2ZM6C

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2zm6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2zm6C02
1HR0C 2QL8A 4B3SC 4DV2C 5IT9D 1HNZC 4DR3C 4K0KC 4B3RC 1N34C 2HJGA 2BJOA 2D7VA 4GKJC 1ML8A 3GKUA 1FJGC 1IBMC 3J7AD 2VQEC 1HNWC 5LMUC 1XMOC 4LFBC 2YCBA 4MH4A 1XNRC 4X65C 2UUBC 3AF5A 2CXCA 4DR2C 4KHPC 4JYAC 3I07A 4JI5C 3CJEA 3R9XA 4JI0C 4JI1C 4DR1C 4LFAC 1VLAA 1MKYA 3T1HC 1HNXC 5LMNC 2E8CA 1WH9A 1I94C 1N36C 3JAMD 4DCSA 4DR6C 2ASBA 2JMPA 4NXMC 2UXDC 2HHHC 4B3TC 4B3MC 2PT7G 3J80D 2F4VC 1XMQC 1HH2P 2KZFA 2EGTA 5IWAC 1WF3A 5BR8C 4X62C 4DUYC 5A2QD 2E8EA 2PN2A 3EERA 4DV6C 4MTNA 1PA4A 5FLXD 1ZB8A 3OTOC 4JI4C 1KKGA 4JI7C 4DUZC 3R9WA 1USPA 1USPB 2E5LC 4NOZA 4XX2A 4DR7C 2ONFA 3J81D 2UUAC 2ATWA 2ZM6C 1N2FA 4X66C 1QWIA 2UU9C 4LF6C 1L2FA 3LUSA 4NXNC 4DCUA 2CY1A 4DR4C 2VQFC 4DV7C 4AQYC 4DR5C 3T1YC 3AF6A 4GKKC 1IBKC 1J5EC 1NYEA 1IBLC 4DV5C 4YHHC 4JI6C 4LF4C 2OPLB 4LF8C 1XNQC 4JI2C 1UKKA 4JI3C 1LQLA 4LF7C 4JV5C 2E8FA 1K0RA 4X64C 4JI8C 2XR1A 2OPLA 4DV1C 2UXCC 4DV3C 4BSZA 3IEUA 1N32C 2UUCC 4YY3C 4DCTA 1ZB9A 4DV4C 4LF9C 4OX9C 1N33C 2DYJA 1EGAA 4DV0C 4LFCC 1JOSA 2E7GA 4DCVA 4LF5C 3IEVA 2UXBC
chains in the Genus database with same CATH superfamily
3NYQA 1V25A 1HR0C 4IR7A 1HNZC 3A9VA 4DR3C 4B3RC 1N34C 2HJGA 3N2QA 3J7AD 1HNWC 2BH1X 4LFBC 5AE2A 1XNRC 3UX3A 4G37A 5LCIA 4X65C 2CXCA 4DG8A 2WP0C 3R9XA 1YGTA 3CW8X 5KYVA 1O9TA 3VNSA 3UX2A 1MKYA 3T1HC 1HNXC 4BC7A 5LMNC 1QM4A 1N36C 4DCSA 3NYRA 4DR6C 2ASBA 4I9GA 4D56A 4K0BA 1NY8A 5A1GA 3R44A 4L7IA 1P7LA 2EGTA 3PESA 1VEHA 5IWAC 1WF3A 5BR8C 4ODJA 5A2QD 2PN2A 2DPLA 3EERA 3KXWA 3OTOC 2D1RA 4IZ6A 2D28C 3A26A 3SO4A 2E5LC 4XX2A 4DR7C 3A4IA 2ATWA 3J81D 2ZM6C 1N2FA 1QWIA 2UU9C 3A25A 3TUFA 4DCUA 3CW9A 3L8CA 4DG9A 4DR4C 4DR5C 3T1YC 4GKKC 3GPCA 1ULTA 1PG3A 3TDEA 4DV5C 3DAYA 4PHTA 5BUSA 4JV5C 2E8FA 5K8FA 4X64C 1FUGA 4GS5A 4DV1C 5IFIA 3G7SA 4YY3C 1XHJA 5BSMA 2DYJA 5DV9A 4DV0C 4LFCC 1JOSA 1MDBA 3IEVA 2UXBC 1PU1A 2QVYX 2QL8A 5IT9D 3O2EA 2VZEA 1BA3A 2D7VA 1ML8A 4PZPA 2MCQA 3TQIA 4HPVA 4BC9A 2YCBA 5AE1A 2M5OA 3B7WA 2UUBC 2PROA 4GXQA 5T8TA 1UWDA 4RLQA 1YJ7A 3IMLA 1XRBA 3PROC 4JI1C 4DR1C 3A9UA 1VLAA 4BBYA 4KTVA 5JRHA 2JMPA 2NCLA 2P20A 2HHHC 4L4QA 2F4VC 1XMQC 3GR1A 4X62C 1IB8A 2E8EA 2ZZMA 4TPSB 3K6RA 4MTNA 5FLXD 1ZB8A 2QVZX 4RLFA 2P02A 3TR3A 1USPA 1USPB 3E7XA 2ONFA 4X66C 4RMNA 4FTFA 3CQ3A 4DV7C 2PG1E 2Z51A 4PROC 5BSUA 1J5EC 1NYEA 3FCCA 3ETCA 4YHHC 4LF4C 2OPLB 1TH5A 3EQ6A 2MM9A 3H2TA 1O92A 4JI3C 1LQLA 3DHVA 2XR1A 4KTTA 2D1SA 4DCTA 4ZLPA 1MXAA 1N33C 4RVNA 3N54B 5KYTA 1EGAA 3UEBA 1M6XC 2WD9A 1MXBA 1RG9A 4B3SC 5H9UA 4FUQA 4WV3A 2BJOA 4GKJC 3GKUA 1IBMC 1PG4A 2VQEC 5LMUC 1WCJA 2QVXX 3IPLA 4D4IA 3GR0A 2DHMA 5K85A 4G36A 3AF5A 3ETOA 4KHPC 4JYAC 4RM3A 3VNRA 1AMUA 2D1QA 2P2QA 2YWBA 4PUGA 1LCIA 4GXRA 1WH9A 4NXMC 2ZTBA 1P4EA 4BCAA 2D1TA 2VSQA 4B3MC 3J80D 5A19A 3CQ2A 3C5EA 3RG2A 3UZ0A 4R1MA 2P2JA 2ZZNA 5BSVA 1KKGA 1V60A 2M5HA 3NPDA 4LF6C 3LUSA 5BSTA 4OYCA 5A1IA 2E0GA 4I9FA 3LNVA 4LE5A 2Y4NA 5GTDA 1IBKC 3FM7A 4JI6C 4LF8C 2P2MA 4JI2C 4LF7C 4JM1A 4PUIA 2JNVA 4BSZA 3IEUA 2KDNA 1N32C 2UUCC 3PBKA 1ZB9A 4LF9C 4ZJZA 5BUQA 2E7GA 4DCVA 4LF5C 4DV2C 3E7WA 1GPMA 4U5YD 4K0KC 1FJGC 5BURA 3LAXA 2KZ0A 1XMOC 2P2FA 4MH4A 1T5HX 1RY2A 4DR2C 2D27A 3I07A 3DLPX 3CJEA 4JI5C 1MXCA 1MDFA 4OXIA 4JI0C 2V7BA 4NDNA 1FLOA 4LFAC 3UOWA 3VNQA 2E8CA 1I94C 1P4EC 3JAMD 1V26A 1O93A 2UXDC 4B3TC 2OBVA 4L2ZA 2PT7G 4R0MA 1XS3A 5BSRA 1HH2P 2KZFA 4DUYC 4D57A 4DV6C 5ADZA 2OO4A 1PA4A 5T8SA 2YX1A 4EATA 4JI4C 2YWCA 4JI7C 3CQ1A 4D4GA 3S82A 4DUZC 3R9WA 4NOZA 4RM2A 2UUAC 1T5DX 1L2FA 2CU6A 4NXNC 1O90A 2CY1A 2Y27A 2Y4OA 2VQFC 4AQYC 3FCEA 5KEIA 3AF6A 5E7QA 2P2BA 1IBLC 1XDXA 5AE3A 3LNOA 4ISBA 5CZVA 1XNQC 4PUHA 1XRAA 2MMAB 1UKKA 3LGXA 4RVOA 4R1LA 1K0RA 4JI8C 2QW0X 2OPLA 5BSWA 5CZXA 2UXCC 4DV3C 3I08A 3L95X 4DV4C 4OX9C 4G1IA 1MD9A 3AY0A 1M6XA 1XRCA 3RV2A 4FUTA 2AYAA 3NI2A 4WS9A
chains in the Genus database with same CATH topology
3NYQA 1V25A 1HR0C 4IR7A 1HNZC 3A9VA 4DR3C 4B3RC 1N34C 2HJGA 3N2QA 3J7AD 1HNWC 2BH1X 4LFBC 5AE2A 1XNRC 4G37A 4X65C 2CXCA 4DG8A 2WP0C 3R9XA 3CW8X 5KYVA 1O9TA 3VNSA 1MKYA 3T1HC 1HNXC 4BC7A 5LMNC 1QM4A 1N36C 4DCSA 3NYRA 4DR6C 2ASBA 4I9GA 4D56A 4K0BA 5A1GA 3R44A 4L7IA 1P7LA 2EGTA 3PESA 5IWAC 1WF3A 5BR8C 4ODJA 5A2QD 2PN2A 2DPLA 3EERA 3KXWA 3OTOC 2D1RA 4IZ6A 2D28C 3SO4A 2E5LC 4XX2A 4DR7C 3A4IA 2ATWA 3J81D 1N2FA 2ZM6C 2UU9C 1QWIA 3TUFA 4DCUA 3CW9A 3L8CA 4DG9A 4DR4C 4DR5C 3T1YC 4GKKC 3GPCA 1ULTA 1PG3A 3TDEA 4DV5C 3DAYA 4PHTA 5BUSA 4JV5C 2E8FA 5K8FA 4X64C 1FUGA 4GS5A 4DV1C 5IFIA 3G7SA 4YY3C 5BSMA 2DYJA 5DV9A 4DV0C 4LFCC 1JOSA 1MDBA 3IEVA 2UXBC 2QVYX 2QL8A 5IT9D 2VZEA 1BA3A 2D7VA 1ML8A 4PZPA 3TQIA 4HPVA 4BC9A 2YCBA 5AE1A 3B7WA 2UUBC 2PROA 4GXQA 5T8TA 4RLQA 1YJ7A 3IMLA 1XRBA 3PROC 4JI1C 4DR1C 3A9UA 1VLAA 4BBYA 4KTVA 5JRHA 2JMPA 2P20A 2HHHC 4L4QA 2F4VC 1XMQC 3GR1A 4X62C 2E8EA 4TPSB 4MTNA 5FLXD 1ZB8A 2QVZX 4RLFA 2P02A 1USPA 1USPB 3E7XA 2ONFA 4X66C 4RMNA 4FTFA 4DV7C 4PROC 5BSUA 1J5EC 1NYEA 3FCCA 3ETCA 4YHHC 4LF4C 2OPLB 3EQ6A 3H2TA 1O92A 4JI3C 1LQLA 3DHVA 2XR1A 4KTTA 2D1SA 4DCTA 4ZLPA 1MXAA 1N33C 4RVNA 3N54B 5KYTA 1EGAA 2WD9A 1MXBA 1RG9A 4B3SC 5H9UA 4FUQA 4WV3A 2BJOA 4GKJC 3GKUA 1IBMC 1PG4A 2VQEC 5LMUC 2QVXX 3IPLA 4D4IA 3GR0A 5K85A 4G36A 3AF5A 3ETOA 4KHPC 4JYAC 4RM3A 3VNRA 1AMUA 2P2QA 2D1QA 2YWBA 1LCIA 4GXRA 1WH9A 4NXMC 4BCAA 2D1TA 2VSQA 4B3MC 3J80D 5A19A 3C5EA 3RG2A 3UZ0A 4R1MA 2P2JA 5BSVA 1KKGA 3NPDA 4LF6C 3LUSA 5BSTA 4OYCA 5A1IA 2E0GA 4I9FA 3LNVA 4LE5A 2Y4NA 5GTDA 1IBKC 4JI6C 4LF8C 2P2MA 4JI2C 4LF7C 4JM1A 4BSZA 3IEUA 1N32C 2UUCC 3PBKA 1ZB9A 4LF9C 4ZJZA 5BUQA 2E7GA 4DCVA 4LF5C 4DV2C 3E7WA 1GPMA 4U5YD 4K0KC 1FJGC 5BURA 3LAXA 1XMOC 2P2FA 4MH4A 1T5HX 1RY2A 4DR2C 2D27A 3I07A 3DLPX 3CJEA 4JI5C 1MXCA 1MDFA 4OXIA 4JI0C 2V7BA 4NDNA 4LFAC 3UOWA 3VNQA 2E8CA 1I94C 3JAMD 1V26A 1O93A 2UXDC 4B3TC 2OBVA 4L2ZA 2PT7G 4R0MA 5BSRA 1HH2P 2KZFA 4DUYC 4D57A 4DV6C 2OO4A 5ADZA 1PA4A 5T8SA 4EATA 4JI4C 2YWCA 4JI7C 4D4GA 3S82A 4DUZC 3R9WA 4NOZA 4RM2A 2UUAC 1T5DX 1L2FA 4NXNC 1O90A 2CY1A 2Y27A 2Y4OA 2VQFC 4AQYC 3FCEA 5KEIA 3AF6A 5E7QA 2P2BA 1IBLC 5AE3A 5CZVA 4ISBA 1XNQC 1XRAA 1UKKA 3LGXA 4RVOA 4R1LA 1K0RA 4JI8C 2QW0X 2OPLA 5BSWA 5CZXA 2UXCC 4DV3C 3I08A 3L95X 4DV4C 4OX9C 4G1IA 1MD9A 1XRCA 3RV2A 4FUTA 2AYAA 3NI2A 4WS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 C;  2QL8 A;  4B3S C;  4DV2 C;  5IT9 D;  1HNZ C;  4DR3 C;  4K0K C;  4B3R C;  1N34 C;  2HJG A;  2BJO A;  2D7V A;  4GKJ C;  1ML8 A;  3GKU A;  1FJG C;  1IBM C;  3J7A D;  2VQE C;  1HNW C;  5LMU C;  1XMO C;  4LFB C;  2YCB A;  4MH4 A;  1XNR C;  4X65 C;  2UUB C;  3AF5 A;  2CXC A;  4DR2 C;  4KHP C;  4JYA C;  3I07 A;  4JI5 C;  3CJE A;  3R9X A;  4JI0 C;  4JI1 C;  4DR1 C;  4LFA C;  1VLA A;  1MKY A;  3T1H C;  1HNX C;  5LMN C;  2E8C A;  1WH9 A;  1I94 C;  1N36 C;  3JAM D;  4DCS A;  4DR6 C;  2ASB A;  2JMP A;  4NXM C;  2UXD C;  2HHH C;  4B3T C;  4B3M C;  2PT7 G;  3J80 D;  2F4V C;  1XMQ C;  1HH2 P;  2KZF A;  2EGT A;  5IWA C;  1WF3 A;  5BR8 C;  4X62 C;  4DUY C;  5A2Q D;  2E8E A;  2PN2 A;  3EER A;  4DV6 C;  4MTN A;  1PA4 A;  5FLX D;  1ZB8 A;  3OTO C;  4JI4 C;  1KKG A;  4JI7 C;  4DUZ C;  3R9W A;  1USP A;  1USP B;  2E5L C;  4NOZ A;  4XX2 A;  4DR7 C;  2ONF A;  3J81 D;  2UUA C;  2ATW A;  2ZM6 C;  1N2F A;  4X66 C;  1QWI A;  2UU9 C;  4LF6 C;  1L2F A;  3LUS A;  4NXN C;  4DCU A;  2CY1 A;  4DR4 C;  2VQF C;  4DV7 C;  4AQY C;  4DR5 C;  3T1Y C;  3AF6 A;  4GKK C;  1IBK C;  1J5E C;  1NYE A;  1IBL C;  4DV5 C;  4YHH C;  4JI6 C;  4LF4 C;  2OPL B;  4LF8 C;  1XNQ C;  4JI2 C;  1UKK A;  4JI3 C;  1LQL A;  4LF7 C;  4JV5 C;  2E8F A;  1K0R A;  4X64 C;  4JI8 C;  2XR1 A;  2OPL A;  4DV1 C;  2UXC C;  4DV3 C;  4BSZ A;  3IEU A;  1N32 C;  2UUC C;  4YY3 C;  4DCT A;  1ZB9 A;  4DV4 C;  4LF9 C;  4OX9 C;  1N33 C;  2DYJ A;  1EGA A;  4DV0 C;  4LFC C;  1JOS A;  2E7G A;  4DCV A;  4LF5 C;  3IEV A;  2UXB C; 
#chains in the Genus database with same CATH topology
 3NYQ A;  1V25 A;  1HR0 C;  4IR7 A;  1HNZ C;  3A9V A;  4DR3 C;  4B3R C;  1N34 C;  2HJG A;  3N2Q A;  3J7A D;  1HNW C;  2BH1 X;  4LFB C;  5AE2 A;  1XNR C;  3UX3 A;  4G37 A;  5LCI A;  4X65 C;  2CXC A;  4DG8 A;  2WP0 C;  3R9X A;  1YGT A;  3CW8 X;  5KYV A;  1O9T A;  3VNS A;  3UX2 A;  1MKY A;  3T1H C;  1HNX C;  4BC7 A;  5LMN C;  1QM4 A;  1N36 C;  4DCS A;  3NYR A;  4DR6 C;  2ASB A;  4I9G A;  4D56 A;  4K0B A;  1NY8 A;  5A1G A;  3R44 A;  4L7I A;  1P7L A;  2EGT A;  3PES A;  1VEH A;  5IWA C;  1WF3 A;  5BR8 C;  4ODJ A;  5A2Q D;  2PN2 A;  2DPL A;  3EER A;  3KXW A;  3OTO C;  2D1R A;  4IZ6 A;  2D28 C;  3A26 A;  3SO4 A;  2E5L C;  4XX2 A;  4DR7 C;  3A4I A;  2ATW A;  3J81 D;  2ZM6 C;  1N2F A;  1QWI A;  2UU9 C;  3A25 A;  3TUF A;  4DCU A;  3CW9 A;  3L8C A;  4DG9 A;  4DR4 C;  4DR5 C;  3T1Y C;  4GKK C;  3GPC A;  1ULT A;  1PG3 A;  3TDE A;  4DV5 C;  3DAY A;  4PHT A;  5BUS A;  4JV5 C;  2E8F A;  5K8F A;  4X64 C;  1FUG A;  4GS5 A;  4DV1 C;  5IFI A;  3G7S A;  4YY3 C;  1XHJ A;  5BSM A;  2DYJ A;  5DV9 A;  4DV0 C;  4LFC C;  1JOS A;  1MDB A;  3IEV A;  2UXB C;  1PU1 A;  2QVY X;  2QL8 A;  5IT9 D;  3O2E A;  2VZE A;  1BA3 A;  2D7V A;  1ML8 A;  4PZP A;  2MCQ A;  3TQI A;  4HPV A;  4BC9 A;  2YCB A;  5AE1 A;  2M5O A;  3B7W A;  2UUB C;  2PRO A;  4GXQ A;  5T8T A;  1UWD A;  4RLQ A;  1YJ7 A;  3IML A;  1XRB A;  3PRO C;  4JI1 C;  4DR1 C;  3A9U A;  1VLA A;  4BBY A;  4KTV A;  5JRH A;  2JMP A;  2NCL A;  2P20 A;  2HHH C;  4L4Q A;  2F4V C;  1XMQ C;  3GR1 A;  4X62 C;  1IB8 A;  2E8E A;  2ZZM A;  4TPS B;  3K6R A;  4MTN A;  5FLX D;  1ZB8 A;  2QVZ X;  4RLF A;  2P02 A;  3TR3 A;  1USP A;  1USP B;  3E7X A;  2ONF A;  4X66 C;  4RMN A;  4FTF A;  3CQ3 A;  4DV7 C;  2PG1 E;  2Z51 A;  4PRO C;  5BSU A;  1J5E C;  1NYE A;  3FCC A;  3ETC A;  4YHH C;  4LF4 C;  2OPL B;  1TH5 A;  3EQ6 A;  2MM9 A;  3H2T A;  1O92 A;  4JI3 C;  1LQL A;  3DHV A;  2XR1 A;  4KTT A;  2D1S A;  4DCT A;  4ZLP A;  1MXA A;  1N33 C;  4RVN A;  3N54 B;  5KYT A;  1EGA A;  3UEB A;  1M6X C;  2WD9 A;  1MXB A;  1RG9 A;  4B3S C;  5H9U A;  4FUQ A;  4WV3 A;  2BJO A;  4GKJ C;  3GKU A;  1IBM C;  1PG4 A;  2VQE C;  5LMU C;  1WCJ A;  2QVX X;  3IPL A;  4D4I A;  3GR0 A;  2DHM A;  5K85 A;  4G36 A;  3AF5 A;  3ETO A;  4KHP C;  4JYA C;  4RM3 A;  3VNR A;  1AMU A;  2D1Q A;  2P2Q A;  2YWB A;  4PUG A;  1LCI A;  4GXR A;  1WH9 A;  4NXM C;  2ZTB A;  1P4E A;  4BCA A;  2D1T A;  2VSQ A;  4B3M C;  3J80 D;  5A19 A;  3CQ2 A;  3C5E A;  3RG2 A;  3UZ0 A;  4R1M A;  2P2J A;  2ZZN A;  5BSV A;  1KKG A;  1V60 A;  2M5H A;  3NPD A;  4LF6 C;  3LUS A;  5BST A;  4OYC A;  5A1I A;  2E0G A;  4I9F A;  3LNV A;  4LE5 A;  2Y4N A;  5GTD A;  1IBK C;  3FM7 A;  4JI6 C;  4LF8 C;  2P2M A;  4JI2 C;  4LF7 C;  4JM1 A;  4PUI A;  2JNV A;  4BSZ A;  3IEU A;  2KDN A;  1N32 C;  2UUC C;  3PBK A;  1ZB9 A;  4LF9 C;  4ZJZ A;  5BUQ A;  2E7G A;  4DCV A;  4LF5 C;  4DV2 C;  3E7W A;  1GPM A;  4U5Y D;  4K0K C;  1FJG C;  5BUR A;  3LAX A;  2KZ0 A;  1XMO C;  2P2F A;  4MH4 A;  1T5H X;  1RY2 A;  4DR2 C;  2D27 A;  3I07 A;  3DLP X;  3CJE A;  4JI5 C;  1MXC A;  1MDF A;  4OXI A;  4JI0 C;  2V7B A;  4NDN A;  1FLO A;  4LFA C;  3UOW A;  3VNQ A;  2E8C A;  1I94 C;  1P4E C;  3JAM D;  1V26 A;  1O93 A;  2UXD C;  4B3T C;  2OBV A;  4L2Z A;  2PT7 G;  4R0M A;  1XS3 A;  5BSR A;  1HH2 P;  2KZF A;  4DUY C;  4D57 A;  4DV6 C;  5ADZ A;  2OO4 A;  1PA4 A;  5T8S A;  2YX1 A;  4EAT A;  4JI4 C;  2YWC A;  4JI7 C;  3CQ1 A;  4D4G A;  3S82 A;  4DUZ C;  3R9W A;  4NOZ A;  4RM2 A;  2UUA C;  1T5D X;  1L2F A;  2CU6 A;  4NXN C;  1O90 A;  2CY1 A;  2Y27 A;  2Y4O A;  2VQF C;  4AQY C;  3FCE A;  5KEI A;  3AF6 A;  5E7Q A;  2P2B A;  1IBL C;  1XDX A;  5AE3 A;  3LNO A;  4ISB A;  5CZV A;  1XNQ C;  4PUH A;  1XRA A;  2MMA B;  1UKK A;  3LGX A;  4RVO A;  4R1L A;  1K0R A;  4JI8 C;  2QW0 X;  2OPL A;  5BSW A;  5CZX A;  2UXC C;  4DV3 C;  3I08 A;  3L95 X;  4DV4 C;  4OX9 C;  4G1I A;  1MD9 A;  3AY0 A;  1M6X A;  1XRC A;  3RV2 A;  4FUT A;  2AYA A;  3NI2 A;  4WS9 A; 
#chains in the Genus database with same CATH homology
 3NYQ A;  1V25 A;  1HR0 C;  4IR7 A;  1HNZ C;  3A9V A;  4DR3 C;  4B3R C;  1N34 C;  2HJG A;  3N2Q A;  3J7A D;  1HNW C;  2BH1 X;  4LFB C;  5AE2 A;  1XNR C;  4G37 A;  4X65 C;  2CXC A;  4DG8 A;  2WP0 C;  3R9X A;  3CW8 X;  5KYV A;  1O9T A;  3VNS A;  1MKY A;  3T1H C;  1HNX C;  4BC7 A;  5LMN C;  1QM4 A;  1N36 C;  4DCS A;  3NYR A;  4DR6 C;  2ASB A;  4I9G A;  4D56 A;  4K0B A;  5A1G A;  3R44 A;  4L7I A;  1P7L A;  2EGT A;  3PES A;  5IWA C;  1WF3 A;  5BR8 C;  4ODJ A;  5A2Q D;  2PN2 A;  2DPL A;  3EER A;  3KXW A;  3OTO C;  2D1R A;  4IZ6 A;  2D28 C;  3SO4 A;  2E5L C;  4XX2 A;  4DR7 C;  3A4I A;  2ATW A;  3J81 D;  1N2F A;  2ZM6 C;  2UU9 C;  1QWI A;  3TUF A;  4DCU A;  3CW9 A;  3L8C A;  4DG9 A;  4DR4 C;  4DR5 C;  3T1Y C;  4GKK C;  3GPC A;  1ULT A;  1PG3 A;  3TDE A;  4DV5 C;  3DAY A;  4PHT A;  5BUS A;  4JV5 C;  2E8F A;  5K8F A;  4X64 C;  1FUG A;  4GS5 A;  4DV1 C;  5IFI A;  3G7S A;  4YY3 C;  5BSM A;  2DYJ A;  5DV9 A;  4DV0 C;  4LFC C;  1JOS A;  1MDB A;  3IEV A;  2UXB C;  2QVY X;  2QL8 A;  5IT9 D;  2VZE A;  1BA3 A;  2D7V A;  1ML8 A;  4PZP A;  3TQI A;  4HPV A;  4BC9 A;  2YCB A;  5AE1 A;  3B7W A;  2UUB C;  2PRO A;  4GXQ A;  5T8T A;  4RLQ A;  1YJ7 A;  3IML A;  1XRB A;  3PRO C;  4JI1 C;  4DR1 C;  3A9U A;  1VLA A;  4BBY A;  4KTV A;  5JRH A;  2JMP A;  2P20 A;  2HHH C;  4L4Q A;  2F4V C;  1XMQ C;  3GR1 A;  4X62 C;  2E8E A;  4TPS B;  4MTN A;  5FLX D;  1ZB8 A;  2QVZ X;  4RLF A;  2P02 A;  1USP A;  1USP B;  3E7X A;  2ONF A;  4X66 C;  4RMN A;  4FTF A;  4DV7 C;  4PRO C;  5BSU A;  1J5E C;  1NYE A;  3FCC A;  3ETC A;  4YHH C;  4LF4 C;  2OPL B;  3EQ6 A;  3H2T A;  1O92 A;  4JI3 C;  1LQL A;  3DHV A;  2XR1 A;  4KTT A;  2D1S A;  4DCT A;  4ZLP A;  1MXA A;  1N33 C;  4RVN A;  3N54 B;  5KYT A;  1EGA A;  2WD9 A;  1MXB A;  1RG9 A;  4B3S C;  5H9U A;  4FUQ A;  4WV3 A;  2BJO A;  4GKJ C;  3GKU A;  1IBM C;  1PG4 A;  2VQE C;  5LMU C;  2QVX X;  3IPL A;  4D4I A;  3GR0 A;  5K85 A;  4G36 A;  3AF5 A;  3ETO A;  4KHP C;  4JYA C;  4RM3 A;  3VNR A;  1AMU A;  2P2Q A;  2D1Q A;  2YWB A;  1LCI A;  4GXR A;  1WH9 A;  4NXM C;  4BCA A;  2D1T A;  2VSQ A;  4B3M C;  3J80 D;  5A19 A;  3C5E A;  3RG2 A;  3UZ0 A;  4R1M A;  2P2J A;  5BSV A;  1KKG A;  3NPD A;  4LF6 C;  3LUS A;  5BST A;  4OYC A;  5A1I A;  2E0G A;  4I9F A;  3LNV A;  4LE5 A;  2Y4N A;  5GTD A;  1IBK C;  4JI6 C;  4LF8 C;  2P2M A;  4JI2 C;  4LF7 C;  4JM1 A;  4BSZ A;  3IEU A;  1N32 C;  2UUC C;  3PBK A;  1ZB9 A;  4LF9 C;  4ZJZ A;  5BUQ A;  2E7G A;  4DCV A;  4LF5 C;  4DV2 C;  3E7W A;  1GPM A;  4U5Y D;  4K0K C;  1FJG C;  5BUR A;  3LAX A;  1XMO C;  2P2F A;  4MH4 A;  1T5H X;  1RY2 A;  4DR2 C;  2D27 A;  3I07 A;  3DLP X;  3CJE A;  4JI5 C;  1MXC A;  1MDF A;  4OXI A;  4JI0 C;  2V7B A;  4NDN A;  4LFA C;  3UOW A;  3VNQ A;  2E8C A;  1I94 C;  3JAM D;  1V26 A;  1O93 A;  2UXD C;  4B3T C;  2OBV A;  4L2Z A;  2PT7 G;  4R0M A;  5BSR A;  1HH2 P;  2KZF A;  4DUY C;  4D57 A;  4DV6 C;  2OO4 A;  5ADZ A;  1PA4 A;  5T8S A;  4EAT A;  4JI4 C;  2YWC A;  4JI7 C;  4D4G A;  3S82 A;  4DUZ C;  3R9W A;  4NOZ A;  4RM2 A;  2UUA C;  1T5D X;  1L2F A;  4NXN C;  1O90 A;  2CY1 A;  2Y27 A;  2Y4O A;  2VQF C;  4AQY C;  3FCE A;  5KEI A;  3AF6 A;  5E7Q A;  2P2B A;  1IBL C;  5AE3 A;  5CZV A;  4ISB A;  1XNQ C;  1XRA A;  1UKK A;  3LGX A;  4RVO A;  4R1L A;  1K0R A;  4JI8 C;  2QW0 X;  2OPL A;  5BSW A;  5CZX A;  2UXC C;  4DV3 C;  3I08 A;  3L95 X;  4DV4 C;  4OX9 C;  4G1I A;  1MD9 A;  1XRC A;  3RV2 A;  4FUT A;  2AYA A;  3NI2 A;  4WS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...