2JA 2P02A 5KEIA 4DG9A 2ZM6C 5FLXD 2JNVA 5LCIA 1USPB 1O9TA 3FCEA 4ODJA 3DHVA 1WH9A 3L95X 4JI6C 1PA4A 2YX1A 2P2FA 5AE1A
chains in the Genus database with same CATH topology
4R0MA 4MH4A 5AE2A 3LUSA 4NOZA 4BCAA 4DV7C 4B3MC 4AQYC 3FCCA 5BSMA 3GPCA 1XRCA 4DV5C 5BUSA 3E7WA 2CXCA 4OYCA 4DV0C 2DYJA 4DV2C 3R44A 4FUTA 4DV1C 2VQEC 3S82A 4JI4C 1MKYA 3SO4A 2P2QA 2QVZX 3VNQA 4R1MA 1O92A 3NYRA 4X66C 1IBKC 3C5EA 2WD9A 4RVOA 4MTNA 1V26A 2D1SA 1XMQC 1XNQC 4LF5C 2E7GA 1N36C 5IT9D 2OPLB 3EERA 4X62C 4B3RC 3L8CA 5T8TA 3J80D 4DR2C 5BSTA 3UOWA 1NYEA 4DV4C 4DUZC 5DV9A 2ONFA 3I07A 2BJOA 1UKKA 4X65C 2P2MA 4ZJZA 4JV5C 1MDFA 4IR7A 4G1IA 5T8SA 1N33C 4DR5C 1J5EC 3ETOA 2V7BA 1MXBA 1BA3A 4DCVA 1IBLC 5IWAC 4X64C 4KTVA 4GXRA 4PHTA 4RMNA 3B7WA 2E0GA 3DLPX 2P2BA 1T5HX 4HPVA 2YWCA 4DR1C 2E8EA 4GKKC 4LE5A 2D7VA 3NI2A 4DR6C 3E7XA 1XRAA 4R1LA 2OO4A 5K8FA 5IFIA 4YHHC 4JI5C 4D57A 3RG2A 4GKJC 1K0RA 3CW9A 2E8CA 1I94C 5JRHA 2D1TA 2JMPA 1O90A 4DCTA 2PN2A 4FUQA 1MXCA 3GR0A 2UUBC 4DV6C 4G36A 4IZ6A 2VSQA 2OPLA 4XX2A 3JAMD 2DPLA 5BSUA 2KZFA 1GPMA 2HHHC 1VLAA 4LF7C 2QVYX 1L2FA 4LF8C 2PT7G 4GXQA 4DR3C 4WS9A 4NXMC 1FJGC 1V25A 4JI1C 2PROA 4ZLPA 3EQ6A 4KHPC 3N54B 1HH2P 4JYAC 3R9XA 3I08A 5K85A 4OX9C 1IBMC 4U5YD 4JI8C 2UUCC 1T5DX 1O93A 2OBVA 4TPSB 4LF9C 3UZ0A 4JM1A 5GTDA 4DR7C 1YJ7A 4KTTA 2HJGA 2Y4OA 3G7SA 1WF3A 2UXCC 1ML8A 2VZEA 3NPDA 4L4QA 2QVXX 3TUFA 3ETCA 3GKUA 4LFCC 1AMUA 2D27A 4FTFA 3J7AD 3A4IA 1LCIA 3T1YC 2BH1X 3LGXA 2D28C 4BC7A 3TQIA 3H2TA 3A9VA 1MD9A 3TDEA 4DCUA 1USPA 1QWIA 3T1HC 5CZXA 5AE3A 1N34C 2QL8A 2Y27A 2AYAA 4D4IA 3J81D 1FUGA 1JOSA 2E5LC 1HR0C 4K0KC 2CY1A 5BSWA 4L7IA 4D4GA 4G37A 1EGAA 3LAXA 4PROC 5LMUC 4LF4C 1QM4A 4I9FA 3LNVA 5BSVA 2UUAC 4GS5A 2WP0C 5H9UA 3N2QA 1LQLA 3DAYA 4B3TC 3GR1A 2EGTA 4RLQA 4DUYC 2UXBC 4DR4C 4BC9A 1P7LA 1RY2A 5LMNC 1N32C 5BSRA 4RM2A 5BURA 2UU9C 1RG9A 4LFBC 3NYQA 4JI3C 4K0BA 4WV3A 4RLFA 5E7QA 4BBYA 1MXAA 1HNWC 2D1RA 4RM3A 2QW0X 2E8FA 1PG4A 3AF5A 3PESA 3VNRA 1PG3A 4JI0C 1ZB9A 4ISBA 4BSZA 4LF6C 1XRBA 5BR8C 5A19A 3R9WA 4DCSA 4JI2C 2YCBA 3A9UA 2Y4NA 1N2FA 2XR1A 4OXIA 5KYVA 1KKGA 2P20A 3IPLA 2ASBA 5KYTA 3PBKA 3PROC 5A1IA 4JI7C 3CJEA 4LFAC 3KXWA 1HNZC 3IEUA 4L2ZA 3OTOC 4PZPA 5ADZA 2UXDC 5BUQA 4NDNA 1ZB8A 3VNSA 3IMLA 4RVNA 4DG8A 5A1GA 4DV3C 5A2QD 4NXNC 1MDBA 2D1QA 3RV2A 1HNXC 3CW8X 4D56A 2F4VC 1XMOC 1ULTA 4I9GA 5CZVA 2VQFC 2ATWA 2YWBA 4EATA 4YY3C 4B3SC 1XNRC 3IEVA 3AF6A 2P2JA 2P02A 5KEIA 4DG9A 2ZM6C 5FLXD 1USPB 1O9TA 3FCEA 4ODJA 3DHVA 1WH9A 4JI6C 3L95X 1PA4A 2P2FA 5AE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DCV A;  4DR7 C;  1HNW C;  1IBL C;  2HJG A;  5IWA C;  4X64 C;  1WF3 A;  4MH4 A;  2UXC C;  1ML8 A;  3LUS A;  2E8F A;  3AF5 A;  4NOZ A;  4DR1 C;  3GKU A;  4LFC C;  4DV7 C;  4B3M C;  2E8E A;  4GKK C;  4AQY C;  4JI0 C;  1ZB9 A;  4BSZ A;  3J7A D;  2D7V A;  4LF6 C;  4DR6 C;  5BR8 C;  4DV5 C;  3R9W A;  3T1Y C;  4DCS A;  4JI2 C;  2CXC A;  2YCB A;  4DV0 C;  2DYJ A;  4YHH C;  4DV2 C;  1N2F A;  2XR1 A;  1KKG A;  4DCU A;  1USP A;  4JI5 C;  1QWI A;  3T1H C;  4DV1 C;  2VQE C;  2ASB A;  4GKJ C;  1N34 C;  2QL8 A;  4JI7 C;  4JI4 C;  1MKY A;  1K0R A;  1I94 C;  2E8C A;  3J81 D;  3CJE A;  4LFA C;  2JMP A;  4DCT A;  1HNZ C;  1JOS A;  2E5L C;  2PN2 A;  1HR0 C;  4K0K C;  2CY1 A;  3IEU A;  4X66 C;  1IBK C;  2UUB C;  4DV6 C;  3OTO C;  1EGA A;  2OPL A;  4MTN A;  4XX2 A;  3JAM D;  2UXD C;  1ZB8 A;  5LMU C;  1XMQ C;  4LF4 C;  4DV3 C;  2KZF A;  1XNQ C;  2UUA C;  5A2Q D;  2HHH C;  4LF5 C;  1VLA A;  2E7G A;  1N36 C;  5IT9 D;  4LF7 C;  4NXN C;  1L2F A;  1LQL A;  2OPL B;  3EER A;  4LF8 C;  2PT7 G;  4X62 C;  1HNX C;  4B3R C;  4B3T C;  2EGT A;  2F4V C;  1XMO C;  3J80 D;  4DR2 C;  4DUY C;  2VQF C;  2ATW A;  4DR3 C;  2UXB C;  4DR4 C;  1NYE A;  4YY3 C;  4DV4 C;  4NXM C;  1FJG C;  4B3S C;  4JI1 C;  1XNR C;  4DUZ C;  3IEV A;  2ONF A;  3I07 A;  4KHP C;  3AF6 A;  4JYA C;  1HH2 P;  2BJO A;  5LMN C;  1UKK A;  1N32 C;  2ZM6 C;  5FLX D;  4X65 C;  3R9X A;  1USP B;  2UU9 C;  4JV5 C;  4LFB C;  4JI3 C;  4OX9 C;  1IBM C;  4JI8 C;  1N33 C;  4DR5 C;  2UUC C;  1WH9 A;  4JI6 C;  1J5E C;  1PA4 A;  4LF9 C; 
#chains in the Genus database with same CATH topology
 2M5O A;  2MCQ A;  4R0M A;  1VEH A;  4MH4 A;  5AE2 A;  3LUS A;  2ZZM A;  4NOZ A;  4BCA A;  4DV7 C;  4B3M C;  4AQY C;  3FCC A;  5BSM A;  3GPC A;  1XRC A;  4DV5 C;  5BUS A;  3E7W A;  2CXC A;  4OYC A;  4DV0 C;  2DYJ A;  1UWD A;  4DV2 C;  3R44 A;  2DHM A;  4FUT A;  4DV1 C;  2VQE C;  3S82 A;  4JI4 C;  1MKY A;  3SO4 A;  2P2Q A;  2QVZ X;  3VNQ A;  4R1M A;  1O92 A;  3NYR A;  4X66 C;  1IBK C;  3C5E A;  2WD9 A;  4RVO A;  4MTN A;  1V60 A;  1V26 A;  2D1S A;  1XMQ C;  1XNQ C;  2ZZN A;  4LF5 C;  2E7G A;  1N36 C;  5IT9 D;  4PUH A;  2OPL B;  3EER A;  4X62 C;  4B3R C;  3L8C A;  5T8T A;  3J80 D;  4DR2 C;  1PU1 A;  5BST A;  3UOW A;  1NYE A;  4DV4 C;  4DUZ C;  5DV9 A;  2ONF A;  3I07 A;  2BJO A;  2NCL A;  1UKK A;  4X65 C;  2P2M A;  4ZJZ A;  2M5H A;  1FLO A;  4JV5 C;  1MDF A;  4IR7 A;  4G1I A;  5T8S A;  1N33 C;  4DR5 C;  1J5E C;  3ETO A;  2V7B A;  1MXB A;  1BA3 A;  4DCV A;  1IBL C;  5IWA C;  4X64 C;  4KTV A;  4GXR A;  4PHT A;  4RMN A;  3B7W A;  2E0G A;  3DLP X;  2P2B A;  1T5H X;  4HPV A;  2YWC A;  4DR1 C;  2E8E A;  4GKK C;  4LE5 A;  2D7V A;  3NI2 A;  4DR6 C;  3E7X A;  1XRA A;  4R1L A;  2OO4 A;  5K8F A;  5IFI A;  4YHH C;  1IB8 A;  4JI5 C;  4D57 A;  3RG2 A;  4GKJ C;  2MM9 A;  1K0R A;  3CW9 A;  2E8C A;  1I94 C;  5JRH A;  2D1T A;  2JMP A;  1O90 A;  4DCT A;  1P4E A;  2PN2 A;  4FUQ A;  1MXC A;  3GR0 A;  2UUB C;  4DV6 C;  4G36 A;  4IZ6 A;  2VSQ A;  3JAM D;  2OPL A;  4XX2 A;  2DPL A;  2PG1 E;  5BSU A;  2KZF A;  1GPM A;  2HHH C;  1VLA A;  4LF7 C;  2QVY X;  1L2F A;  4LF8 C;  2PT7 G;  1TH5 A;  4GXQ A;  3K6R A;  4DR3 C;  1XHJ A;  4WS9 A;  4NXM C;  1FJG C;  1V25 A;  4JI1 C;  2PRO A;  4ZLP A;  3EQ6 A;  4KHP C;  3N54 B;  1HH2 P;  4JYA C;  3R9X A;  3I08 A;  5K85 A;  2CU6 A;  4OX9 C;  1IBM C;  4U5Y D;  4JI8 C;  2UUC C;  1T5D X;  1O93 A;  2OBV A;  4TPS B;  4LF9 C;  3UZ0 A;  3AY0 A;  3CQ2 A;  4JM1 A;  5GTD A;  4DR7 C;  1YJ7 A;  4KTT A;  2HJG A;  2Y4O A;  3G7S A;  1WF3 A;  2UXC C;  1ML8 A;  2VZE A;  3NPD A;  4L4Q A;  2QVX X;  3TUF A;  3ETC A;  3GKU A;  4LFC C;  1AMU A;  2D27 A;  4FTF A;  3J7A D;  3A4I A;  1LCI A;  3T1Y C;  4PUI A;  2BH1 X;  3LGX A;  2D28 C;  4BC7 A;  3TQI A;  3H2T A;  3A9V A;  3TDE A;  1MD9 A;  4PUG A;  2MMA B;  4DCU A;  1USP A;  2ZTB A;  1QWI A;  2KDN A;  3T1H C;  5CZX A;  5AE3 A;  1N34 C;  1M6X C;  2QL8 A;  2Y27 A;  2Z51 A;  2AYA A;  4D4I A;  1XDX A;  3J81 D;  1FUG A;  1JOS A;  2E5L C;  1HR0 C;  4K0K C;  2CY1 A;  5BSW A;  4L7I A;  4D4G A;  4G37 A;  1EGA A;  3LAX A;  3LNO A;  4PRO C;  5LMU C;  4LF4 C;  1QM4 A;  4I9F A;  3LNV A;  3UX2 A;  5BSV A;  2UUA C;  4GS5 A;  2WP0 C;  5H9U A;  3A25 A;  3N2Q A;  1LQL A;  3DAY A;  4B3T C;  3GR1 A;  2EGT A;  4RLQ A;  4DUY C;  2UXB C;  4DR4 C;  4BC9 A;  1P7L A;  1YGT A;  1RY2 A;  5LMN C;  1N32 C;  5BSR A;  4RM2 A;  5BUR A;  2UU9 C;  1RG9 A;  4LFB C;  3NYQ A;  4JI3 C;  4K0B A;  3TR3 A;  4WV3 A;  4RLF A;  5E7Q A;  4BBY A;  1MXA A;  1HNW C;  2D1R A;  4RM3 A;  2QW0 X;  2E8F A;  2KZ0 A;  1PG4 A;  3AF5 A;  3O2E A;  3PES A;  3VNR A;  1PG3 A;  4JI0 C;  1ZB9 A;  4ISB A;  4BSZ A;  4LF6 C;  1XRB A;  3UX3 A;  5BR8 C;  5A19 A;  3R9W A;  4DCS A;  3FM7 A;  4JI2 C;  2YCB A;  3A9U A;  3A26 A;  2Y4N A;  1N2F A;  2XR1 A;  4OXI A;  5KYV A;  1XS3 A;  1KKG A;  2P20 A;  1P4E C;  3IPL A;  2ASB A;  5KYT A;  1WCJ A;  3PBK A;  3PRO C;  5A1I A;  4JI7 C;  3CJE A;  4LFA C;  3KXW A;  1HNZ C;  1NY8 A;  3IEU A;  4L2Z A;  3OTO C;  4PZP A;  5ADZ A;  3CQ3 A;  2UXD C;  5BUQ A;  4NDN A;  1ZB8 A;  3VNS A;  3IML A;  4RVN A;  4DG8 A;  5A1G A;  4DV3 C;  3CQ1 A;  5A2Q D;  4NXN C;  1MDB A;  2D1Q A;  3RV2 A;  1HNX C;  3CW8 X;  4D56 A;  2F4V C;  1XMO C;  1ULT A;  1M6X A;  4I9G A;  5CZV A;  2VQF C;  2ATW A;  2YWB A;  4EAT A;  3UEB A;  4YY3 C;  4B3S C;  1XNR C;  3IEV A;  3AF6 A;  2P2J A;  2P02 A;  5KEI A;  4DG9 A;  2ZM6 C;  5FLX D;  2JNV A;  5LCI A;  1USP B;  1O9T A;  3FCE A;  4ODJ A;  3DHV A;  1WH9 A;  3L95 X;  4JI6 C;  1PA4 A;  2YX1 A;  2P2F A;  5AE1 A; 
#chains in the Genus database with same CATH homology
 4R0M A;  4MH4 A;  5AE2 A;  3LUS A;  4NOZ A;  4BCA A;  4DV7 C;  4B3M C;  4AQY C;  3FCC A;  5BSM A;  3GPC A;  1XRC A;  4DV5 C;  5BUS A;  3E7W A;  2CXC A;  4OYC A;  4DV0 C;  2DYJ A;  4DV2 C;  3R44 A;  4FUT A;  4DV1 C;  2VQE C;  3S82 A;  4JI4 C;  1MKY A;  3SO4 A;  2P2Q A;  2QVZ X;  3VNQ A;  4R1M A;  1O92 A;  3NYR A;  4X66 C;  1IBK C;  3C5E A;  2WD9 A;  4RVO A;  4MTN A;  1V26 A;  2D1S A;  1XMQ C;  1XNQ C;  4LF5 C;  2E7G A;  1N36 C;  5IT9 D;  2OPL B;  3EER A;  4X62 C;  4B3R C;  3L8C A;  5T8T A;  3J80 D;  4DR2 C;  5BST A;  3UOW A;  1NYE A;  4DV4 C;  4DUZ C;  5DV9 A;  2ONF A;  3I07 A;  2BJO A;  1UKK A;  4X65 C;  2P2M A;  4ZJZ A;  4JV5 C;  1MDF A;  4IR7 A;  4G1I A;  5T8S A;  1N33 C;  4DR5 C;  1J5E C;  3ETO A;  2V7B A;  1MXB A;  1BA3 A;  4DCV A;  1IBL C;  5IWA C;  4X64 C;  4KTV A;  4GXR A;  4PHT A;  4RMN A;  3B7W A;  2E0G A;  3DLP X;  2P2B A;  1T5H X;  4HPV A;  2YWC A;  4DR1 C;  2E8E A;  4GKK C;  4LE5 A;  2D7V A;  3NI2 A;  4DR6 C;  3E7X A;  1XRA A;  4R1L A;  2OO4 A;  5K8F A;  5IFI A;  4YHH C;  4JI5 C;  4D57 A;  3RG2 A;  4GKJ C;  1K0R A;  3CW9 A;  2E8C A;  1I94 C;  5JRH A;  2D1T A;  2JMP A;  1O90 A;  4DCT A;  2PN2 A;  4FUQ A;  1MXC A;  3GR0 A;  2UUB C;  4DV6 C;  4G36 A;  4IZ6 A;  2VSQ A;  2OPL A;  4XX2 A;  3JAM D;  2DPL A;  5BSU A;  2KZF A;  1GPM A;  2HHH C;  1VLA A;  4LF7 C;  2QVY X;  1L2F A;  4LF8 C;  2PT7 G;  4GXQ A;  4DR3 C;  4WS9 A;  4NXM C;  1FJG C;  1V25 A;  4JI1 C;  2PRO A;  4ZLP A;  3EQ6 A;  4KHP C;  3N54 B;  1HH2 P;  4JYA C;  3R9X A;  3I08 A;  5K85 A;  4OX9 C;  1IBM C;  4U5Y D;  4JI8 C;  2UUC C;  1T5D X;  1O93 A;  2OBV A;  4TPS B;  4LF9 C;  3UZ0 A;  4JM1 A;  5GTD A;  4DR7 C;  1YJ7 A;  4KTT A;  2HJG A;  2Y4O A;  3G7S A;  1WF3 A;  2UXC C;  1ML8 A;  2VZE A;  3NPD A;  4L4Q A;  2QVX X;  3TUF A;  3ETC A;  3GKU A;  4LFC C;  1AMU A;  2D27 A;  4FTF A;  3J7A D;  3A4I A;  1LCI A;  3T1Y C;  2BH1 X;  3LGX A;  2D28 C;  4BC7 A;  3TQI A;  3H2T A;  3A9V A;  1MD9 A;  3TDE A;  4DCU A;  1USP A;  1QWI A;  3T1H C;  5CZX A;  5AE3 A;  1N34 C;  2QL8 A;  2Y27 A;  2AYA A;  4D4I A;  3J81 D;  1FUG A;  1JOS A;  2E5L C;  1HR0 C;  4K0K C;  2CY1 A;  5BSW A;  4L7I A;  4D4G A;  4G37 A;  1EGA A;  3LAX A;  4PRO C;  5LMU C;  4LF4 C;  1QM4 A;  4I9F A;  3LNV A;  5BSV A;  2UUA C;  4GS5 A;  2WP0 C;  5H9U A;  3N2Q A;  1LQL A;  3DAY A;  4B3T C;  3GR1 A;  2EGT A;  4RLQ A;  4DUY C;  2UXB C;  4DR4 C;  4BC9 A;  1P7L A;  1RY2 A;  5LMN C;  1N32 C;  5BSR A;  4RM2 A;  5BUR A;  2UU9 C;  1RG9 A;  4LFB C;  3NYQ A;  4JI3 C;  4K0B A;  4WV3 A;  4RLF A;  5E7Q A;  4BBY A;  1MXA A;  1HNW C;  2D1R A;  4RM3 A;  2QW0 X;  2E8F A;  1PG4 A;  3AF5 A;  3PES A;  3VNR A;  1PG3 A;  4JI0 C;  1ZB9 A;  4ISB A;  4BSZ A;  4LF6 C;  1XRB A;  5BR8 C;  5A19 A;  3R9W A;  4DCS A;  4JI2 C;  2YCB A;  3A9U A;  2Y4N A;  1N2F A;  2XR1 A;  4OXI A;  5KYV A;  1KKG A;  2P20 A;  3IPL A;  2ASB A;  5KYT A;  3PBK A;  3PRO C;  5A1I A;  4JI7 C;  3CJE A;  4LFA C;  3KXW A;  1HNZ C;  3IEU A;  4L2Z A;  3OTO C;  4PZP A;  5ADZ A;  2UXD C;  5BUQ A;  4NDN A;  1ZB8 A;  3VNS A;  3IML A;  4RVN A;  4DG8 A;  5A1G A;  4DV3 C;  5A2Q D;  4NXN C;  1MDB A;  2D1Q A;  3RV2 A;  1HNX C;  3CW8 X;  4D56 A;  2F4V C;  1XMO C;  1ULT A;  4I9G A;  5CZV A;  2VQF C;  2ATW A;  2YWB A;  4EAT A;  4YY3 C;  4B3S C;  1XNR C;  3IEV A;  3AF6 A;  2P2J A;  2P02 A;  5KEI A;  4DG9 A;  2ZM6 C;  5FLX D;  1USP B;  1O9T A;  3FCE A;  4ODJ A;  3DHV A;  1WH9 A;  4JI6 C;  3L95 X;  1PA4 A;  2P2F A;  5AE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...