5IT9D

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
223
structure length
223
Chain Sequence
AIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRATKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHSGQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKALPDAVTIIEPKEEEPVLEPSVKDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
total genus 45
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
D PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5it9D01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5it9D02
1VLAA 2VQFC 4XX2A 2JMPA 1ZB9A 4LF7C 2F4VC 2ONFA 1N34C 4X65C 2UUCC 4B3SC 4X64C 2E7GA 3J81D 4AQYC 4LF9C 4LFAC 4JI6C 2HHHC 1WF3A 1EGAA 3JAMD 2E5LC 4LFCC 3IEVA 4MTNA 5IT9D 4DV0C 4DCUA 2OPLB 1XMOC 4DCSA 1N2FA 4LF6C 1HH2P 1HR0C 4JI2C 3R9XA 4LF8C 4LF4C 1IBLC 1QWIA 4K0KC 4OX9C 1HNZC 4DR1C 3J7AD 4KHPC 1FJGC 3LUSA 4DR4C 2HJGA 4NXMC 3T1HC 4DR3C 1ZB8A 4X66C 4DUYC 2UXDC 3AF6A 2E8CA 2UUAC 4B3MC 2DYJA 1MKYA 5A2QD 3T1YC 3EERA 4GKJC 4DV4C 2QL8A 2XR1A 5BR8C 4DV1C 4DV6C 1HNXC 4JI8C 1WH9A 2YCBA 2EGTA 4JI1C 4BSZA 1USPA 4DCVA 2BJOA 1J5EC 4DR2C 4DV2C 2D7VA 4DCTA 4DR6C 1IBMC 2E8EA 4LFBC 4JI0C 2UXCC 4LF5C 3OTOC 2KZFA 5LMUC 4JYAC 1UKKA 2PN2A 2E8FA 1XMQC 2ZM6C 4X62C 1K0RA 4DR5C 2ATWA 4DUZC 4GKKC 4YHHC 4B3RC 4NXNC 1JOSA 4NOZA 1NYEA 1HNWC 2UXBC 1XNQC 4YY3C 1LQLA 3AF5A 4DV5C 2VQEC 5IWAC 4JI7C 1N36C 4JV5C 2UUBC 2UU9C 1I94C 2PT7G 3I07A 2CXCA 1PA4A 4B3TC 4JI5C 1N32C 4DV7C 2OPLA 1IBKC 3R9WA 4MH4A 1USPB 4JI3C 2CY1A 3CJEA 3GKUA 3IEUA 1N33C 1KKGA 4JI4C 2ASBA 5LMNC 4DR7C 3J80D 1L2FA 4DV3C 1ML8A 1XNRC 5FLXD
chains in the Genus database with same CATH superfamily
4XX2A 5IFIA 2JMPA 4BC9A 4RVNA 5CZVA 5BSVA 3J81D 1TH5A 2HHHC 4R1LA 1EGAA 3IPLA 2E5LC 3KXWA 4MTNA 5T8SA 5IT9D 3CQ3A 4DV0C 4DCUA 2M5HA 1N2FA 3FM7A 5E7QA 1MDBA 4LF8C 3A9UA 3UEBA 4ODJA 1HNZC 2QVYX 3DLPX 4DR1C 4BBYA 5ADZA 3LUSA 4DR4C 4FUTA 2BH1X 4L7IA 2HJGA 1O93A 3A4IA 2D1RA 2E0GA 3S82A 2UUAC 2QW0X 2P2FA 2Y4NA 2WD9A 4JM1A 4IZ6A 5BR8C 1HNXC 1XHJA 3FCEA 1USPA 2BJOA 2KDNA 4DR2C 2D7VA 4DR6C 1XRBA 4JI0C 4G36A 1XDXA 3N2QA 4I9GA 5GTDA 5LMUC 2E8FA 1RG9A 2ZM6C 1MDFA 1XRCA 3UZ0A 1M6XA 1HNWC 1O9TA 4YY3C 5IWAC 4JI7C 2QVXX 4JV5C 2UU9C 2PT7G 1PA4A 4B3TC 4GXQA 1N32C 4DV7C 2Z51A 5LCIA 3R9WA 5KEIA 3IMLA 1FUGA 2OBVA 1USPB 4JI3C 2CY1A 3DAYA 4L4QA 4D57A 3IEUA 5DV9A 1V60A 1L2FA 4DV3C 1WCJA 2VSQA 1XNRC 5FLXD 1MD9A 2M5OA 2NCLA 2P2JA 3GPCA 4X65C 3VNQA 2D28C 4X64C 3GR1A 4ISBA 1NY8A 4AQYC 1WF3A 4R0MA 3NPDA 2PROA 5BUSA 4WV3A 2DPLA 1XMOC 4DCSA 4LF6C 1HH2P 1PG4A 3R9XA 4LF4C 5BSUA 3RG2A 1T5HX 3RV2A 1PU1A 3CW9A 2QVZX 1FJGC 5AE2A 4NXMC 3T1HC 3FCCA 1PG3A 3E7WA 4B3MC 2DYJA 1MKYA 3O2EA 3SO4A 5K85A 4DV4C 4FUQA 2XR1A 4DV1C 2YCBA 4BSZA 4DCVA 4PUHA 3LAXA 4RVOA 1XRAA 5K8FA 5A1GA 1IBMC 4LFBC 5AE1A 4TPSB 2KZFA 3OTOC 4JYAC 4X62C 2ATWA 5BSMA 2UXBC 1NYEA 1LQLA 3AF5A 3L95X 1N36C 2MM9A 1YJ7A 5AE3A 2CXCA 1QM4A 4PHTA 2OPLA 1IBKC 2P2MA 3GR0A 4MH4A 4RMNA 1IB8A 2DHMA 4ZLPA 2D1SA 1MXCA 3J80D 1ML8A 1VEHA 2YWBA 5BSRA 1O90A 3N54B 2VQFC 1MXBA 3B7WA 4LF7C 2ONFA 5JRHA 5KYTA 4OYCA 4BC7A 4B3SC 2E7GA 4LF9C 3DHVA 5CZXA 4JI6C 2P20A 3K6RA 3LNVA 3JAMD 1AMUA 2OPLB 2WP0C 1T5DX 5A19A 1LCIA 2Y4OA 4G37A 4R1MA 3UX3A 3A25A 4I9FA 4K0KC 3EQ6A 4GS5A 3J7AD 1P4EC 2D1TA 4PUGA 4D56A 2OO4A 1P7LA 1XS3A 4OXIA 4DUYC 2UXDC 2E8CA 4GXRA 2ZTBA 5A2QD 4D4GA 2P2QA 4GKJC 3H2TA 4DV6C 2P2BA 4JI8C 2EGTA 4DV2C 4DCTA 5KYVA 2VZEA 3ETOA 4LF5C 1FLOA 3A9VA 2D27A 5T8TA 1XMQC 1K0RA 3UX2A 3TR3A 3E7XA 4U5YD 4DUZC 4YHHC 4B3RC 4NXNC 4PROC 4NOZA 5BUQA 3C5EA 4DV5C 4EATA 4ZJZA 3I07A 4JI5C 5BSWA 4NDNA 4PUIA 3AY0A 3CJEA 4L2ZA 1KKGA 3LNOA 4RM3A 2ASBA 4DR7C 2YWCA 4WS9A 1VLAA 2MMAB 1ZB9A 2F4VC 3PESA 1N34C 2UUCC 4DG8A 3R44A 5A1IA 3L8CA 4LFAC 4IR7A 3NI2A 3NYQA 2CU6A 5H9UA 1V25A 4LFCC 3IEVA 1YGTA 4G1IA 1M6XC 4D4IA 1HR0C 2ZZMA 1RY2A 4JI2C 3ETCA 4KTTA 2KZ0A 1IBLC 1QWIA 4OX9C 3PROC 2JNVA 4HPVA 3CW8X 3VNRA 3G7SA 4KHPC 3VNSA 2MCQA 4DR3C 4K0BA 1ZB8A 4BCAA 2Y27A 4RLQA 4X66C 2D1QA 3AF6A 4DG9A 1BA3A 3T1YC 3EERA 1UWDA 4FTFA 2QL8A 4LE5A 2PG1E 1WH9A 3PBKA 4JI1C 3I08A 1J5EC 1GPMA 4RM2A 2E8EA 2UXCC 4RLFA 1UKKA 2PN2A 4DR5C 1V26A 4GKKC 3CQ1A 3CQ2A 5BSTA 2P02A 1JOSA 1XNQC 2YX1A 2VQEC 3A26A 3TDEA 2UUBC 1I94C 1P4EA 1ULTA 1O92A 4KTVA 2V7BA 3UOWA 5BURA 1MXAA 3NYRA 3TUFA 2ZZNA 3GKUA 3TQIA 1N33C 4PZPA 5LMNC 2AYAA 3LGXA 4JI4C
chains in the Genus database with same CATH topology
4XX2A 5IFIA 2JMPA 4BC9A 4RVNA 5CZVA 5BSVA 3J81D 2HHHC 4R1LA 1EGAA 3IPLA 2E5LC 3KXWA 4MTNA 5T8SA 5IT9D 4DV0C 4DCUA 1N2FA 5E7QA 1MDBA 4LF8C 3A9UA 4ODJA 1HNZC 2QVYX 3DLPX 4DR1C 4BBYA 5ADZA 3LUSA 4DR4C 4FUTA 2BH1X 4L7IA 2HJGA 1O93A 3A4IA 2D1RA 2E0GA 3S82A 2UUAC 2QW0X 2P2FA 2Y4NA 2WD9A 4JM1A 4IZ6A 5BR8C 1HNXC 3FCEA 1USPA 2BJOA 4DR2C 2D7VA 4DR6C 1XRBA 4JI0C 4G36A 3N2QA 4I9GA 5GTDA 5LMUC 2E8FA 1RG9A 2ZM6C 1MDFA 1XRCA 3UZ0A 1HNWC 1O9TA 4YY3C 5IWAC 4JI7C 2QVXX 4JV5C 2UU9C 2PT7G 1PA4A 4B3TC 4GXQA 1N32C 4DV7C 3R9WA 5KEIA 3IMLA 1FUGA 2OBVA 1USPB 4JI3C 2CY1A 3DAYA 4L4QA 4D57A 3IEUA 5DV9A 1L2FA 4DV3C 2VSQA 1XNRC 5FLXD 1MD9A 2P2JA 3GPCA 4X65C 3VNQA 2D28C 4X64C 3GR1A 4ISBA 4AQYC 1WF3A 4R0MA 3NPDA 2PROA 5BUSA 4WV3A 2DPLA 1XMOC 4DCSA 4LF6C 1HH2P 1PG4A 3R9XA 4LF4C 5BSUA 3RG2A 1T5HX 3RV2A 3CW9A 2QVZX 1FJGC 5AE2A 4NXMC 3T1HC 3FCCA 1PG3A 3E7WA 4B3MC 2DYJA 1MKYA 3SO4A 5K85A 4DV4C 4FUQA 2XR1A 4DV1C 2YCBA 4BSZA 4DCVA 3LAXA 4RVOA 1XRAA 5K8FA 5A1GA 1IBMC 4LFBC 5AE1A 4TPSB 2KZFA 3OTOC 4JYAC 4X62C 2ATWA 5BSMA 2UXBC 1NYEA 1LQLA 3AF5A 3L95X 1N36C 1YJ7A 5AE3A 2CXCA 1QM4A 4PHTA 2OPLA 1IBKC 2P2MA 3GR0A 4MH4A 4RMNA 4ZLPA 2D1SA 1MXCA 3J80D 1ML8A 2YWBA 5BSRA 1O90A 3N54B 2VQFC 1MXBA 3B7WA 4LF7C 2ONFA 5JRHA 5KYTA 4OYCA 4BC7A 4B3SC 2E7GA 4LF9C 3DHVA 5CZXA 4JI6C 2P20A 3LNVA 3JAMD 1AMUA 2OPLB 2WP0C 1T5DX 5A19A 1LCIA 2Y4OA 4G37A 4R1MA 4I9FA 4K0KC 3EQ6A 4GS5A 3J7AD 2D1TA 4D56A 2OO4A 1P7LA 4OXIA 4DUYC 2UXDC 2E8CA 4GXRA 5A2QD 4D4GA 2P2QA 4GKJC 3H2TA 4DV6C 2P2BA 4JI8C 2EGTA 4DV2C 4DCTA 5KYVA 2VZEA 3ETOA 4LF5C 3A9VA 2D27A 5T8TA 1XMQC 1K0RA 3E7XA 4U5YD 4DUZC 4YHHC 4B3RC 4NXNC 4PROC 4NOZA 5BUQA 3C5EA 4DV5C 4EATA 4ZJZA 3I07A 4JI5C 5BSWA 4NDNA 3CJEA 4L2ZA 1KKGA 4RM3A 2ASBA 4DR7C 2YWCA 4WS9A 1VLAA 1ZB9A 2F4VC 3PESA 1N34C 2UUCC 4DG8A 3R44A 5A1IA 3L8CA 4LFAC 4IR7A 3NI2A 3NYQA 5H9UA 1V25A 4LFCC 3IEVA 4G1IA 4D4IA 1HR0C 1RY2A 4JI2C 3ETCA 4KTTA 1IBLC 1QWIA 4OX9C 3PROC 4HPVA 3CW8X 3VNRA 3G7SA 4KHPC 3VNSA 4DR3C 4K0BA 1ZB8A 4BCAA 2Y27A 4RLQA 4X66C 2D1QA 3AF6A 4DG9A 1BA3A 3T1YC 3EERA 4FTFA 2QL8A 4LE5A 1WH9A 3PBKA 4JI1C 3I08A 1J5EC 1GPMA 4RM2A 2E8EA 2UXCC 4RLFA 1UKKA 2PN2A 4DR5C 1V26A 4GKKC 5BSTA 2P02A 1JOSA 1XNQC 2VQEC 3TDEA 2UUBC 1I94C 1ULTA 1O92A 4KTVA 2V7BA 3UOWA 5BURA 1MXAA 3NYRA 3TUFA 3GKUA 3TQIA 1N33C 4PZPA 5LMNC 2AYAA 3LGXA 4JI4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLA A;  2VQF C;  4XX2 A;  2JMP A;  1ZB9 A;  4LF7 C;  2F4V C;  2ONF A;  1N34 C;  4X65 C;  2UUC C;  4B3S C;  4X64 C;  2E7G A;  3J81 D;  4AQY C;  4LF9 C;  4LFA C;  4JI6 C;  2HHH C;  1WF3 A;  1EGA A;  3JAM D;  2E5L C;  4LFC C;  3IEV A;  4MTN A;  5IT9 D;  4DV0 C;  4DCU A;  2OPL B;  1XMO C;  4DCS A;  1N2F A;  4LF6 C;  1HH2 P;  1HR0 C;  4JI2 C;  3R9X A;  4LF8 C;  4LF4 C;  1IBL C;  1QWI A;  4K0K C;  4OX9 C;  1HNZ C;  4DR1 C;  3J7A D;  4KHP C;  1FJG C;  3LUS A;  4DR4 C;  2HJG A;  4NXM C;  3T1H C;  4DR3 C;  1ZB8 A;  4X66 C;  4DUY C;  2UXD C;  3AF6 A;  2E8C A;  2UUA C;  4B3M C;  2DYJ A;  1MKY A;  5A2Q D;  3T1Y C;  3EER A;  4GKJ C;  4DV4 C;  2QL8 A;  2XR1 A;  5BR8 C;  4DV1 C;  4DV6 C;  1HNX C;  4JI8 C;  1WH9 A;  2YCB A;  2EGT A;  4JI1 C;  4BSZ A;  1USP A;  4DCV A;  2BJO A;  1J5E C;  4DR2 C;  4DV2 C;  2D7V A;  4DCT A;  4DR6 C;  1IBM C;  2E8E A;  4LFB C;  4JI0 C;  2UXC C;  4LF5 C;  3OTO C;  2KZF A;  5LMU C;  4JYA C;  1UKK A;  2PN2 A;  2E8F A;  1XMQ C;  2ZM6 C;  4X62 C;  1K0R A;  4DR5 C;  2ATW A;  4DUZ C;  4GKK C;  4YHH C;  4B3R C;  4NXN C;  1JOS A;  4NOZ A;  1NYE A;  1HNW C;  2UXB C;  1XNQ C;  4YY3 C;  1LQL A;  3AF5 A;  4DV5 C;  2VQE C;  5IWA C;  4JI7 C;  1N36 C;  4JV5 C;  2UUB C;  2UU9 C;  1I94 C;  2PT7 G;  3I07 A;  2CXC A;  1PA4 A;  4B3T C;  4JI5 C;  1N32 C;  4DV7 C;  2OPL A;  1IBK C;  3R9W A;  4MH4 A;  1USP B;  4JI3 C;  2CY1 A;  3CJE A;  3GKU A;  3IEU A;  1N33 C;  1KKG A;  4JI4 C;  2ASB A;  5LMN C;  4DR7 C;  3J80 D;  1L2F A;  4DV3 C;  1ML8 A;  1XNR C;  5FLX D; 
#chains in the Genus database with same CATH topology
 4XX2 A;  5IFI A;  2JMP A;  4BC9 A;  4RVN A;  5CZV A;  5BSV A;  3J81 D;  1TH5 A;  2HHH C;  4R1L A;  1EGA A;  3IPL A;  2E5L C;  3KXW A;  4MTN A;  5T8S A;  5IT9 D;  3CQ3 A;  4DV0 C;  4DCU A;  2M5H A;  1N2F A;  3FM7 A;  5E7Q A;  1MDB A;  4LF8 C;  3A9U A;  3UEB A;  4ODJ A;  1HNZ C;  2QVY X;  3DLP X;  4DR1 C;  4BBY A;  5ADZ A;  3LUS A;  4DR4 C;  4FUT A;  2BH1 X;  4L7I A;  2HJG A;  1O93 A;  3A4I A;  2D1R A;  2E0G A;  3S82 A;  2UUA C;  2QW0 X;  2P2F A;  2Y4N A;  2WD9 A;  4JM1 A;  4IZ6 A;  5BR8 C;  1HNX C;  1XHJ A;  3FCE A;  1USP A;  2BJO A;  2KDN A;  4DR2 C;  2D7V A;  4DR6 C;  1XRB A;  4JI0 C;  4G36 A;  1XDX A;  3N2Q A;  4I9G A;  5GTD A;  5LMU C;  2E8F A;  1RG9 A;  2ZM6 C;  1MDF A;  1XRC A;  3UZ0 A;  1M6X A;  1HNW C;  1O9T A;  4YY3 C;  5IWA C;  4JI7 C;  2QVX X;  4JV5 C;  2UU9 C;  2PT7 G;  1PA4 A;  4B3T C;  4GXQ A;  1N32 C;  4DV7 C;  2Z51 A;  5LCI A;  3R9W A;  5KEI A;  3IML A;  1FUG A;  2OBV A;  1USP B;  4JI3 C;  2CY1 A;  3DAY A;  4L4Q A;  4D57 A;  3IEU A;  5DV9 A;  1V60 A;  1L2F A;  4DV3 C;  1WCJ A;  2VSQ A;  1XNR C;  5FLX D;  1MD9 A;  2M5O A;  2NCL A;  2P2J A;  3GPC A;  4X65 C;  3VNQ A;  2D28 C;  4X64 C;  3GR1 A;  4ISB A;  1NY8 A;  4AQY C;  1WF3 A;  4R0M A;  3NPD A;  2PRO A;  5BUS A;  4WV3 A;  2DPL A;  1XMO C;  4DCS A;  4LF6 C;  1HH2 P;  1PG4 A;  3R9X A;  4LF4 C;  5BSU A;  3RG2 A;  1T5H X;  3RV2 A;  1PU1 A;  3CW9 A;  2QVZ X;  1FJG C;  5AE2 A;  4NXM C;  3T1H C;  3FCC A;  1PG3 A;  3E7W A;  4B3M C;  2DYJ A;  1MKY A;  3O2E A;  3SO4 A;  5K85 A;  4DV4 C;  4FUQ A;  2XR1 A;  4DV1 C;  2YCB A;  4BSZ A;  4DCV A;  4PUH A;  3LAX A;  4RVO A;  1XRA A;  5K8F A;  5A1G A;  1IBM C;  4LFB C;  5AE1 A;  4TPS B;  2KZF A;  3OTO C;  4JYA C;  4X62 C;  2ATW A;  5BSM A;  2UXB C;  1NYE A;  1LQL A;  3AF5 A;  3L95 X;  1N36 C;  2MM9 A;  1YJ7 A;  5AE3 A;  2CXC A;  1QM4 A;  4PHT A;  2OPL A;  1IBK C;  2P2M A;  3GR0 A;  4MH4 A;  4RMN A;  1IB8 A;  2DHM A;  4ZLP A;  2D1S A;  1MXC A;  3J80 D;  1ML8 A;  1VEH A;  2YWB A;  5BSR A;  1O90 A;  3N54 B;  2VQF C;  1MXB A;  3B7W A;  4LF7 C;  2ONF A;  5JRH A;  5KYT A;  4OYC A;  4BC7 A;  4B3S C;  2E7G A;  4LF9 C;  3DHV A;  5CZX A;  4JI6 C;  2P20 A;  3K6R A;  3LNV A;  3JAM D;  1AMU A;  2OPL B;  2WP0 C;  1T5D X;  5A19 A;  1LCI A;  2Y4O A;  4G37 A;  4R1M A;  3UX3 A;  3A25 A;  4I9F A;  4K0K C;  3EQ6 A;  4GS5 A;  3J7A D;  1P4E C;  2D1T A;  4PUG A;  4D56 A;  2OO4 A;  1P7L A;  1XS3 A;  4OXI A;  4DUY C;  2UXD C;  2E8C A;  4GXR A;  2ZTB A;  5A2Q D;  4D4G A;  2P2Q A;  4GKJ C;  3H2T A;  4DV6 C;  2P2B A;  4JI8 C;  2EGT A;  4DV2 C;  4DCT A;  5KYV A;  2VZE A;  3ETO A;  4LF5 C;  1FLO A;  3A9V A;  2D27 A;  5T8T A;  1XMQ C;  1K0R A;  3UX2 A;  3TR3 A;  3E7X A;  4U5Y D;  4DUZ C;  4YHH C;  4B3R C;  4NXN C;  4PRO C;  4NOZ A;  5BUQ A;  3C5E A;  4DV5 C;  4EAT A;  4ZJZ A;  3I07 A;  4JI5 C;  5BSW A;  4NDN A;  4PUI A;  3AY0 A;  3CJE A;  4L2Z A;  1KKG A;  3LNO A;  4RM3 A;  2ASB A;  4DR7 C;  2YWC A;  4WS9 A;  1VLA A;  2MMA B;  1ZB9 A;  2F4V C;  3PES A;  1N34 C;  2UUC C;  4DG8 A;  3R44 A;  5A1I A;  3L8C A;  4LFA C;  4IR7 A;  3NI2 A;  3NYQ A;  2CU6 A;  5H9U A;  1V25 A;  4LFC C;  3IEV A;  1YGT A;  4G1I A;  1M6X C;  4D4I A;  1HR0 C;  2ZZM A;  1RY2 A;  4JI2 C;  3ETC A;  4KTT A;  2KZ0 A;  1IBL C;  1QWI A;  4OX9 C;  3PRO C;  2JNV A;  4HPV A;  3CW8 X;  3VNR A;  3G7S A;  4KHP C;  3VNS A;  2MCQ A;  4DR3 C;  4K0B A;  1ZB8 A;  4BCA A;  2Y27 A;  4RLQ A;  4X66 C;  2D1Q A;  3AF6 A;  4DG9 A;  1BA3 A;  3T1Y C;  3EER A;  1UWD A;  4FTF A;  2QL8 A;  4LE5 A;  2PG1 E;  1WH9 A;  3PBK A;  4JI1 C;  3I08 A;  1J5E C;  1GPM A;  4RM2 A;  2E8E A;  2UXC C;  4RLF A;  1UKK A;  2PN2 A;  4DR5 C;  1V26 A;  4GKK C;  3CQ1 A;  3CQ2 A;  5BST A;  2P02 A;  1JOS A;  1XNQ C;  2YX1 A;  2VQE C;  3A26 A;  3TDE A;  2UUB C;  1I94 C;  1P4E A;  1ULT A;  1O92 A;  4KTV A;  2V7B A;  3UOW A;  5BUR A;  1MXA A;  3NYR A;  3TUF A;  2ZZN A;  3GKU A;  3TQI A;  1N33 C;  4PZP A;  5LMN C;  2AYA A;  3LGX A;  4JI4 C; 
#chains in the Genus database with same CATH homology
 4XX2 A;  5IFI A;  2JMP A;  4BC9 A;  4RVN A;  5CZV A;  5BSV A;  3J81 D;  2HHH C;  4R1L A;  1EGA A;  3IPL A;  2E5L C;  3KXW A;  4MTN A;  5T8S A;  5IT9 D;  4DV0 C;  4DCU A;  1N2F A;  5E7Q A;  1MDB A;  4LF8 C;  3A9U A;  4ODJ A;  1HNZ C;  2QVY X;  3DLP X;  4DR1 C;  4BBY A;  5ADZ A;  3LUS A;  4DR4 C;  4FUT A;  2BH1 X;  4L7I A;  2HJG A;  1O93 A;  3A4I A;  2D1R A;  2E0G A;  3S82 A;  2UUA C;  2QW0 X;  2P2F A;  2Y4N A;  2WD9 A;  4JM1 A;  4IZ6 A;  5BR8 C;  1HNX C;  3FCE A;  1USP A;  2BJO A;  4DR2 C;  2D7V A;  4DR6 C;  1XRB A;  4JI0 C;  4G36 A;  3N2Q A;  4I9G A;  5GTD A;  5LMU C;  2E8F A;  1RG9 A;  2ZM6 C;  1MDF A;  1XRC A;  3UZ0 A;  1HNW C;  1O9T A;  4YY3 C;  5IWA C;  4JI7 C;  2QVX X;  4JV5 C;  2UU9 C;  2PT7 G;  1PA4 A;  4B3T C;  4GXQ A;  1N32 C;  4DV7 C;  3R9W A;  5KEI A;  3IML A;  1FUG A;  2OBV A;  1USP B;  4JI3 C;  2CY1 A;  3DAY A;  4L4Q A;  4D57 A;  3IEU A;  5DV9 A;  1L2F A;  4DV3 C;  2VSQ A;  1XNR C;  5FLX D;  1MD9 A;  2P2J A;  3GPC A;  4X65 C;  3VNQ A;  2D28 C;  4X64 C;  3GR1 A;  4ISB A;  4AQY C;  1WF3 A;  4R0M A;  3NPD A;  2PRO A;  5BUS A;  4WV3 A;  2DPL A;  1XMO C;  4DCS A;  4LF6 C;  1HH2 P;  1PG4 A;  3R9X A;  4LF4 C;  5BSU A;  3RG2 A;  1T5H X;  3RV2 A;  3CW9 A;  2QVZ X;  1FJG C;  5AE2 A;  4NXM C;  3T1H C;  3FCC A;  1PG3 A;  3E7W A;  4B3M C;  2DYJ A;  1MKY A;  3SO4 A;  5K85 A;  4DV4 C;  4FUQ A;  2XR1 A;  4DV1 C;  2YCB A;  4BSZ A;  4DCV A;  3LAX A;  4RVO A;  1XRA A;  5K8F A;  5A1G A;  1IBM C;  4LFB C;  5AE1 A;  4TPS B;  2KZF A;  3OTO C;  4JYA C;  4X62 C;  2ATW A;  5BSM A;  2UXB C;  1NYE A;  1LQL A;  3AF5 A;  3L95 X;  1N36 C;  1YJ7 A;  5AE3 A;  2CXC A;  1QM4 A;  4PHT A;  2OPL A;  1IBK C;  2P2M A;  3GR0 A;  4MH4 A;  4RMN A;  4ZLP A;  2D1S A;  1MXC A;  3J80 D;  1ML8 A;  2YWB A;  5BSR A;  1O90 A;  3N54 B;  2VQF C;  1MXB A;  3B7W A;  4LF7 C;  2ONF A;  5JRH A;  5KYT A;  4OYC A;  4BC7 A;  4B3S C;  2E7G A;  4LF9 C;  3DHV A;  5CZX A;  4JI6 C;  2P20 A;  3LNV A;  3JAM D;  1AMU A;  2OPL B;  2WP0 C;  1T5D X;  5A19 A;  1LCI A;  2Y4O A;  4G37 A;  4R1M A;  4I9F A;  4K0K C;  3EQ6 A;  4GS5 A;  3J7A D;  2D1T A;  4D56 A;  2OO4 A;  1P7L A;  4OXI A;  4DUY C;  2UXD C;  2E8C A;  4GXR A;  5A2Q D;  4D4G A;  2P2Q A;  4GKJ C;  3H2T A;  4DV6 C;  2P2B A;  4JI8 C;  2EGT A;  4DV2 C;  4DCT A;  5KYV A;  2VZE A;  3ETO A;  4LF5 C;  3A9V A;  2D27 A;  5T8T A;  1XMQ C;  1K0R A;  3E7X A;  4U5Y D;  4DUZ C;  4YHH C;  4B3R C;  4NXN C;  4PRO C;  4NOZ A;  5BUQ A;  3C5E A;  4DV5 C;  4EAT A;  4ZJZ A;  3I07 A;  4JI5 C;  5BSW A;  4NDN A;  3CJE A;  4L2Z A;  1KKG A;  4RM3 A;  2ASB A;  4DR7 C;  2YWC A;  4WS9 A;  1VLA A;  1ZB9 A;  2F4V C;  3PES A;  1N34 C;  2UUC C;  4DG8 A;  3R44 A;  5A1I A;  3L8C A;  4LFA C;  4IR7 A;  3NI2 A;  3NYQ A;  5H9U A;  1V25 A;  4LFC C;  3IEV A;  4G1I A;  4D4I A;  1HR0 C;  1RY2 A;  4JI2 C;  3ETC A;  4KTT A;  1IBL C;  1QWI A;  4OX9 C;  3PRO C;  4HPV A;  3CW8 X;  3VNR A;  3G7S A;  4KHP C;  3VNS A;  4DR3 C;  4K0B A;  1ZB8 A;  4BCA A;  2Y27 A;  4RLQ A;  4X66 C;  2D1Q A;  3AF6 A;  4DG9 A;  1BA3 A;  3T1Y C;  3EER A;  4FTF A;  2QL8 A;  4LE5 A;  1WH9 A;  3PBK A;  4JI1 C;  3I08 A;  1J5E C;  1GPM A;  4RM2 A;  2E8E A;  2UXC C;  4RLF A;  1UKK A;  2PN2 A;  4DR5 C;  1V26 A;  4GKK C;  5BST A;  2P02 A;  1JOS A;  1XNQ C;  2VQE C;  3TDE A;  2UUB C;  1I94 C;  1ULT A;  1O92 A;  4KTV A;  2V7B A;  3UOW A;  5BUR A;  1MXA A;  3NYR A;  3TUF A;  3GKU A;  3TQI A;  1N33 C;  4PZP A;  5LMN C;  2AYA A;  3LGX A;  4JI4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...