2ZM6C

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2zm6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2zm6C02
3I07A 1UKKA 2ONFA 3R9XA 1N2FA 1USPA 5IT9D 4X62C 2YCBA 1XMQC 2VQEC 3T1HC 1IBMC 4DR7C 3J81D 2OPLB 4JI6C 4LF6C 4DCTA 1J5EC 1I94C 2HJGA 2ZM6C 2UUAC 4BSZA 4JV5C 4DCVA 3LUSA 4K0KC 1HNXC 1IBLC 1FJGC 3R9WA 2JMPA 4B3SC 4NXNC 4DR1C 4DR5C 4JI0C 4LF8C 4DUYC 1WH9A 5LMUC 1PA4A 3J7AD 3OTOC 4DUZC 4DV2C 4DR3C 2ASBA 4GKJC 2ATWA 3AF6A 2XR1A 2E8EA 4LF5C 4DR4C 4DV5C 5A2QD 2PN2A 4DV4C 4LFCC 1USPB 4JI3C 4OX9C 4B3TC 4DV6C 1XNQC 4JI8C 2UXBC 1N34C 1N32C 2CXCA 1JOSA 4DV1C 2PT7G 4XX2A 4JYAC 2HHHC 2UXCC 5IWAC 2DYJA 3GKUA 1L2FA 4DV3C 4NXMC 1EGAA 4GKKC 4DR6C 1QWIA 4DR2C 1VLAA 4YY3C 4JI5C 1WF3A 2VQFC 3T1YC 3JAMD 4LFAC 4X66C 4JI2C 4X65C 2E5LC 4LFBC 4MTNA 4DCSA 1HNWC 5BR8C 1HNZC 1MKYA 2UUBC 4LF4C 4DV7C 2QL8A 4JI1C 4LF9C 2UXDC 1NYEA 5LMNC 1IBKC 1HH2P 1LQLA 2OPLA 1K0RA 2EGTA 2KZFA 2E8FA 4B3MC 1XMOC 5FLXD 4JI7C 1ZB8A 4JI4C 3J80D 2UUCC 4B3RC 1ZB9A 1XNRC 3EERA 2F4VC 1N36C 4LF7C 1ML8A 4MH4A 4YHHC 4NOZA 1N33C 1HR0C 4DV0C 3IEUA 4DCUA 2BJOA 4KHPC 2E7GA 1KKGA 3CJEA 4X64C 4AQYC 2E8CA 3IEVA 2UU9C 2D7VA 3AF5A 2CY1A
chains in the Genus database with same CATH superfamily
1UKKA 4OXIA 3UX2A 2PG1E 4PHTA 4DG8A 1BA3A 2VQEC 2OBVA 3PBKA 4DCTA 4PUHA 2HJGA 2ZM6C 5BSVA 4ISBA 2AYAA 4JV5C 5A1GA 4K0KC 2P2QA 4OYCA 1IBLC 3R9WA 5AE2A 2YWCA 2D1QA 3CQ2A 4DR5C 4GKJC 3AF6A 2E8EA 2MM9A 1XRCA 5E7QA 4LE5A 4GXRA 4B3TC 4JI8C 1N32C 1JOSA 4DV1C 2PT7G 5BUSA 4FUQA 4IR7A 5LCIA 4BCAA 4RVOA 1RY2A 1V25A 1YJ7A 1O92A 4TPSB 3S82A 3GKUA 2D27A 4GKKC 1GPMA 1QWIA 3I08A 4DR2C 4ZJZA 3E7XA 5CZXA 2VQFC 3GPCA 5AE1A 5BSWA 4X65C 5IFIA 4PUIA 2M5HA 4JI1C 2UXDC 1NYEA 4G36A 1HH2P 3DAYA 2JNVA 2VSQA 1NY8A 4B3MC 5FLXD 2P02A 1ZB8A 4B3RC 3LAXA 1N36C 4YHHC 4NOZA 1N33C 4DV0C 1MDFA 4KHPC 1KKGA 2E7GA 3CJEA 4X64C 1T5HX 2E8CA 3ETCA 2MCQA 4RVNA 2WP0C 2P2BA 4DG9A 3R9XA 2D1TA 3T1HC 1MD9A 4DR7C 1T5DX 2OPLB 1J5EC 5ADZA 2UUAC 2ZZMA 1MXBA 4RM2A 4DCVA 3LUSA 5T8TA 4I9GA 2JMPA 4B3SC 4NXNC 3K6RA 2D28C 3L95X 4DR1C 3UZ0A 2WD9A 4JI0C 4LF8C 5LMUC 4DR3C 1V26A 4RMNA 4LF5C 3TQIA 3ETOA 3UOWA 4DV4C 4LFCC 1USPB 4JI3C 1O9TA 4D4GA 3A4IA 1XDXA 2Y4OA 4KTVA 5BURA 2P2MA 1IB8A 4XX2A 4JYAC 3E7WA 2UXCC 2Z51A 3NI2A 3G7SA 4RLFA 5IWAC 3H2TA 3DHVA 4PUGA 3DLPX 1VLAA 4YY3C 1WF3A 4L2ZA 2ZZNA 4D56A 4JI2C 5KYVA 3NYQA 4ODJA 1HNWC 3FCCA 2UUBC 2QVXX 4ZLPA 3GR0A 5LMNC 2OPLA 1K0RA 3A25A 4FUTA 5AE3A 2DPLA 1XMOC 3J80D 4D57A 2DHMA 2M5OA 2F4VC 3N2QA 5KEIA 4NDNA 4LF7C 1ML8A 4MH4A 3VNSA 4KTTA 5BSUA 2BJOA 3VNRA 1PG4A 1PU1A 4GXQA 2V7BA 2P2FA 3CQ3A 4K0BA 2CY1A 3I07A 3NPDA 4EATA 3VNQA 5K8FA 1USPA 3UX3A 1XMQC 2VZEA 2Y27A 4LF6C 1I94C 2Y4NA 4BBYA 3FCEA 4BSZA 2MMAB 1PG3A 4BC9A 1FJGC 2D1SA 1XRAA 3EQ6A 4DUYC 1WH9A 4PROC 1PA4A 3J7AD 4DUZC 5A19A 4DV2C 2ATWA 4JM1A 4RM3A 1P4EA 2XR1A 3TDEA 4DR4C 4DV5C 3FM7A 1P7LA 2PN2A 2KDNA 1VEHA 1XNQC 2UXBC 1N34C 4GS5A 1MDBA 2PROA 3TUFA 4D4IA 4HPVA 3CQ1A 4NXMC 1FUGA 1WCJA 3T1YC 1P4EC 3A9VA 4L4QA 4R0MA 5BSTA 4LFAC 4LFBC 4MTNA 5BUQA 3A26A 1MKYA 4LF4C 3PESA 2QL8A 4DV7C 4RLQA 2EGTA 1M6XA 1FLOA 4WV3A 2KZFA 3O2EA 4JI7C 4JI4C 4U5YD 2ZTBA 1HR0C 3IEUA 4AQYC 4G37A 2QVYX 3CW8X 2D7VA 1XRBA 2ONFA 2E0GA 1N2FA 2D1RA 5IT9D 4X62C 2YCBA 1QM4A 1IBMC 1M6XC 3J81D 5K85A 4JI6C 3NYRA 5CZVA 5A1IA 2CU6A 3A9UA 5T8SA 1HNXC 2P20A 3C5EA 3OTOC 4BC7A 2ASBA 1UWDA 3N54B 3TR3A 5A2QD 3IMLA 1XS3A 2OO4A 3IPLA 2NCLA 3LNOA 1AMUA 4OX9C 4DV6C 3CW9A 4PZPA 2CXCA 1XHJA 3PROC 2YX1A 4R1LA 3LGXA 4IZ6A 2HHHC 1O90A 5GTDA 3RV2A 2DYJA 4G1IA 4WS9A 3RG2A 4R1MA 1L2FA 4DV3C 1EGAA 4DR6C 2KZ0A 5JRHA 5DV9A 4JI5C 3KXWA 1O93A 3JAMD 2BH1X 4X66C 2YWBA 4L7IA 2E5LC 5BSRA 4DCSA 5BR8C 1HNZC 1RG9A 3B7WA 4LF9C 2QVZX 1IBKC 3LNVA 1V60A 1LQLA 3R44A 2E8FA 5H9UA 2UUCC 1MXCA 1ZB9A 1XNRC 3EERA 1LCIA 5BSMA 3GR1A 4I9FA 2QW0X 3UEBA 4FTFA 3L8CA 1MXAA 4DCUA 1YGTA 2P2JA 3SO4A 1ULTA 5KYTA 3IEVA 3AY0A 1TH5A 2UU9C 3AF5A
chains in the Genus database with same CATH topology
1UKKA 4OXIA 4PHTA 4DG8A 1BA3A 2VQEC 2OBVA 3PBKA 4DCTA 2HJGA 2ZM6C 5BSVA 4ISBA 2AYAA 4JV5C 5A1GA 4K0KC 2P2QA 4OYCA 1IBLC 3R9WA 5AE2A 2YWCA 2D1QA 4DR5C 4GKJC 3AF6A 2E8EA 1XRCA 5E7QA 4LE5A 4GXRA 4B3TC 4JI8C 1N32C 1JOSA 4DV1C 2PT7G 5BUSA 4FUQA 4IR7A 4BCAA 4RVOA 1RY2A 1V25A 1YJ7A 1O92A 4TPSB 3S82A 3GKUA 2D27A 4GKKC 1GPMA 1QWIA 3I08A 4DR2C 4ZJZA 3E7XA 5CZXA 2VQFC 3GPCA 5AE1A 5BSWA 4X65C 5IFIA 4JI1C 2UXDC 1NYEA 4G36A 1HH2P 3DAYA 2VSQA 4B3MC 5FLXD 2P02A 1ZB8A 4B3RC 3LAXA 1N36C 4YHHC 4NOZA 1N33C 4DV0C 1MDFA 4KHPC 1KKGA 2E7GA 3CJEA 4X64C 1T5HX 2E8CA 3ETCA 4RVNA 2WP0C 2P2BA 4DG9A 3R9XA 2D1TA 3T1HC 1MD9A 4DR7C 1T5DX 2OPLB 1J5EC 5ADZA 2UUAC 1MXBA 4RM2A 4DCVA 3LUSA 5T8TA 4I9GA 2JMPA 4B3SC 4NXNC 2D28C 3L95X 4DR1C 3UZ0A 2WD9A 4JI0C 4LF8C 5LMUC 4DR3C 1V26A 4RMNA 4LF5C 3TQIA 3ETOA 3UOWA 4DV4C 4LFCC 1USPB 4JI3C 1O9TA 4D4GA 3A4IA 2Y4OA 4KTVA 5BURA 2P2MA 4XX2A 4JYAC 3E7WA 2UXCC 3NI2A 3G7SA 4RLFA 5IWAC 3H2TA 3DHVA 3DLPX 1VLAA 4YY3C 1WF3A 4L2ZA 4D56A 4JI2C 5KYVA 3NYQA 4ODJA 1HNWC 3FCCA 2UUBC 2QVXX 4ZLPA 3GR0A 5LMNC 2OPLA 1K0RA 4FUTA 5AE3A 2DPLA 1XMOC 3J80D 4D57A 2F4VC 3N2QA 5KEIA 4NDNA 4LF7C 1ML8A 4MH4A 3VNSA 4KTTA 5BSUA 2BJOA 3VNRA 1PG4A 4GXQA 2V7BA 2P2FA 4K0BA 2CY1A 3I07A 3NPDA 4EATA 3VNQA 5K8FA 1USPA 1XMQC 2VZEA 2Y27A 4LF6C 1I94C 2Y4NA 4BBYA 3FCEA 4BSZA 1PG3A 4BC9A 1FJGC 2D1SA 1XRAA 3EQ6A 4DUYC 1WH9A 4PROC 1PA4A 3J7AD 4DUZC 5A19A 4DV2C 2ATWA 4JM1A 4RM3A 2XR1A 3TDEA 4DR4C 4DV5C 1P7LA 2PN2A 1XNQC 2UXBC 1N34C 4GS5A 1MDBA 2PROA 3TUFA 4D4IA 4HPVA 4NXMC 1FUGA 3T1YC 3A9VA 4L4QA 4R0MA 5BSTA 4LFAC 4LFBC 4MTNA 5BUQA 1MKYA 4LF4C 3PESA 2QL8A 4DV7C 4RLQA 2EGTA 4WV3A 2KZFA 4JI7C 4JI4C 4U5YD 1HR0C 3IEUA 4AQYC 4G37A 2QVYX 3CW8X 2D7VA 1XRBA 2ONFA 2E0GA 1N2FA 2D1RA 5IT9D 4X62C 2YCBA 1QM4A 1IBMC 3J81D 5K85A 4JI6C 3NYRA 5CZVA 5A1IA 3A9UA 5T8SA 1HNXC 2P20A 3C5EA 3OTOC 4BC7A 2ASBA 3N54B 5A2QD 3IMLA 2OO4A 3IPLA 1AMUA 4OX9C 4DV6C 3CW9A 4PZPA 2CXCA 3PROC 4R1LA 3LGXA 4IZ6A 2HHHC 1O90A 5GTDA 3RV2A 2DYJA 4G1IA 4WS9A 3RG2A 4R1MA 1L2FA 4DV3C 1EGAA 4DR6C 5JRHA 5DV9A 4JI5C 3KXWA 1O93A 3JAMD 2BH1X 4X66C 2YWBA 4L7IA 2E5LC 5BSRA 4DCSA 5BR8C 1HNZC 1RG9A 3B7WA 4LF9C 2QVZX 1IBKC 3LNVA 3R44A 1LQLA 2E8FA 5H9UA 2UUCC 1MXCA 1ZB9A 1XNRC 3EERA 1LCIA 5BSMA 3GR1A 4I9FA 2QW0X 4FTFA 3L8CA 1MXAA 4DCUA 2P2JA 3SO4A 1ULTA 5KYTA 3IEVA 2UU9C 3AF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I07 A;  1UKK A;  2ONF A;  3R9X A;  1N2F A;  1USP A;  5IT9 D;  4X62 C;  2YCB A;  1XMQ C;  2VQE C;  3T1H C;  1IBM C;  4DR7 C;  3J81 D;  2OPL B;  4JI6 C;  4LF6 C;  4DCT A;  1J5E C;  1I94 C;  2HJG A;  2ZM6 C;  2UUA C;  4BSZ A;  4JV5 C;  4DCV A;  3LUS A;  4K0K C;  1HNX C;  1IBL C;  1FJG C;  3R9W A;  2JMP A;  4B3S C;  4NXN C;  4DR1 C;  4DR5 C;  4JI0 C;  4LF8 C;  4DUY C;  1WH9 A;  5LMU C;  1PA4 A;  3J7A D;  3OTO C;  4DUZ C;  4DV2 C;  4DR3 C;  2ASB A;  4GKJ C;  2ATW A;  3AF6 A;  2XR1 A;  2E8E A;  4LF5 C;  4DR4 C;  4DV5 C;  5A2Q D;  2PN2 A;  4DV4 C;  4LFC C;  1USP B;  4JI3 C;  4OX9 C;  4B3T C;  4DV6 C;  1XNQ C;  4JI8 C;  2UXB C;  1N34 C;  1N32 C;  2CXC A;  1JOS A;  4DV1 C;  2PT7 G;  4XX2 A;  4JYA C;  2HHH C;  2UXC C;  5IWA C;  2DYJ A;  3GKU A;  1L2F A;  4DV3 C;  4NXM C;  1EGA A;  4GKK C;  4DR6 C;  1QWI A;  4DR2 C;  1VLA A;  4YY3 C;  4JI5 C;  1WF3 A;  2VQF C;  3T1Y C;  3JAM D;  4LFA C;  4X66 C;  4JI2 C;  4X65 C;  2E5L C;  4LFB C;  4MTN A;  4DCS A;  1HNW C;  5BR8 C;  1HNZ C;  1MKY A;  2UUB C;  4LF4 C;  4DV7 C;  2QL8 A;  4JI1 C;  4LF9 C;  2UXD C;  1NYE A;  5LMN C;  1IBK C;  1HH2 P;  1LQL A;  2OPL A;  1K0R A;  2EGT A;  2KZF A;  2E8F A;  4B3M C;  1XMO C;  5FLX D;  4JI7 C;  1ZB8 A;  4JI4 C;  3J80 D;  2UUC C;  4B3R C;  1ZB9 A;  1XNR C;  3EER A;  2F4V C;  1N36 C;  4LF7 C;  1ML8 A;  4MH4 A;  4YHH C;  4NOZ A;  1N33 C;  1HR0 C;  4DV0 C;  3IEU A;  4DCU A;  2BJO A;  4KHP C;  2E7G A;  1KKG A;  3CJE A;  4X64 C;  4AQY C;  2E8C A;  3IEV A;  2UU9 C;  2D7V A;  3AF5 A;  2CY1 A; 
#chains in the Genus database with same CATH topology
 1UKK A;  4OXI A;  3UX2 A;  2PG1 E;  4PHT A;  4DG8 A;  1BA3 A;  2VQE C;  2OBV A;  3PBK A;  4DCT A;  4PUH A;  2HJG A;  2ZM6 C;  5BSV A;  4ISB A;  2AYA A;  4JV5 C;  5A1G A;  4K0K C;  2P2Q A;  4OYC A;  1IBL C;  3R9W A;  5AE2 A;  2YWC A;  2D1Q A;  3CQ2 A;  4DR5 C;  4GKJ C;  3AF6 A;  2E8E A;  2MM9 A;  1XRC A;  5E7Q A;  4LE5 A;  4GXR A;  4B3T C;  4JI8 C;  1N32 C;  1JOS A;  4DV1 C;  2PT7 G;  5BUS A;  4FUQ A;  4IR7 A;  5LCI A;  4BCA A;  4RVO A;  1RY2 A;  1V25 A;  1YJ7 A;  1O92 A;  4TPS B;  3S82 A;  3GKU A;  2D27 A;  4GKK C;  1GPM A;  1QWI A;  3I08 A;  4DR2 C;  4ZJZ A;  3E7X A;  5CZX A;  2VQF C;  3GPC A;  5AE1 A;  5BSW A;  4X65 C;  5IFI A;  4PUI A;  2M5H A;  4JI1 C;  2UXD C;  1NYE A;  4G36 A;  1HH2 P;  3DAY A;  2JNV A;  2VSQ A;  1NY8 A;  4B3M C;  5FLX D;  2P02 A;  1ZB8 A;  4B3R C;  3LAX A;  1N36 C;  4YHH C;  4NOZ A;  1N33 C;  4DV0 C;  1MDF A;  4KHP C;  1KKG A;  2E7G A;  3CJE A;  4X64 C;  1T5H X;  2E8C A;  3ETC A;  2MCQ A;  4RVN A;  2WP0 C;  2P2B A;  4DG9 A;  3R9X A;  2D1T A;  3T1H C;  1MD9 A;  4DR7 C;  1T5D X;  2OPL B;  1J5E C;  5ADZ A;  2UUA C;  2ZZM A;  1MXB A;  4RM2 A;  4DCV A;  3LUS A;  5T8T A;  4I9G A;  2JMP A;  4B3S C;  4NXN C;  3K6R A;  2D28 C;  3L95 X;  4DR1 C;  3UZ0 A;  2WD9 A;  4JI0 C;  4LF8 C;  5LMU C;  4DR3 C;  1V26 A;  4RMN A;  4LF5 C;  3TQI A;  3ETO A;  3UOW A;  4DV4 C;  4LFC C;  1USP B;  4JI3 C;  1O9T A;  4D4G A;  3A4I A;  1XDX A;  2Y4O A;  4KTV A;  5BUR A;  2P2M A;  1IB8 A;  4XX2 A;  4JYA C;  3E7W A;  2UXC C;  2Z51 A;  3NI2 A;  3G7S A;  4RLF A;  5IWA C;  3H2T A;  3DHV A;  4PUG A;  3DLP X;  1VLA A;  4YY3 C;  1WF3 A;  4L2Z A;  2ZZN A;  4D56 A;  4JI2 C;  5KYV A;  3NYQ A;  4ODJ A;  1HNW C;  3FCC A;  2UUB C;  2QVX X;  4ZLP A;  3GR0 A;  5LMN C;  2OPL A;  1K0R A;  3A25 A;  4FUT A;  5AE3 A;  2DPL A;  1XMO C;  3J80 D;  4D57 A;  2DHM A;  2M5O A;  2F4V C;  3N2Q A;  5KEI A;  4NDN A;  4LF7 C;  1ML8 A;  4MH4 A;  3VNS A;  4KTT A;  5BSU A;  2BJO A;  3VNR A;  1PG4 A;  1PU1 A;  4GXQ A;  2V7B A;  2P2F A;  3CQ3 A;  4K0B A;  2CY1 A;  3I07 A;  3NPD A;  4EAT A;  3VNQ A;  5K8F A;  1USP A;  3UX3 A;  1XMQ C;  2VZE A;  2Y27 A;  4LF6 C;  1I94 C;  2Y4N A;  4BBY A;  3FCE A;  4BSZ A;  2MMA B;  1PG3 A;  4BC9 A;  1FJG C;  2D1S A;  1XRA A;  3EQ6 A;  4DUY C;  1WH9 A;  4PRO C;  1PA4 A;  3J7A D;  4DUZ C;  5A19 A;  4DV2 C;  2ATW A;  4JM1 A;  4RM3 A;  1P4E A;  2XR1 A;  3TDE A;  4DR4 C;  4DV5 C;  3FM7 A;  1P7L A;  2PN2 A;  2KDN A;  1VEH A;  1XNQ C;  2UXB C;  1N34 C;  4GS5 A;  1MDB A;  2PRO A;  3TUF A;  4D4I A;  4HPV A;  3CQ1 A;  4NXM C;  1FUG A;  1WCJ A;  3T1Y C;  1P4E C;  3A9V A;  4L4Q A;  4R0M A;  5BST A;  4LFA C;  4LFB C;  4MTN A;  5BUQ A;  3A26 A;  1MKY A;  4LF4 C;  3PES A;  2QL8 A;  4DV7 C;  4RLQ A;  2EGT A;  1M6X A;  1FLO A;  4WV3 A;  2KZF A;  3O2E A;  4JI7 C;  4JI4 C;  4U5Y D;  2ZTB A;  1HR0 C;  3IEU A;  4AQY C;  4G37 A;  2QVY X;  3CW8 X;  2D7V A;  1XRB A;  2ONF A;  2E0G A;  1N2F A;  2D1R A;  5IT9 D;  4X62 C;  2YCB A;  1QM4 A;  1IBM C;  1M6X C;  3J81 D;  5K85 A;  4JI6 C;  3NYR A;  5CZV A;  5A1I A;  2CU6 A;  3A9U A;  5T8S A;  1HNX C;  2P20 A;  3C5E A;  3OTO C;  4BC7 A;  2ASB A;  1UWD A;  3N54 B;  3TR3 A;  5A2Q D;  3IML A;  1XS3 A;  2OO4 A;  3IPL A;  2NCL A;  3LNO A;  1AMU A;  4OX9 C;  4DV6 C;  3CW9 A;  4PZP A;  2CXC A;  1XHJ A;  3PRO C;  2YX1 A;  4R1L A;  3LGX A;  4IZ6 A;  2HHH C;  1O90 A;  5GTD A;  3RV2 A;  2DYJ A;  4G1I A;  4WS9 A;  3RG2 A;  4R1M A;  1L2F A;  4DV3 C;  1EGA A;  4DR6 C;  2KZ0 A;  5JRH A;  5DV9 A;  4JI5 C;  3KXW A;  1O93 A;  3JAM D;  2BH1 X;  4X66 C;  2YWB A;  4L7I A;  2E5L C;  5BSR A;  4DCS A;  5BR8 C;  1HNZ C;  1RG9 A;  3B7W A;  4LF9 C;  2QVZ X;  1IBK C;  3LNV A;  1V60 A;  1LQL A;  3R44 A;  2E8F A;  5H9U A;  2UUC C;  1MXC A;  1ZB9 A;  1XNR C;  3EER A;  1LCI A;  5BSM A;  3GR1 A;  4I9F A;  2QW0 X;  3UEB A;  4FTF A;  3L8C A;  1MXA A;  4DCU A;  1YGT A;  2P2J A;  3SO4 A;  1ULT A;  5KYT A;  3IEV A;  3AY0 A;  1TH5 A;  2UU9 C;  3AF5 A; 
#chains in the Genus database with same CATH homology
 1UKK A;  4OXI A;  4PHT A;  4DG8 A;  1BA3 A;  2VQE C;  2OBV A;  3PBK A;  4DCT A;  2HJG A;  2ZM6 C;  5BSV A;  4ISB A;  2AYA A;  4JV5 C;  5A1G A;  4K0K C;  2P2Q A;  4OYC A;  1IBL C;  3R9W A;  5AE2 A;  2YWC A;  2D1Q A;  4DR5 C;  4GKJ C;  3AF6 A;  2E8E A;  1XRC A;  5E7Q A;  4LE5 A;  4GXR A;  4B3T C;  4JI8 C;  1N32 C;  1JOS A;  4DV1 C;  2PT7 G;  5BUS A;  4FUQ A;  4IR7 A;  4BCA A;  4RVO A;  1RY2 A;  1V25 A;  1YJ7 A;  1O92 A;  4TPS B;  3S82 A;  3GKU A;  2D27 A;  4GKK C;  1GPM A;  1QWI A;  3I08 A;  4DR2 C;  4ZJZ A;  3E7X A;  5CZX A;  2VQF C;  3GPC A;  5AE1 A;  5BSW A;  4X65 C;  5IFI A;  4JI1 C;  2UXD C;  1NYE A;  4G36 A;  1HH2 P;  3DAY A;  2VSQ A;  4B3M C;  5FLX D;  2P02 A;  1ZB8 A;  4B3R C;  3LAX A;  1N36 C;  4YHH C;  4NOZ A;  1N33 C;  4DV0 C;  1MDF A;  4KHP C;  1KKG A;  2E7G A;  3CJE A;  4X64 C;  1T5H X;  2E8C A;  3ETC A;  4RVN A;  2WP0 C;  2P2B A;  4DG9 A;  3R9X A;  2D1T A;  3T1H C;  1MD9 A;  4DR7 C;  1T5D X;  2OPL B;  1J5E C;  5ADZ A;  2UUA C;  1MXB A;  4RM2 A;  4DCV A;  3LUS A;  5T8T A;  4I9G A;  2JMP A;  4B3S C;  4NXN C;  2D28 C;  3L95 X;  4DR1 C;  3UZ0 A;  2WD9 A;  4JI0 C;  4LF8 C;  5LMU C;  4DR3 C;  1V26 A;  4RMN A;  4LF5 C;  3TQI A;  3ETO A;  3UOW A;  4DV4 C;  4LFC C;  1USP B;  4JI3 C;  1O9T A;  4D4G A;  3A4I A;  2Y4O A;  4KTV A;  5BUR A;  2P2M A;  4XX2 A;  4JYA C;  3E7W A;  2UXC C;  3NI2 A;  3G7S A;  4RLF A;  5IWA C;  3H2T A;  3DHV A;  3DLP X;  1VLA A;  4YY3 C;  1WF3 A;  4L2Z A;  4D56 A;  4JI2 C;  5KYV A;  3NYQ A;  4ODJ A;  1HNW C;  3FCC A;  2UUB C;  2QVX X;  4ZLP A;  3GR0 A;  5LMN C;  2OPL A;  1K0R A;  4FUT A;  5AE3 A;  2DPL A;  1XMO C;  3J80 D;  4D57 A;  2F4V C;  3N2Q A;  5KEI A;  4NDN A;  4LF7 C;  1ML8 A;  4MH4 A;  3VNS A;  4KTT A;  5BSU A;  2BJO A;  3VNR A;  1PG4 A;  4GXQ A;  2V7B A;  2P2F A;  4K0B A;  2CY1 A;  3I07 A;  3NPD A;  4EAT A;  3VNQ A;  5K8F A;  1USP A;  1XMQ C;  2VZE A;  2Y27 A;  4LF6 C;  1I94 C;  2Y4N A;  4BBY A;  3FCE A;  4BSZ A;  1PG3 A;  4BC9 A;  1FJG C;  2D1S A;  1XRA A;  3EQ6 A;  4DUY C;  1WH9 A;  4PRO C;  1PA4 A;  3J7A D;  4DUZ C;  5A19 A;  4DV2 C;  2ATW A;  4JM1 A;  4RM3 A;  2XR1 A;  3TDE A;  4DR4 C;  4DV5 C;  1P7L A;  2PN2 A;  1XNQ C;  2UXB C;  1N34 C;  4GS5 A;  1MDB A;  2PRO A;  3TUF A;  4D4I A;  4HPV A;  4NXM C;  1FUG A;  3T1Y C;  3A9V A;  4L4Q A;  4R0M A;  5BST A;  4LFA C;  4LFB C;  4MTN A;  5BUQ A;  1MKY A;  4LF4 C;  3PES A;  2QL8 A;  4DV7 C;  4RLQ A;  2EGT A;  4WV3 A;  2KZF A;  4JI7 C;  4JI4 C;  4U5Y D;  1HR0 C;  3IEU A;  4AQY C;  4G37 A;  2QVY X;  3CW8 X;  2D7V A;  1XRB A;  2ONF A;  2E0G A;  1N2F A;  2D1R A;  5IT9 D;  4X62 C;  2YCB A;  1QM4 A;  1IBM C;  3J81 D;  5K85 A;  4JI6 C;  3NYR A;  5CZV A;  5A1I A;  3A9U A;  5T8S A;  1HNX C;  2P20 A;  3C5E A;  3OTO C;  4BC7 A;  2ASB A;  3N54 B;  5A2Q D;  3IML A;  2OO4 A;  3IPL A;  1AMU A;  4OX9 C;  4DV6 C;  3CW9 A;  4PZP A;  2CXC A;  3PRO C;  4R1L A;  3LGX A;  4IZ6 A;  2HHH C;  1O90 A;  5GTD A;  3RV2 A;  2DYJ A;  4G1I A;  4WS9 A;  3RG2 A;  4R1M A;  1L2F A;  4DV3 C;  1EGA A;  4DR6 C;  5JRH A;  5DV9 A;  4JI5 C;  3KXW A;  1O93 A;  3JAM D;  2BH1 X;  4X66 C;  2YWB A;  4L7I A;  2E5L C;  5BSR A;  4DCS A;  5BR8 C;  1HNZ C;  1RG9 A;  3B7W A;  4LF9 C;  2QVZ X;  1IBK C;  3LNV A;  3R44 A;  1LQL A;  2E8F A;  5H9U A;  2UUC C;  1MXC A;  1ZB9 A;  1XNR C;  3EER A;  1LCI A;  5BSM A;  3GR1 A;  4I9F A;  2QW0 X;  4FTF A;  3L8C A;  1MXA A;  4DCU A;  2P2J A;  3SO4 A;  1ULT A;  5KYT A;  3IEV A;  2UU9 C;  3AF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...