5IT9D

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
223
structure length
223
Chain Sequence
AIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRATKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHSGQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKALPDAVTIIEPKEEEPVLEPSVKDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 45
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
D PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5it9D01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5it9D02
1LQLA 4DR3C 1UKKA 2HJGA 4JI3C 1WH9A 4JI0C 4GKJC 5IWAC 2YCBA 2KZFA 4DCUA 3IEVA 2E8CA 3EERA 2OPLA 1QWIA 4DCSA 1HNXC 1HNWC 1VLAA 2CY1A 4YY3C 4LFCC 4LF8C 4JI8C 1PA4A 2E7GA 2E8EA 4OX9C 4K0KC 4JYAC 4X66C 4B3TC 4DV4C 1I94C 4JI2C 3I07A 2F4VC 4YHHC 4JI5C 3R9XA 4X64C 2VQEC 5LMNC 1HR0C 2E5LC 1J5EC 4NOZA 4LFBC 4MTNA 2VQFC 2UUBC 4LF5C 5LMUC 2UXCC 4DV6C 4GKKC 1JOSA 4DV2C 4X65C 4JI1C 3CJEA 4DV3C 1NYEA 2XR1A 3T1YC 1N34C 1N33C 4DV0C 2UUAC 1USPB 4JI4C 4JI7C 1EGAA 4B3MC 2CXCA 4MH4A 3R9WA 3J7AD 1L2FA 5FLXD 4LF4C 1KKGA 2OPLB 4LF7C 4DCTA 3JAMD 5BR8C 3OTOC 4LFAC 3AF5A 4DUZC 5A2QD 4DR5C 2UUCC 1XMQC 2ZM6C 2DYJA 2EGTA 1IBKC 4LF9C 4DV7C 5IT9D 4DR6C 3IEUA 4LF6C 4DR2C 2E8FA 2PT7G 1N32C 1N36C 1XNRC 1ML8A 1ZB9A 1USPA 4BSZA 4B3SC 4NXNC 4JV5C 4DV1C 2HHHC 2UXBC 2JMPA 4KHPC 1HH2P 4X62C 4B3RC 4DCVA 2ONFA 1IBLC 2D7VA 3J81D 2QL8A 2UXDC 1MKYA 4NXMC 2PN2A 1HNZC 3AF6A 1XMOC 3T1HC 4DR7C 2ATWA 4DV5C 3LUSA 4XX2A 2UU9C 1K0RA 1ZB8A 4JI6C 4DUYC 4DR4C 4AQYC 1XNQC 4DR1C 3GKUA 1FJGC 1N2FA 3J80D 1IBMC 1WF3A 2ASBA 2BJOA
chains in the Genus database with same CATH superfamily
1LQLA 4DR3C 4JI3C 4L4QA 2WP0C 5IWAC 2KZFA 2E8CA 3CW8X 3TUFA 1VLAA 4R1LA 4LFCC 5GTDA 4G1IA 4IZ6A 1PA4A 3DAYA 4JYAC 3GR1A 5AE2A 2JNVA 2D1RA 4IR7A 3I07A 4NDNA 3R9XA 3ETCA 2E5LC 1XRBA 4MTNA 2VQFC 2UUBC 4LF5C 2MMAB 4DV6C 1QM4A 4DV2C 5BUSA 2KZ0A 2XR1A 3CW9A 4DV3C 3T1YC 2ZZMA 3UX3A 5A1GA 1USPB 4I9GA 4TPSB 1MXBA 3A26A 3TDEA 1L2FA 4BC9A 4WV3A 3RV2A 4DG8A 3DHVA 2PROA 3JAMD 5BR8C 1BA3A 3LGXA 4DUZC 1PG4A 1XMQC 2ZM6C 1V26A 2Y4OA 4DR6C 2KDNA 4DR2C 2E8FA 4WS9A 3N2QA 1XNRC 1ZB9A 1USPA 2DHMA 4PZPA 4BSZA 4JV5C 2CU6A 2JMPA 4KHPC 2Y4NA 3A25A 1IBLC 1FUGA 3J81D 2QL8A 1O93A 4NXMC 2ATWA 5BSMA 1RG9A 1K0RA 4BC7A 4JI6C 3J80D 2P20A 4JI0C 3LNOA 2YCBA 3IEVA 5BUQA 1V25A 3CQ3A 4U5YD 3UEBA 5BSUA 5KEIA 2CY1A 1T5DX 5CZXA 1V60A 3AY0A 2E7GA 4ZLPA 4X66C 4I9FA 1I94C 4JI2C 4RVOA 3EQ6A 3PESA 4KTTA 2F4VC 4YHHC 4RLFA 1J5EC 3H2TA 4LFBC 4G36A 4ZJZA 1P4EA 4PUGA 2E0GA 3PBKA 1XDXA 5AE3A 1N33C 1T5HX 2V7BA 4JI4C 4D4IA 4JI7C 2CXCA 5LCIA 1NY8A 3R9WA 5AE1A 3ETOA 2WD9A 5CZVA 4LF4C 1AMUA 4R0MA 3S82A 1KKGA 4LE5A 4DCTA 2VZEA 3FCCA 3UZ0A 5KYTA 2DYJA 2EGTA 1LCIA 4HPVA 4LF9C 2M5HA 3FCEA 2YX1A 2ZTBA 4LF6C 3GPCA 1N36C 2AYAA 1TH5A 3LAXA 3B7WA 4DR7C 2YWBA 4DV5C 2Y27A 2UU9C 2M5OA 4DUYC 3A4IA 4AQYC 1XNQC 3GKUA 1N2FA 2D27A 1FLOA 1WH9A 1UWDA 4DCUA 1M6XA 5A1IA 2OPLA 4DCSA 1HNXC 1YJ7A 3L95X 5T8TA 3R44A 4FUTA 4JI8C 1MXCA 2P2MA 4ISBA 4RVNA 3VNSA 1XS3A 4JI5C 1PU1A 4X64C 5LMNC 1HR0C 4NOZA 4OXIA 4GKKC 1JOSA 1WCJA 4JI1C 3I08A 1ULTA 1N34C 4DV0C 3CQ1A 3L8CA 4PUIA 3E7WA 2UUAC 3NYQA 1RY2A 5DV9A 1EGAA 3KXWA 4B3MC 2YWCA 3G7SA 4D56A 2P2JA 2MCQA 1GPMA 2OPLB 4LFAC 4FTFA 1VEHA 4RM2A 1P4EC 2UUCC 3FM7A 1XHJA 3CQ2A 4L2ZA 5KYVA 2ZZNA 4DV7C 3IMLA 1MD9A 3E7XA 3IEUA 4DG9A 2PT7G 1N32C 1ML8A 3NI2A 1O92A 4NXNC 2DPLA 4DV1C 2UXBC 4RM3A 4X62C 4B3RC 4DCVA 2ONFA 5BSTA 3VNRA 2UXDC 5E7QA 4PHTA 1MKYA 3UOWA 1HNZC 3AF6A 1XMOC 3LUSA 1MXAA 2P2BA 1YGTA 1ZB8A 4DR4C 5K8FA 4BCAA 4DR1C 1P7LA 2QVYX 4D4GA 3K6RA 2P02A 2ASBA 2BJOA 1PG3A 1MDFA 1UKKA 2HJGA 3DLPX 4GKJC 3O2EA 3NPDA 3A9VA 4FUQA 3EERA 1QWIA 1HNWC 4YY3C 4LF8C 5H9UA 2E8EA 4OX9C 4K0KC 4ODJA 4B3TC 1MDBA 4DV4C 2D28C 2QW0X 3SO4A 2QVXX 5BURA 2Z51A 2VQEC 3PROC 4OYCA 1O90A 3NYRA 2P2FA 3LNVA 5LMUC 2UXCC 4X65C 4GS5A 3CJEA 4GXRA 1NYEA 4PUHA 2NCLA 4JM1A 4GXQA 2OO4A 1XRAA 3A9UA 2PG1E 4MH4A 1M6XC 4K0BA 1IB8A 3J7AD 5FLXD 4D57A 3TR3A 3UX2A 5K85A 5A19A 4LF7C 3OTOC 2D1QA 3AF5A 5A2QD 2D1TA 4DR5C 1IBKC 5BSRA 5IT9D 1O9TA 5T8SA 2BH1X 4G37A 1XRCA 5BSWA 2QVZX 5ADZA 4B3SC 5JRHA 2D1SA 2MM9A 5BSVA 2HHHC 1HH2P 2VSQA 3N54B 4KTVA 2D7VA 3VNQA 4PROC 2PN2A 3TQIA 3T1HC 4BBYA 4XX2A 5IFIA 2OBVA 4L7IA 4R1MA 3C5EA 2P2QA 4EATA 3IPLA 1FJGC 4RMNA 3RG2A 1IBMC 3GR0A 1WF3A 4RLQA
chains in the Genus database with same CATH topology
1LQLA 4DR3C 4JI3C 4L4QA 2WP0C 5IWAC 2KZFA 2E8CA 3CW8X 3TUFA 1VLAA 4R1LA 4LFCC 5GTDA 4G1IA 4IZ6A 1PA4A 3DAYA 4JYAC 3GR1A 5AE2A 2D1RA 4IR7A 3I07A 4NDNA 3R9XA 3ETCA 2E5LC 1XRBA 4MTNA 2VQFC 2UUBC 4LF5C 4DV6C 1QM4A 4DV2C 5BUSA 4DV3C 2XR1A 3CW9A 3T1YC 5A1GA 1USPB 4I9GA 4TPSB 1MXBA 3TDEA 1L2FA 4BC9A 4WV3A 3RV2A 4DG8A 3DHVA 2PROA 3JAMD 5BR8C 1BA3A 3LGXA 4DUZC 1PG4A 1XMQC 2ZM6C 1V26A 2Y4OA 4DR6C 4DR2C 2E8FA 4WS9A 3N2QA 1XNRC 1ZB9A 1USPA 4PZPA 4BSZA 4JV5C 2JMPA 4KHPC 2Y4NA 1IBLC 1FUGA 3J81D 2QL8A 1O93A 4NXMC 2ATWA 5BSMA 1RG9A 1K0RA 4BC7A 4JI6C 3J80D 2P20A 4JI0C 2YCBA 3IEVA 5BUQA 1V25A 4U5YD 5BSUA 5KEIA 2CY1A 1T5DX 5CZXA 4ZLPA 2E7GA 4X66C 4I9FA 1I94C 4JI2C 4RVOA 3EQ6A 3PESA 4KTTA 2F4VC 4YHHC 4RLFA 1J5EC 3H2TA 4LFBC 4G36A 4ZJZA 2E0GA 3PBKA 5AE3A 1N33C 1T5HX 2V7BA 4JI4C 4D4IA 4JI7C 2CXCA 3R9WA 5AE1A 3ETOA 2WD9A 5CZVA 4LF4C 1AMUA 4R0MA 3S82A 1KKGA 4LE5A 4DCTA 2VZEA 3FCCA 3UZ0A 5KYTA 2DYJA 2EGTA 1LCIA 4HPVA 4LF9C 3FCEA 4LF6C 3GPCA 1N36C 2AYAA 3LAXA 3B7WA 4DR7C 2YWBA 4DV5C 2Y27A 2UU9C 4DUYC 3A4IA 4AQYC 1XNQC 3GKUA 1N2FA 2D27A 1WH9A 4DCUA 5A1IA 2OPLA 4DCSA 1HNXC 1YJ7A 3L95X 5T8TA 3R44A 4FUTA 4JI8C 1MXCA 2P2MA 4ISBA 4RVNA 3VNSA 4JI5C 4X64C 5LMNC 1HR0C 4NOZA 4OXIA 4GKKC 1JOSA 4JI1C 3I08A 1ULTA 1N34C 4DV0C 3L8CA 3E7WA 2UUAC 3NYQA 1RY2A 5DV9A 1EGAA 3KXWA 4B3MC 2YWCA 3G7SA 4D56A 2P2JA 1GPMA 2OPLB 4LFAC 4FTFA 4RM2A 2UUCC 4L2ZA 5KYVA 4DV7C 3IMLA 1MD9A 3E7XA 3IEUA 4DG9A 2PT7G 1N32C 1ML8A 3NI2A 1O92A 4NXNC 2DPLA 4DV1C 2UXBC 4RM3A 4X62C 4B3RC 4DCVA 2ONFA 5BSTA 3VNRA 2UXDC 5E7QA 4PHTA 1MKYA 3UOWA 1HNZC 3AF6A 1XMOC 3LUSA 1MXAA 2P2BA 1ZB8A 4DR4C 5K8FA 4BCAA 4DR1C 1P7LA 2QVYX 4D4GA 2P02A 2ASBA 2BJOA 1PG3A 1MDFA 1UKKA 2HJGA 3DLPX 4GKJC 3NPDA 3A9VA 4FUQA 3EERA 1QWIA 1HNWC 4YY3C 4LF8C 5H9UA 2E8EA 4OX9C 4K0KC 4ODJA 4B3TC 1MDBA 4DV4C 2D28C 2QW0X 3SO4A 2QVXX 5BURA 2VQEC 3PROC 4OYCA 1O90A 3NYRA 2P2FA 3LNVA 5LMUC 2UXCC 4X65C 4GS5A 3CJEA 4GXRA 1NYEA 4JM1A 4GXQA 2OO4A 1XRAA 3A9UA 4MH4A 4K0BA 3J7AD 5FLXD 4D57A 5K85A 5A19A 4LF7C 3OTOC 2D1QA 3AF5A 5A2QD 2D1TA 4DR5C 1IBKC 5BSRA 5IT9D 1O9TA 5T8SA 2BH1X 4G37A 1XRCA 5BSWA 2QVZX 5ADZA 4B3SC 5JRHA 2D1SA 5BSVA 2HHHC 1HH2P 2VSQA 3N54B 4KTVA 2D7VA 3VNQA 4PROC 2PN2A 3TQIA 3T1HC 4BBYA 4XX2A 5IFIA 2OBVA 4L7IA 4R1MA 3C5EA 2P2QA 4EATA 3IPLA 1FJGC 4RMNA 3RG2A 1IBMC 3GR0A 1WF3A 4RLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQL A;  4DR3 C;  1UKK A;  2HJG A;  4JI3 C;  1WH9 A;  4JI0 C;  4GKJ C;  5IWA C;  2YCB A;  2KZF A;  4DCU A;  3IEV A;  2E8C A;  3EER A;  2OPL A;  1QWI A;  4DCS A;  1HNX C;  1HNW C;  1VLA A;  2CY1 A;  4YY3 C;  4LFC C;  4LF8 C;  4JI8 C;  1PA4 A;  2E7G A;  2E8E A;  4OX9 C;  4K0K C;  4JYA C;  4X66 C;  4B3T C;  4DV4 C;  1I94 C;  4JI2 C;  3I07 A;  2F4V C;  4YHH C;  4JI5 C;  3R9X A;  4X64 C;  2VQE C;  5LMN C;  1HR0 C;  2E5L C;  1J5E C;  4NOZ A;  4LFB C;  4MTN A;  2VQF C;  2UUB C;  4LF5 C;  5LMU C;  2UXC C;  4DV6 C;  4GKK C;  1JOS A;  4DV2 C;  4X65 C;  4JI1 C;  3CJE A;  4DV3 C;  1NYE A;  2XR1 A;  3T1Y C;  1N34 C;  1N33 C;  4DV0 C;  2UUA C;  1USP B;  4JI4 C;  4JI7 C;  1EGA A;  4B3M C;  2CXC A;  4MH4 A;  3R9W A;  3J7A D;  1L2F A;  5FLX D;  4LF4 C;  1KKG A;  2OPL B;  4LF7 C;  4DCT A;  3JAM D;  5BR8 C;  3OTO C;  4LFA C;  3AF5 A;  4DUZ C;  5A2Q D;  4DR5 C;  2UUC C;  1XMQ C;  2ZM6 C;  2DYJ A;  2EGT A;  1IBK C;  4LF9 C;  4DV7 C;  5IT9 D;  4DR6 C;  3IEU A;  4LF6 C;  4DR2 C;  2E8F A;  2PT7 G;  1N32 C;  1N36 C;  1XNR C;  1ML8 A;  1ZB9 A;  1USP A;  4BSZ A;  4B3S C;  4NXN C;  4JV5 C;  4DV1 C;  2HHH C;  2UXB C;  2JMP A;  4KHP C;  1HH2 P;  4X62 C;  4B3R C;  4DCV A;  2ONF A;  1IBL C;  2D7V A;  3J81 D;  2QL8 A;  2UXD C;  1MKY A;  4NXM C;  2PN2 A;  1HNZ C;  3AF6 A;  1XMO C;  3T1H C;  4DR7 C;  2ATW A;  4DV5 C;  3LUS A;  4XX2 A;  2UU9 C;  1K0R A;  1ZB8 A;  4JI6 C;  4DUY C;  4DR4 C;  4AQY C;  1XNQ C;  4DR1 C;  3GKU A;  1FJG C;  1N2F A;  3J80 D;  1IBM C;  1WF3 A;  2ASB A;  2BJO A; 
#chains in the Genus database with same CATH topology
 1LQL A;  4DR3 C;  4JI3 C;  4L4Q A;  2WP0 C;  5IWA C;  2KZF A;  2E8C A;  3CW8 X;  3TUF A;  1VLA A;  4R1L A;  4LFC C;  5GTD A;  4G1I A;  4IZ6 A;  1PA4 A;  3DAY A;  4JYA C;  3GR1 A;  5AE2 A;  2JNV A;  2D1R A;  4IR7 A;  3I07 A;  4NDN A;  3R9X A;  3ETC A;  2E5L C;  1XRB A;  4MTN A;  2VQF C;  2UUB C;  4LF5 C;  2MMA B;  4DV6 C;  1QM4 A;  4DV2 C;  5BUS A;  2KZ0 A;  2XR1 A;  3CW9 A;  4DV3 C;  3T1Y C;  2ZZM A;  3UX3 A;  5A1G A;  1USP B;  4I9G A;  4TPS B;  1MXB A;  3A26 A;  3TDE A;  1L2F A;  4BC9 A;  4WV3 A;  3RV2 A;  4DG8 A;  3DHV A;  2PRO A;  3JAM D;  5BR8 C;  1BA3 A;  3LGX A;  4DUZ C;  1PG4 A;  1XMQ C;  2ZM6 C;  1V26 A;  2Y4O A;  4DR6 C;  2KDN A;  4DR2 C;  2E8F A;  4WS9 A;  3N2Q A;  1XNR C;  1ZB9 A;  1USP A;  2DHM A;  4PZP A;  4BSZ A;  4JV5 C;  2CU6 A;  2JMP A;  4KHP C;  2Y4N A;  3A25 A;  1IBL C;  1FUG A;  3J81 D;  2QL8 A;  1O93 A;  4NXM C;  2ATW A;  5BSM A;  1RG9 A;  1K0R A;  4BC7 A;  4JI6 C;  3J80 D;  2P20 A;  4JI0 C;  3LNO A;  2YCB A;  3IEV A;  5BUQ A;  1V25 A;  3CQ3 A;  4U5Y D;  3UEB A;  5BSU A;  5KEI A;  2CY1 A;  1T5D X;  5CZX A;  1V60 A;  3AY0 A;  2E7G A;  4ZLP A;  4X66 C;  4I9F A;  1I94 C;  4JI2 C;  4RVO A;  3EQ6 A;  3PES A;  4KTT A;  2F4V C;  4YHH C;  4RLF A;  1J5E C;  3H2T A;  4LFB C;  4G36 A;  4ZJZ A;  1P4E A;  4PUG A;  2E0G A;  3PBK A;  1XDX A;  5AE3 A;  1N33 C;  1T5H X;  2V7B A;  4JI4 C;  4D4I A;  4JI7 C;  2CXC A;  5LCI A;  1NY8 A;  3R9W A;  5AE1 A;  3ETO A;  2WD9 A;  5CZV A;  4LF4 C;  1AMU A;  4R0M A;  3S82 A;  1KKG A;  4LE5 A;  4DCT A;  2VZE A;  3FCC A;  3UZ0 A;  5KYT A;  2DYJ A;  2EGT A;  1LCI A;  4HPV A;  4LF9 C;  2M5H A;  3FCE A;  2YX1 A;  2ZTB A;  4LF6 C;  3GPC A;  1N36 C;  2AYA A;  1TH5 A;  3LAX A;  3B7W A;  4DR7 C;  2YWB A;  4DV5 C;  2Y27 A;  2UU9 C;  2M5O A;  4DUY C;  3A4I A;  4AQY C;  1XNQ C;  3GKU A;  1N2F A;  2D27 A;  1FLO A;  1WH9 A;  1UWD A;  4DCU A;  1M6X A;  5A1I A;  2OPL A;  4DCS A;  1HNX C;  1YJ7 A;  3L95 X;  5T8T A;  3R44 A;  4FUT A;  4JI8 C;  1MXC A;  2P2M A;  4ISB A;  4RVN A;  3VNS A;  1XS3 A;  4JI5 C;  1PU1 A;  4X64 C;  5LMN C;  1HR0 C;  4NOZ A;  4OXI A;  4GKK C;  1JOS A;  1WCJ A;  4JI1 C;  3I08 A;  1ULT A;  1N34 C;  4DV0 C;  3CQ1 A;  3L8C A;  4PUI A;  3E7W A;  2UUA C;  3NYQ A;  1RY2 A;  5DV9 A;  1EGA A;  3KXW A;  4B3M C;  2YWC A;  3G7S A;  4D56 A;  2P2J A;  2MCQ A;  1GPM A;  2OPL B;  4LFA C;  4FTF A;  1VEH A;  4RM2 A;  1P4E C;  2UUC C;  3FM7 A;  1XHJ A;  3CQ2 A;  4L2Z A;  5KYV A;  2ZZN A;  4DV7 C;  3IML A;  1MD9 A;  3E7X A;  3IEU A;  4DG9 A;  2PT7 G;  1N32 C;  1ML8 A;  3NI2 A;  1O92 A;  4NXN C;  2DPL A;  4DV1 C;  2UXB C;  4RM3 A;  4X62 C;  4B3R C;  4DCV A;  2ONF A;  5BST A;  3VNR A;  2UXD C;  5E7Q A;  4PHT A;  1MKY A;  3UOW A;  1HNZ C;  3AF6 A;  1XMO C;  3LUS A;  1MXA A;  2P2B A;  1YGT A;  1ZB8 A;  4DR4 C;  5K8F A;  4BCA A;  4DR1 C;  1P7L A;  2QVY X;  4D4G A;  3K6R A;  2P02 A;  2ASB A;  2BJO A;  1PG3 A;  1MDF A;  1UKK A;  2HJG A;  3DLP X;  4GKJ C;  3O2E A;  3NPD A;  3A9V A;  4FUQ A;  3EER A;  1QWI A;  1HNW C;  4YY3 C;  4LF8 C;  5H9U A;  2E8E A;  4OX9 C;  4K0K C;  4ODJ A;  4B3T C;  1MDB A;  4DV4 C;  2D28 C;  2QW0 X;  3SO4 A;  2QVX X;  5BUR A;  2Z51 A;  2VQE C;  3PRO C;  4OYC A;  1O90 A;  3NYR A;  2P2F A;  3LNV A;  5LMU C;  2UXC C;  4X65 C;  4GS5 A;  3CJE A;  4GXR A;  1NYE A;  4PUH A;  2NCL A;  4JM1 A;  4GXQ A;  2OO4 A;  1XRA A;  3A9U A;  2PG1 E;  4MH4 A;  1M6X C;  4K0B A;  1IB8 A;  3J7A D;  5FLX D;  4D57 A;  3TR3 A;  3UX2 A;  5K85 A;  5A19 A;  4LF7 C;  3OTO C;  2D1Q A;  3AF5 A;  5A2Q D;  2D1T A;  4DR5 C;  1IBK C;  5BSR A;  5IT9 D;  1O9T A;  5T8S A;  2BH1 X;  4G37 A;  1XRC A;  5BSW A;  2QVZ X;  5ADZ A;  4B3S C;  5JRH A;  2D1S A;  2MM9 A;  5BSV A;  2HHH C;  1HH2 P;  2VSQ A;  3N54 B;  4KTV A;  2D7V A;  3VNQ A;  4PRO C;  2PN2 A;  3TQI A;  3T1H C;  4BBY A;  4XX2 A;  5IFI A;  2OBV A;  4L7I A;  4R1M A;  3C5E A;  2P2Q A;  4EAT A;  3IPL A;  1FJG C;  4RMN A;  3RG2 A;  1IBM C;  3GR0 A;  1WF3 A;  4RLQ A; 
#chains in the Genus database with same CATH homology
 1LQL A;  4DR3 C;  4JI3 C;  4L4Q A;  2WP0 C;  5IWA C;  2KZF A;  2E8C A;  3CW8 X;  3TUF A;  1VLA A;  4R1L A;  4LFC C;  5GTD A;  4G1I A;  4IZ6 A;  1PA4 A;  3DAY A;  4JYA C;  3GR1 A;  5AE2 A;  2D1R A;  4IR7 A;  3I07 A;  4NDN A;  3R9X A;  3ETC A;  2E5L C;  1XRB A;  4MTN A;  2VQF C;  2UUB C;  4LF5 C;  4DV6 C;  1QM4 A;  4DV2 C;  5BUS A;  4DV3 C;  2XR1 A;  3CW9 A;  3T1Y C;  5A1G A;  1USP B;  4I9G A;  4TPS B;  1MXB A;  3TDE A;  1L2F A;  4BC9 A;  4WV3 A;  3RV2 A;  4DG8 A;  3DHV A;  2PRO A;  3JAM D;  5BR8 C;  1BA3 A;  3LGX A;  4DUZ C;  1PG4 A;  1XMQ C;  2ZM6 C;  1V26 A;  2Y4O A;  4DR6 C;  4DR2 C;  2E8F A;  4WS9 A;  3N2Q A;  1XNR C;  1ZB9 A;  1USP A;  4PZP A;  4BSZ A;  4JV5 C;  2JMP A;  4KHP C;  2Y4N A;  1IBL C;  1FUG A;  3J81 D;  2QL8 A;  1O93 A;  4NXM C;  2ATW A;  5BSM A;  1RG9 A;  1K0R A;  4BC7 A;  4JI6 C;  3J80 D;  2P20 A;  4JI0 C;  2YCB A;  3IEV A;  5BUQ A;  1V25 A;  4U5Y D;  5BSU A;  5KEI A;  2CY1 A;  1T5D X;  5CZX A;  4ZLP A;  2E7G A;  4X66 C;  4I9F A;  1I94 C;  4JI2 C;  4RVO A;  3EQ6 A;  3PES A;  4KTT A;  2F4V C;  4YHH C;  4RLF A;  1J5E C;  3H2T A;  4LFB C;  4G36 A;  4ZJZ A;  2E0G A;  3PBK A;  5AE3 A;  1N33 C;  1T5H X;  2V7B A;  4JI4 C;  4D4I A;  4JI7 C;  2CXC A;  3R9W A;  5AE1 A;  3ETO A;  2WD9 A;  5CZV A;  4LF4 C;  1AMU A;  4R0M A;  3S82 A;  1KKG A;  4LE5 A;  4DCT A;  2VZE A;  3FCC A;  3UZ0 A;  5KYT A;  2DYJ A;  2EGT A;  1LCI A;  4HPV A;  4LF9 C;  3FCE A;  4LF6 C;  3GPC A;  1N36 C;  2AYA A;  3LAX A;  3B7W A;  4DR7 C;  2YWB A;  4DV5 C;  2Y27 A;  2UU9 C;  4DUY C;  3A4I A;  4AQY C;  1XNQ C;  3GKU A;  1N2F A;  2D27 A;  1WH9 A;  4DCU A;  5A1I A;  2OPL A;  4DCS A;  1HNX C;  1YJ7 A;  3L95 X;  5T8T A;  3R44 A;  4FUT A;  4JI8 C;  1MXC A;  2P2M A;  4ISB A;  4RVN A;  3VNS A;  4JI5 C;  4X64 C;  5LMN C;  1HR0 C;  4NOZ A;  4OXI A;  4GKK C;  1JOS A;  4JI1 C;  3I08 A;  1ULT A;  1N34 C;  4DV0 C;  3L8C A;  3E7W A;  2UUA C;  3NYQ A;  1RY2 A;  5DV9 A;  1EGA A;  3KXW A;  4B3M C;  2YWC A;  3G7S A;  4D56 A;  2P2J A;  1GPM A;  2OPL B;  4LFA C;  4FTF A;  4RM2 A;  2UUC C;  4L2Z A;  5KYV A;  4DV7 C;  3IML A;  1MD9 A;  3E7X A;  3IEU A;  4DG9 A;  2PT7 G;  1N32 C;  1ML8 A;  3NI2 A;  1O92 A;  4NXN C;  2DPL A;  4DV1 C;  2UXB C;  4RM3 A;  4X62 C;  4B3R C;  4DCV A;  2ONF A;  5BST A;  3VNR A;  2UXD C;  5E7Q A;  4PHT A;  1MKY A;  3UOW A;  1HNZ C;  3AF6 A;  1XMO C;  3LUS A;  1MXA A;  2P2B A;  1ZB8 A;  4DR4 C;  5K8F A;  4BCA A;  4DR1 C;  1P7L A;  2QVY X;  4D4G A;  2P02 A;  2ASB A;  2BJO A;  1PG3 A;  1MDF A;  1UKK A;  2HJG A;  3DLP X;  4GKJ C;  3NPD A;  3A9V A;  4FUQ A;  3EER A;  1QWI A;  1HNW C;  4YY3 C;  4LF8 C;  5H9U A;  2E8E A;  4OX9 C;  4K0K C;  4ODJ A;  4B3T C;  1MDB A;  4DV4 C;  2D28 C;  2QW0 X;  3SO4 A;  2QVX X;  5BUR A;  2VQE C;  3PRO C;  4OYC A;  1O90 A;  3NYR A;  2P2F A;  3LNV A;  5LMU C;  2UXC C;  4X65 C;  4GS5 A;  3CJE A;  4GXR A;  1NYE A;  4JM1 A;  4GXQ A;  2OO4 A;  1XRA A;  3A9U A;  4MH4 A;  4K0B A;  3J7A D;  5FLX D;  4D57 A;  5K85 A;  5A19 A;  4LF7 C;  3OTO C;  2D1Q A;  3AF5 A;  5A2Q D;  2D1T A;  4DR5 C;  1IBK C;  5BSR A;  5IT9 D;  1O9T A;  5T8S A;  2BH1 X;  4G37 A;  1XRC A;  5BSW A;  2QVZ X;  5ADZ A;  4B3S C;  5JRH A;  2D1S A;  5BSV A;  2HHH C;  1HH2 P;  2VSQ A;  3N54 B;  4KTV A;  2D7V A;  3VNQ A;  4PRO C;  2PN2 A;  3TQI A;  3T1H C;  4BBY A;  4XX2 A;  5IFI A;  2OBV A;  4L7I A;  4R1M A;  3C5E A;  2P2Q A;  4EAT A;  3IPL A;  1FJG C;  4RMN A;  3RG2 A;  1IBM C;  3GR0 A;  1WF3 A;  4RLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...