2ZM6C

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2zm6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2zm6C02
4KHPC 4JI5C 5FLXD 1FJGC 4DV0C 4B3SC 4DV5C 4OX9C 2ATWA 1HNXC 5IT9D 2E5LC 1N32C 4LFCC 1WF3A 2VQEC 4DR5C 2OPLB 3CJEA 2UUBC 1IBKC 3OTOC 2ZM6C 4X66C 1N2FA 2XR1A 4DR2C 2CXCA 2BJOA 4JI8C 1QWIA 4DV2C 3J7AD 2QL8A 1N33C 4B3RC 1XMQC 4MH4A 2ONFA 4LF9C 4DCSA 4BSZA 1JOSA 2PT7G 2OPLA 2E8CA 1USPA 3J80D 4K0KC 2UXCC 4DR3C 3GKUA 3J81D 4LFAC 1N36C 3LUSA 4GKJC 2EGTA 2E7GA 4B3TC 1XNRC 4XX2A 2UUAC 3EERA 1HNWC 2E8EA 4DV6C 4AQYC 4DR4C 4DR1C 1XNQC 4JI6C 4LF4C 3R9XA 4DV7C 4X62C 2ASBA 1KKGA 2HHHC 2UUCC 1LQLA 4JI3C 1MKYA 5LMNC 5BR8C 4GKKC 2UXBC 3AF6A 2HJGA 4LF8C 4DV1C 3AF5A 5LMUC 4JI4C 1ML8A 4B3MC 4DCTA 4DR6C 2DYJA 1I94C 4DR7C 4JI0C 3JAMD 4DUZC 4LF6C 4LF5C 4LF7C 4DUYC 1PA4A 1USPB 1L2FA 2F4VC 4JI2C 2E8FA 1NYEA 2YCBA 4NXNC 2UXDC 1J5EC 4JYAC 1UKKA 1IBLC 1EGAA 4LFBC 4DV4C 1K0RA 5A2QD 1XMOC 2CY1A 1ZB9A 3R9WA 4NOZA 4X65C 1ZB8A 1IBMC 3T1YC 3T1HC 2KZFA 4X64C 2UU9C 1VLAA 4JI7C 3I07A 1HNZC 2D7VA 2JMPA 1N34C 4YHHC 4MTNA 1WH9A 2PN2A 4NXMC 4DCUA 1HR0C 1HH2P 4DV3C 4YY3C 4JI1C 3IEVA 4JV5C 5IWAC 2VQFC 4DCVA 3IEUA
chains in the Genus database with same CATH superfamily
3RV2A 3I08A 5DV9A 1FJGC 2Y4NA 1AMUA 4DV5C 4OX9C 2ATWA 1HNXC 5BSVA 1WF3A 2VQEC 2OPLB 3TUFA 2Y27A 3OTOC 2ZM6C 1QWIA 4FUTA 3L8CA 4D57A 3VNQA 4G36A 3E7WA 4B3RC 2ONFA 1GPMA 5E7QA 1JOSA 2PT7G 5H9UA 2VSQA 3NYQA 3LAXA 3PBKA 4WV3A 4EATA 1XS3A 3GKUA 4OYCA 5K8FA 4LFAC 3UX2A 1YJ7A 4GKJC 2QVYX 4B3TC 5AE2A 4DR4C 2JNVA 4DV7C 4X62C 1KKGA 3O2EA 3LNVA 1TH5A 1YGTA 5LMNC 3TQIA 4DV1C 3DHVA 5K85A 3LNOA 4DUYC 1PA4A 2D1TA 2KZ0A 4JYAC 1UKKA 1EGAA 4DV4C 4OXIA 1ZB9A 4D4GA 2OBVA 2MMAB 3T1HC 2KZFA 3DLPX 3VNSA 1HNZC 5BSWA 3KXWA 3VNRA 4DCUA 3PROC 4K0BA 3NYRA 3IEVA 2P2BA 2ZZMA 3S82A 2VQFC 4DCVA 1UWDA 4PZPA 1N2FA 3H2TA 5T8SA 2ZZNA 1VEHA 2P2JA 2E5LC 4PUIA 4G1IA 2P20A 3NPDA 1O92A 4ISBA 2XR1A 2ZTBA 1T5HX 4I9GA 4JI8C 1MDFA 1PG3A 4HPVA 4DG8A 4MH4A 4BSZA 1RY2A 1M6XC 2E8CA 3CQ1A 1PU1A 1XRAA 1N36C 2P2MA 4TPSB 3LUSA 1V60A 3EERA 2M5HA 4AQYC 3K6RA 4GS5A 3TDEA 2HHHC 1P4EA 5BSUA 4L2ZA 3UEBA 3CW8X 5GTDA 4PHTA 5KYVA 4BCAA 5BR8C 4GKKC 2UXBC 3A4IA 4LF8C 1O9TA 1ML8A 4B3MC 4DCTA 1XDXA 4ZLPA 4BBYA 3ETOA 4DR7C 5KEIA 4JI0C 3FM7A 3UZ0A 4DUZC 4LF6C 4PROC 2F4VC 1RG9A 4JI2C 2D1SA 3G7SA 2YCBA 2UXDC 5BSRA 3CW9A 4LFBC 1V26A 3UX3A 2MM9A 5BUSA 2D28C 3N2QA 3CQ3A 3NI2A 2JMPA 2MCQA 2D1QA 4YHHC 1WH9A 2PN2A 4NXMC 1HH2P 4D56A 5AE3A 4RLQA 1XHJA 3AY0A 2NCLA 3IEUA 3R44A 5FLXD 4IR7A 5JRHA 3A9UA 4BC9A 4B3SC 4RVNA 3A26A 5T8TA 1N32C 2OO4A 2UUBC 2V7BA 4D4IA 3FCCA 4RLFA 4R1LA 4DR2C 5LCIA 1QM4A 3J7AD 2QL8A 2D27A 1XMQC 4LF9C 4DCSA 1XRBA 1V25A 4ODJA 1USPA 3B7WA 3J80D 4K0KC 4DR3C 1MDBA 2EGTA 3ETCA 1XNRC 4XX2A 1MXAA 3DAYA 3A25A 4LE5A 4JI6C 3GR0A 4LF4C 3LGXA 3R9XA 3C5EA 4PUGA 2ASBA 4RM3A 5KYTA 4JI3C 1MD9A 3FCEA 3UOWA 3AF6A 2D1RA 3AF5A 2QVXX 5BSMA 4JI4C 2DYJA 2P2QA 3JAMD 3E7XA 4LF7C 1USPB 1L2FA 1NYEA 4G37A 1FLOA 2DHMA 1J5EC 1IBLC 5ADZA 4R1MA 2CY1A 4RM2A 2WP0C 3R9WA 1ZB8A 1IBMC 1MXBA 4FTFA 4JM1A 2UU9C 1VLAA 4RMNA 3I07A 5BURA 2YX1A 1FUGA 1HR0C 2DPLA 4JI1C 5IWAC 2PROA 2P2FA 4KHPC 3N54B 4JI5C 4ZJZA 4DV0C 4RVOA 5IT9D 3EQ6A 4LFCC 4DR5C 5BUQA 3CJEA 1T5DX 4WS9A 1IBKC 4BC7A 5BSTA 5A19A 4X66C 1O93A 1XRCA 2CXCA 4DG9A 2BJOA 4DV2C 1IB8A 3SO4A 1P4EC 3IMLA 1N33C 2QVZX 2OPLA 4L7IA 1NY8A 3PESA 4L4QA 2UXCC 3J81D 4KTTA 2PG1E 2AYAA 2E7GA 1P7LA 4R0MA 2E0GA 2UUAC 1M6XA 4U5YD 2M5OA 1HNWC 1ULTA 2E8EA 4DV6C 4DR1C 4FUQA 1XNQC 4KTVA 1BA3A 2VZEA 1LCIA 2UUCC 1LQLA 1MKYA 2HJGA 3L95X 5CZVA 5LMUC 2BH1X 2WD9A 1MXCA 4DR6C 1I94C 4I9FA 5AE1A 4IZ6A 4LF5C 5CZXA 3GR1A 1O90A 3GPCA 2E8FA 5A1IA 4NXNC 3TR3A 1WCJA 5A1GA 1K0RA 5A2QD 1XMOC 2QW0X 2Y4OA 3IPLA 4NOZA 4PUHA 4GXQA 2CU6A 4X65C 2YWCA 3T1YC 4GXRA 2P02A 4NDNA 3A9VA 4X64C 3CQ2A 2Z51A 4JI7C 1PG4A 2D7VA 1N34C 2KDNA 4MTNA 5IFIA 4DV3C 4YY3C 2YWBA 4JV5C 3RG2A
chains in the Genus database with same CATH topology
3RV2A 3I08A 5DV9A 1FJGC 2Y4NA 1AMUA 4DV5C 4OX9C 2ATWA 1HNXC 5BSVA 1WF3A 2VQEC 2OPLB 3TUFA 2Y27A 3OTOC 2ZM6C 1QWIA 4FUTA 3L8CA 4D57A 3VNQA 4G36A 3E7WA 4B3RC 2ONFA 1GPMA 5E7QA 1JOSA 2PT7G 5H9UA 2VSQA 3NYQA 3LAXA 3PBKA 4WV3A 4EATA 3GKUA 4OYCA 5K8FA 4LFAC 1YJ7A 4GKJC 2QVYX 4B3TC 5AE2A 4DR4C 4DV7C 4X62C 1KKGA 3LNVA 5LMNC 3TQIA 4DV1C 3DHVA 5K85A 4DUYC 1PA4A 2D1TA 4JYAC 1UKKA 1EGAA 4DV4C 4OXIA 1ZB9A 4D4GA 2OBVA 3T1HC 2KZFA 3DLPX 3VNSA 1HNZC 5BSWA 3KXWA 3VNRA 4DCUA 3PROC 4K0BA 3NYRA 3IEVA 2P2BA 3S82A 2VQFC 4DCVA 4PZPA 1N2FA 3H2TA 5T8SA 2P2JA 2E5LC 4G1IA 2P20A 3NPDA 1O92A 4ISBA 2XR1A 1T5HX 4I9GA 4JI8C 1MDFA 1PG3A 4HPVA 4DG8A 4MH4A 4BSZA 1RY2A 2E8CA 1XRAA 1N36C 2P2MA 4TPSB 3LUSA 3EERA 4AQYC 4GS5A 3TDEA 2HHHC 5BSUA 4L2ZA 3CW8X 5GTDA 4PHTA 5KYVA 4BCAA 5BR8C 4GKKC 2UXBC 3A4IA 4LF8C 1O9TA 1ML8A 4B3MC 4DCTA 4ZLPA 4BBYA 3ETOA 4DR7C 5KEIA 4JI0C 3UZ0A 4DUZC 4LF6C 4PROC 2F4VC 1RG9A 4JI2C 2D1SA 3G7SA 2YCBA 2UXDC 5BSRA 3CW9A 4LFBC 1V26A 5BUSA 2D28C 3N2QA 3NI2A 2JMPA 2D1QA 4YHHC 1WH9A 2PN2A 4NXMC 1HH2P 4D56A 5AE3A 4RLQA 3IEUA 3R44A 5FLXD 4IR7A 5JRHA 3A9UA 4BC9A 4B3SC 4RVNA 5T8TA 1N32C 2OO4A 2UUBC 2V7BA 4D4IA 3FCCA 4RLFA 4R1LA 4DR2C 1QM4A 3J7AD 2QL8A 2D27A 1XMQC 4LF9C 4DCSA 1XRBA 1V25A 4ODJA 1USPA 3B7WA 3J80D 4K0KC 4DR3C 1MDBA 2EGTA 3ETCA 1XNRC 4XX2A 1MXAA 3DAYA 4LE5A 4JI6C 3GR0A 4LF4C 3LGXA 3R9XA 3C5EA 2ASBA 4RM3A 5KYTA 4JI3C 1MD9A 3FCEA 3UOWA 3AF6A 2D1RA 3AF5A 2QVXX 5BSMA 4JI4C 2DYJA 2P2QA 3JAMD 3E7XA 4LF7C 1USPB 1L2FA 1NYEA 4G37A 1J5EC 1IBLC 5ADZA 4R1MA 2CY1A 4RM2A 2WP0C 3R9WA 1ZB8A 1IBMC 1MXBA 4FTFA 4JM1A 2UU9C 1VLAA 4RMNA 3I07A 5BURA 1FUGA 1HR0C 2DPLA 4JI1C 5IWAC 2PROA 2P2FA 4KHPC 3N54B 4JI5C 4ZJZA 4DV0C 4RVOA 5IT9D 3EQ6A 4LFCC 4DR5C 5BUQA 3CJEA 1T5DX 4WS9A 1IBKC 4BC7A 5BSTA 5A19A 4X66C 1O93A 1XRCA 2CXCA 4DG9A 2BJOA 4DV2C 3SO4A 3IMLA 1N33C 2QVZX 2OPLA 4L7IA 3PESA 4L4QA 2UXCC 3J81D 4KTTA 2AYAA 2E7GA 1P7LA 4R0MA 2E0GA 2UUAC 4U5YD 1HNWC 1ULTA 2E8EA 4DV6C 4DR1C 4FUQA 1XNQC 4KTVA 1BA3A 2VZEA 1LCIA 2UUCC 1LQLA 1MKYA 2HJGA 3L95X 5CZVA 5LMUC 2BH1X 2WD9A 1MXCA 4DR6C 1I94C 4I9FA 5AE1A 4IZ6A 4LF5C 5CZXA 3GR1A 1O90A 3GPCA 2E8FA 5A1IA 4NXNC 5A1GA 1K0RA 5A2QD 1XMOC 2QW0X 2Y4OA 3IPLA 4NOZA 4GXQA 4X65C 2YWCA 3T1YC 4GXRA 2P02A 4NDNA 3A9VA 4X64C 4JI7C 1PG4A 2D7VA 1N34C 4MTNA 5IFIA 4DV3C 4YY3C 2YWBA 4JV5C 3RG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP C;  4JI5 C;  5FLX D;  1FJG C;  4DV0 C;  4B3S C;  4DV5 C;  4OX9 C;  2ATW A;  1HNX C;  5IT9 D;  2E5L C;  1N32 C;  4LFC C;  1WF3 A;  2VQE C;  4DR5 C;  2OPL B;  3CJE A;  2UUB C;  1IBK C;  3OTO C;  2ZM6 C;  4X66 C;  1N2F A;  2XR1 A;  4DR2 C;  2CXC A;  2BJO A;  4JI8 C;  1QWI A;  4DV2 C;  3J7A D;  2QL8 A;  1N33 C;  4B3R C;  1XMQ C;  4MH4 A;  2ONF A;  4LF9 C;  4DCS A;  4BSZ A;  1JOS A;  2PT7 G;  2OPL A;  2E8C A;  1USP A;  3J80 D;  4K0K C;  2UXC C;  4DR3 C;  3GKU A;  3J81 D;  4LFA C;  1N36 C;  3LUS A;  4GKJ C;  2EGT A;  2E7G A;  4B3T C;  1XNR C;  4XX2 A;  2UUA C;  3EER A;  1HNW C;  2E8E A;  4DV6 C;  4AQY C;  4DR4 C;  4DR1 C;  1XNQ C;  4JI6 C;  4LF4 C;  3R9X A;  4DV7 C;  4X62 C;  2ASB A;  1KKG A;  2HHH C;  2UUC C;  1LQL A;  4JI3 C;  1MKY A;  5LMN C;  5BR8 C;  4GKK C;  2UXB C;  3AF6 A;  2HJG A;  4LF8 C;  4DV1 C;  3AF5 A;  5LMU C;  4JI4 C;  1ML8 A;  4B3M C;  4DCT A;  4DR6 C;  2DYJ A;  1I94 C;  4DR7 C;  4JI0 C;  3JAM D;  4DUZ C;  4LF6 C;  4LF5 C;  4LF7 C;  4DUY C;  1PA4 A;  1USP B;  1L2F A;  2F4V C;  4JI2 C;  2E8F A;  1NYE A;  2YCB A;  4NXN C;  2UXD C;  1J5E C;  4JYA C;  1UKK A;  1IBL C;  1EGA A;  4LFB C;  4DV4 C;  1K0R A;  5A2Q D;  1XMO C;  2CY1 A;  1ZB9 A;  3R9W A;  4NOZ A;  4X65 C;  1ZB8 A;  1IBM C;  3T1Y C;  3T1H C;  2KZF A;  4X64 C;  2UU9 C;  1VLA A;  4JI7 C;  3I07 A;  1HNZ C;  2D7V A;  2JMP A;  1N34 C;  4YHH C;  4MTN A;  1WH9 A;  2PN2 A;  4NXM C;  4DCU A;  1HR0 C;  1HH2 P;  4DV3 C;  4YY3 C;  4JI1 C;  3IEV A;  4JV5 C;  5IWA C;  2VQF C;  4DCV A;  3IEU A; 
#chains in the Genus database with same CATH topology
 3RV2 A;  3I08 A;  5DV9 A;  1FJG C;  2Y4N A;  1AMU A;  4DV5 C;  4OX9 C;  2ATW A;  1HNX C;  5BSV A;  1WF3 A;  2VQE C;  2OPL B;  3TUF A;  2Y27 A;  3OTO C;  2ZM6 C;  1QWI A;  4FUT A;  3L8C A;  4D57 A;  3VNQ A;  4G36 A;  3E7W A;  4B3R C;  2ONF A;  1GPM A;  5E7Q A;  1JOS A;  2PT7 G;  5H9U A;  2VSQ A;  3NYQ A;  3LAX A;  3PBK A;  4WV3 A;  4EAT A;  1XS3 A;  3GKU A;  4OYC A;  5K8F A;  4LFA C;  3UX2 A;  1YJ7 A;  4GKJ C;  2QVY X;  4B3T C;  5AE2 A;  4DR4 C;  2JNV A;  4DV7 C;  4X62 C;  1KKG A;  3O2E A;  3LNV A;  1TH5 A;  1YGT A;  5LMN C;  3TQI A;  4DV1 C;  3DHV A;  5K85 A;  3LNO A;  4DUY C;  1PA4 A;  2D1T A;  2KZ0 A;  4JYA C;  1UKK A;  1EGA A;  4DV4 C;  4OXI A;  1ZB9 A;  4D4G A;  2OBV A;  2MMA B;  3T1H C;  2KZF A;  3DLP X;  3VNS A;  1HNZ C;  5BSW A;  3KXW A;  3VNR A;  4DCU A;  3PRO C;  4K0B A;  3NYR A;  3IEV A;  2P2B A;  2ZZM A;  3S82 A;  2VQF C;  4DCV A;  1UWD A;  4PZP A;  1N2F A;  3H2T A;  5T8S A;  2ZZN A;  1VEH A;  2P2J A;  2E5L C;  4PUI A;  4G1I A;  2P20 A;  3NPD A;  1O92 A;  4ISB A;  2XR1 A;  2ZTB A;  1T5H X;  4I9G A;  4JI8 C;  1MDF A;  1PG3 A;  4HPV A;  4DG8 A;  4MH4 A;  4BSZ A;  1RY2 A;  1M6X C;  2E8C A;  3CQ1 A;  1PU1 A;  1XRA A;  1N36 C;  2P2M A;  4TPS B;  3LUS A;  1V60 A;  3EER A;  2M5H A;  4AQY C;  3K6R A;  4GS5 A;  3TDE A;  2HHH C;  1P4E A;  5BSU A;  4L2Z A;  3UEB A;  3CW8 X;  5GTD A;  4PHT A;  5KYV A;  4BCA A;  5BR8 C;  4GKK C;  2UXB C;  3A4I A;  4LF8 C;  1O9T A;  1ML8 A;  4B3M C;  4DCT A;  1XDX A;  4ZLP A;  4BBY A;  3ETO A;  4DR7 C;  5KEI A;  4JI0 C;  3FM7 A;  3UZ0 A;  4DUZ C;  4LF6 C;  4PRO C;  2F4V C;  1RG9 A;  4JI2 C;  2D1S A;  3G7S A;  2YCB A;  2UXD C;  5BSR A;  3CW9 A;  4LFB C;  1V26 A;  3UX3 A;  2MM9 A;  5BUS A;  2D28 C;  3N2Q A;  3CQ3 A;  3NI2 A;  2JMP A;  2MCQ A;  2D1Q A;  4YHH C;  1WH9 A;  2PN2 A;  4NXM C;  1HH2 P;  4D56 A;  5AE3 A;  4RLQ A;  1XHJ A;  3AY0 A;  2NCL A;  3IEU A;  3R44 A;  5FLX D;  4IR7 A;  5JRH A;  3A9U A;  4BC9 A;  4B3S C;  4RVN A;  3A26 A;  5T8T A;  1N32 C;  2OO4 A;  2UUB C;  2V7B A;  4D4I A;  3FCC A;  4RLF A;  4R1L A;  4DR2 C;  5LCI A;  1QM4 A;  3J7A D;  2QL8 A;  2D27 A;  1XMQ C;  4LF9 C;  4DCS A;  1XRB A;  1V25 A;  4ODJ A;  1USP A;  3B7W A;  3J80 D;  4K0K C;  4DR3 C;  1MDB A;  2EGT A;  3ETC A;  1XNR C;  4XX2 A;  1MXA A;  3DAY A;  3A25 A;  4LE5 A;  4JI6 C;  3GR0 A;  4LF4 C;  3LGX A;  3R9X A;  3C5E A;  4PUG A;  2ASB A;  4RM3 A;  5KYT A;  4JI3 C;  1MD9 A;  3FCE A;  3UOW A;  3AF6 A;  2D1R A;  3AF5 A;  2QVX X;  5BSM A;  4JI4 C;  2DYJ A;  2P2Q A;  3JAM D;  3E7X A;  4LF7 C;  1USP B;  1L2F A;  1NYE A;  4G37 A;  1FLO A;  2DHM A;  1J5E C;  1IBL C;  5ADZ A;  4R1M A;  2CY1 A;  4RM2 A;  2WP0 C;  3R9W A;  1ZB8 A;  1IBM C;  1MXB A;  4FTF A;  4JM1 A;  2UU9 C;  1VLA A;  4RMN A;  3I07 A;  5BUR A;  2YX1 A;  1FUG A;  1HR0 C;  2DPL A;  4JI1 C;  5IWA C;  2PRO A;  2P2F A;  4KHP C;  3N54 B;  4JI5 C;  4ZJZ A;  4DV0 C;  4RVO A;  5IT9 D;  3EQ6 A;  4LFC C;  4DR5 C;  5BUQ A;  3CJE A;  1T5D X;  4WS9 A;  1IBK C;  4BC7 A;  5BST A;  5A19 A;  4X66 C;  1O93 A;  1XRC A;  2CXC A;  4DG9 A;  2BJO A;  4DV2 C;  1IB8 A;  3SO4 A;  1P4E C;  3IML A;  1N33 C;  2QVZ X;  2OPL A;  4L7I A;  1NY8 A;  3PES A;  4L4Q A;  2UXC C;  3J81 D;  4KTT A;  2PG1 E;  2AYA A;  2E7G A;  1P7L A;  4R0M A;  2E0G A;  2UUA C;  1M6X A;  4U5Y D;  2M5O A;  1HNW C;  1ULT A;  2E8E A;  4DV6 C;  4DR1 C;  4FUQ A;  1XNQ C;  4KTV A;  1BA3 A;  2VZE A;  1LCI A;  2UUC C;  1LQL A;  1MKY A;  2HJG A;  3L95 X;  5CZV A;  5LMU C;  2BH1 X;  2WD9 A;  1MXC A;  4DR6 C;  1I94 C;  4I9F A;  5AE1 A;  4IZ6 A;  4LF5 C;  5CZX A;  3GR1 A;  1O90 A;  3GPC A;  2E8F A;  5A1I A;  4NXN C;  3TR3 A;  1WCJ A;  5A1G A;  1K0R A;  5A2Q D;  1XMO C;  2QW0 X;  2Y4O A;  3IPL A;  4NOZ A;  4PUH A;  4GXQ A;  2CU6 A;  4X65 C;  2YWC A;  3T1Y C;  4GXR A;  2P02 A;  4NDN A;  3A9V A;  4X64 C;  3CQ2 A;  2Z51 A;  4JI7 C;  1PG4 A;  2D7V A;  1N34 C;  2KDN A;  4MTN A;  5IFI A;  4DV3 C;  4YY3 C;  2YWB A;  4JV5 C;  3RG2 A; 
#chains in the Genus database with same CATH homology
 3RV2 A;  3I08 A;  5DV9 A;  1FJG C;  2Y4N A;  1AMU A;  4DV5 C;  4OX9 C;  2ATW A;  1HNX C;  5BSV A;  1WF3 A;  2VQE C;  2OPL B;  3TUF A;  2Y27 A;  3OTO C;  2ZM6 C;  1QWI A;  4FUT A;  3L8C A;  4D57 A;  3VNQ A;  4G36 A;  3E7W A;  4B3R C;  2ONF A;  1GPM A;  5E7Q A;  1JOS A;  2PT7 G;  5H9U A;  2VSQ A;  3NYQ A;  3LAX A;  3PBK A;  4WV3 A;  4EAT A;  3GKU A;  4OYC A;  5K8F A;  4LFA C;  1YJ7 A;  4GKJ C;  2QVY X;  4B3T C;  5AE2 A;  4DR4 C;  4DV7 C;  4X62 C;  1KKG A;  3LNV A;  5LMN C;  3TQI A;  4DV1 C;  3DHV A;  5K85 A;  4DUY C;  1PA4 A;  2D1T A;  4JYA C;  1UKK A;  1EGA A;  4DV4 C;  4OXI A;  1ZB9 A;  4D4G A;  2OBV A;  3T1H C;  2KZF A;  3DLP X;  3VNS A;  1HNZ C;  5BSW A;  3KXW A;  3VNR A;  4DCU A;  3PRO C;  4K0B A;  3NYR A;  3IEV A;  2P2B A;  3S82 A;  2VQF C;  4DCV A;  4PZP A;  1N2F A;  3H2T A;  5T8S A;  2P2J A;  2E5L C;  4G1I A;  2P20 A;  3NPD A;  1O92 A;  4ISB A;  2XR1 A;  1T5H X;  4I9G A;  4JI8 C;  1MDF A;  1PG3 A;  4HPV A;  4DG8 A;  4MH4 A;  4BSZ A;  1RY2 A;  2E8C A;  1XRA A;  1N36 C;  2P2M A;  4TPS B;  3LUS A;  3EER A;  4AQY C;  4GS5 A;  3TDE A;  2HHH C;  5BSU A;  4L2Z A;  3CW8 X;  5GTD A;  4PHT A;  5KYV A;  4BCA A;  5BR8 C;  4GKK C;  2UXB C;  3A4I A;  4LF8 C;  1O9T A;  1ML8 A;  4B3M C;  4DCT A;  4ZLP A;  4BBY A;  3ETO A;  4DR7 C;  5KEI A;  4JI0 C;  3UZ0 A;  4DUZ C;  4LF6 C;  4PRO C;  2F4V C;  1RG9 A;  4JI2 C;  2D1S A;  3G7S A;  2YCB A;  2UXD C;  5BSR A;  3CW9 A;  4LFB C;  1V26 A;  5BUS A;  2D28 C;  3N2Q A;  3NI2 A;  2JMP A;  2D1Q A;  4YHH C;  1WH9 A;  2PN2 A;  4NXM C;  1HH2 P;  4D56 A;  5AE3 A;  4RLQ A;  3IEU A;  3R44 A;  5FLX D;  4IR7 A;  5JRH A;  3A9U A;  4BC9 A;  4B3S C;  4RVN A;  5T8T A;  1N32 C;  2OO4 A;  2UUB C;  2V7B A;  4D4I A;  3FCC A;  4RLF A;  4R1L A;  4DR2 C;  1QM4 A;  3J7A D;  2QL8 A;  2D27 A;  1XMQ C;  4LF9 C;  4DCS A;  1XRB A;  1V25 A;  4ODJ A;  1USP A;  3B7W A;  3J80 D;  4K0K C;  4DR3 C;  1MDB A;  2EGT A;  3ETC A;  1XNR C;  4XX2 A;  1MXA A;  3DAY A;  4LE5 A;  4JI6 C;  3GR0 A;  4LF4 C;  3LGX A;  3R9X A;  3C5E A;  2ASB A;  4RM3 A;  5KYT A;  4JI3 C;  1MD9 A;  3FCE A;  3UOW A;  3AF6 A;  2D1R A;  3AF5 A;  2QVX X;  5BSM A;  4JI4 C;  2DYJ A;  2P2Q A;  3JAM D;  3E7X A;  4LF7 C;  1USP B;  1L2F A;  1NYE A;  4G37 A;  1J5E C;  1IBL C;  5ADZ A;  4R1M A;  2CY1 A;  4RM2 A;  2WP0 C;  3R9W A;  1ZB8 A;  1IBM C;  1MXB A;  4FTF A;  4JM1 A;  2UU9 C;  1VLA A;  4RMN A;  3I07 A;  5BUR A;  1FUG A;  1HR0 C;  2DPL A;  4JI1 C;  5IWA C;  2PRO A;  2P2F A;  4KHP C;  3N54 B;  4JI5 C;  4ZJZ A;  4DV0 C;  4RVO A;  5IT9 D;  3EQ6 A;  4LFC C;  4DR5 C;  5BUQ A;  3CJE A;  1T5D X;  4WS9 A;  1IBK C;  4BC7 A;  5BST A;  5A19 A;  4X66 C;  1O93 A;  1XRC A;  2CXC A;  4DG9 A;  2BJO A;  4DV2 C;  3SO4 A;  3IML A;  1N33 C;  2QVZ X;  2OPL A;  4L7I A;  3PES A;  4L4Q A;  2UXC C;  3J81 D;  4KTT A;  2AYA A;  2E7G A;  1P7L A;  4R0M A;  2E0G A;  2UUA C;  4U5Y D;  1HNW C;  1ULT A;  2E8E A;  4DV6 C;  4DR1 C;  4FUQ A;  1XNQ C;  4KTV A;  1BA3 A;  2VZE A;  1LCI A;  2UUC C;  1LQL A;  1MKY A;  2HJG A;  3L95 X;  5CZV A;  5LMU C;  2BH1 X;  2WD9 A;  1MXC A;  4DR6 C;  1I94 C;  4I9F A;  5AE1 A;  4IZ6 A;  4LF5 C;  5CZX A;  3GR1 A;  1O90 A;  3GPC A;  2E8F A;  5A1I A;  4NXN C;  5A1G A;  1K0R A;  5A2Q D;  1XMO C;  2QW0 X;  2Y4O A;  3IPL A;  4NOZ A;  4GXQ A;  4X65 C;  2YWC A;  3T1Y C;  4GXR A;  2P02 A;  4NDN A;  3A9V A;  4X64 C;  4JI7 C;  1PG4 A;  2D7V A;  1N34 C;  4MTN A;  5IFI A;  4DV3 C;  4YY3 C;  2YWB A;  4JV5 C;  3RG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...