2ZM6C

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2zm6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2zm6C02
4LFCC 2F4VC 4DUYC 3R9WA 1N33C 4LF4C 4YHHC 4B3SC 4JI6C 5IWAC 1QWIA 1XMOC 1IBKC 2EGTA 2E8CA 3GKUA 4KHPC 4DR3C 4NOZA 2JMPA 4JI4C 3T1YC 4X66C 5IT9D 1USPA 2ZM6C 2KZFA 2ASBA 4LFBC 3AF5A 2E7GA 1N2FA 1ZB8A 5LMNC 4DV1C 1MKYA 2D7VA 1J5EC 4DR7C 1N36C 4DR1C 4AQYC 2XR1A 2PN2A 4XX2A 2CY1A 2BJOA 2VQFC 3LUSA 4NXNC 2VQEC 1PA4A 1VLAA 1N32C 1ML8A 4K0KC 5LMUC 1HH2P 1XMQC 4GKKC 2YCBA 4JI3C 4DCSA 1IBLC 4X65C 4DV2C 4YY3C 1N34C 4LF6C 4NXMC 2CXCA 4LF5C 4JI8C 1WF3A 2ONFA 4DR2C 4JI5C 2HJGA 3AF6A 1XNQC 1K0RA 4DUZC 4DV6C 4X62C 2OPLB 3OTOC 4DV4C 4JI7C 1JOSA 1KKGA 4JYAC 3J7AD 2UXDC 2PT7G 4B3MC 1WH9A 1HR0C 4DR4C 2UUBC 4MTNA 4DCTA 4DV3C 2UXBC 4LF8C 4OX9C 1LQLA 3T1HC 4MH4A 4GKJC 4DCVA 1USPB 3IEVA 1HNXC 3J81D 4DV5C 4BSZA 3EERA 2DYJA 3R9XA 1NYEA 1L2FA 5A2QD 5BR8C 1HNWC 4JI2C 4LFAC 2UUAC 2E8FA 4JV5C 2UU9C 1FJGC 4JI0C 3IEUA 4LF9C 2E8EA 1HNZC 4DR6C 3J80D 4DV7C 4B3RC 2QL8A 4DR5C 1IBMC 1ZB9A 3I07A 1UKKA 3JAMD 1EGAA 4DV0C 4X64C 4DCUA 5FLXD 2E5LC 4B3TC 2UUCC 2HHHC 1XNRC 4JI1C 4LF7C 3CJEA 1I94C 2ATWA 2UXCC 2OPLA
chains in the Genus database with same CATH superfamily
5T8SA 2F4VC 3PESA 2PG1E 1MXBA 2WP0C 3IMLA 3NPDA 4GXRA 5BSTA 2JMPA 4JI4C 5A19A 4X66C 3T1YC 2ZM6C 4G36A 3EQ6A 3NYRA 4LFBC 2QVZX 4ODJA 4KTVA 5BUSA 1MKYA 3A9UA 2ZTBA 4AQYC 2XR1A 2PN2A 3A4IA 3N54B 2D28C 1VLAA 4FUQA 4K0KC 5KYTA 4U5YD 5H9UA 3FM7A 2BH1X 1MDBA 5LCIA 4JI3C 4DCSA 4X65C 2Y4OA 4YY3C 4PHTA 1P4EC 2PROA 4JI8C 2ONFA 1XNQC 5IFIA 1K0RA 5T8TA 3CW9A 1P4EA 1T5HX 3GR1A 2QW0X 3E7XA 2D1TA 1HR0C 1VEHA 2KZ0A 4MTNA 1ULTA 1V26A 2P2JA 4I9GA 4I9FA 4GS5A 4R1MA 4DCVA 3A26A 1HNXC 3J81D 1IB8A 4JM1A 4BSZA 3AY0A 2DYJA 4RVNA 2WD9A 4OYCA 2OPLA 5BR8C 1XDXA 5E7QA 3VNQA 4JI0C 3IEUA 2NCLA 4R0MA 5AE3A 4DV7C 5BSMA 3A25A 2QVXX 1XNRC 2M5HA 4HPVA 4L7IA 4DV6C 2P2MA 1RG9A 4LFCC 5CZVA 4DUYC 5DV9A 4B3SC 1XRAA 1XMOC 2EGTA 3GKUA 2KDNA 4DR3C 3DHVA 1XRBA 1YGTA 3CQ1A 3PBKA 1N2FA 5LMNC 4DV1C 3NYQA 4IR7A 3UX3A 4DR1C 4XX2A 2Z51A 3LUSA 1PA4A 1ML8A 1WCJA 5GTDA 5A1IA 1M6XC 4GKKC 5A1GA 3TQIA 1IBLC 2D1QA 4RM3A 2YWBA 1M6XA 1BA3A 3VNSA 1WF3A 3CQ3A 4X62C 3FCEA 5AE1A 5AE2A 3SO4A 3UEBA 4JI7C 3TR3A 4B3MC 1O9TA 1AMUA 4DR4C 4DCTA 4LF8C 3CQ2A 3T1HC 1USPB 3IEVA 5KYVA 2DHMA 5A2QD 4JI2C 1LCIA 2V7BA 4D4GA 1PG4A 2E8FA 4FTFA 4DR6C 3J80D 3KXWA 4DR5C 3I07A 1UKKA 3JAMD 1XRCA 4X64C 4B3TC 2UUCC 2VZEA 4FUTA 4LF7C 3L8CA 3ETOA 1NY8A 2UXCC 2VQFC 1P7LA 3UOWA 5KEIA 2E0GA 3I08A 4PZPA 1N33C 2Y4NA 4LF4C 4LE5A 4PUIA 1XS3A 5IWAC 2OBVA 4BC7A 5IT9D 2AYAA 2ASBA 3UZ0A 2M5OA 2E7GA 2MM9A 3TDEA 2D7VA 4ZLPA 1J5EC 4DR7C 3L95X 1N36C 5CZXA 4RMNA 2CU6A 2CY1A 2BJOA 1T5DX 1MDFA 2P2QA 2VQEC 3GPCA 2QVYX 4ZJZA 1N32C 3R44A 3DAYA 4D56A 1XHJA 5LMUC 1HH2P 1XMQC 2ZZNA 2VSQA 4BC9A 4G1IA 1V25A 3UX2A 1N34C 4LF6C 2CXCA 3S82A 4DR2C 4JI5C 2HJGA 5BSUA 3N2QA 4DUZC 2YWCA 2OPLB 1PG3A 3OTOC 3J7AD 2YX1A 2UXDC 2PT7G 1WH9A 2UUBC 2UXBC 4DV3C 1LQLA 4DG8A 4D57A 4MH4A 4GKJC 1MXCA 2DPLA 4TPSB 1O93A 4RLQA 1L2FA 4RVOA 1HNWC 2D27A 1V60A 4LFAC 3CW8X 2UUAC 4K0BA 2UU9C 4JV5C 3RV2A 1GPMA 3RG2A 1HNZC 4NDNA 3FCCA 3DLPX 4B3RC 1IBMC 2D1SA 1ZB9A 2P2FA 2MCQA 1O90A 4DCUA 5FLXD 5BSWA 2P20A 2HHHC 2ZZMA 4RM2A 1YJ7A 4R1LA 3CJEA 1I94C 2ATWA 3A9VA 1FUGA 3R9WA 4YHHC 4JI6C 1QWIA 1IBKC 2E8CA 3ETCA 4KHPC 5BSVA 4NOZA 1MD9A 3K6RA 1USPA 2KZFA 4BBYA 2P2BA 3AF5A 3LGXA 1QM4A 1UWDA 4EATA 5BUQA 4PUGA 1ZB8A 3LAXA 4ISBA 3LNOA 3C5EA 4PUHA 3IPLA 4DG9A 4NXNC 3NI2A 5BURA 4PROC 2Y27A 2YCBA 3E7WA 3PROC 3O2EA 4DV2C 4NXMC 4LF5C 2MMAB 1RY2A 3AF6A 1MXAA 4RLFA 4KTTA 4DV4C 1FLOA 1JOSA 1KKGA 4JYAC 3VNRA 4OX9C 4G37A 3TUFA 4DV5C 3EERA 2JNVA 3R9XA 1NYEA 2OO4A 3H2TA 2P02A 1FJGC 1O92A 4LF9C 2E8EA 4WS9A 2D1RA 5K8FA 4OXIA 2QL8A 3LNVA 4L2ZA 3GR0A 5BSRA 4BCAA 4D4IA 1EGAA 4DV0C 2E5LC 1PU1A 5ADZA 5K85A 4GXQA 4WV3A 3B7WA 4IZ6A 4JI1C 3G7SA 1TH5A 5JRHA 4L4QA
chains in the Genus database with same CATH topology
5T8SA 2F4VC 3PESA 1MXBA 2WP0C 3IMLA 3NPDA 4GXRA 5BSTA 2JMPA 4JI4C 5A19A 4X66C 3T1YC 2ZM6C 4G36A 3EQ6A 3NYRA 4LFBC 2QVZX 4ODJA 4KTVA 5BUSA 1MKYA 3A9UA 4AQYC 2XR1A 2PN2A 3A4IA 3N54B 2D28C 1VLAA 4FUQA 4K0KC 5KYTA 4U5YD 5H9UA 2BH1X 1MDBA 4JI3C 4DCSA 4X65C 2Y4OA 4YY3C 4PHTA 2PROA 4JI8C 2ONFA 1XNQC 5IFIA 1K0RA 5T8TA 3CW9A 1T5HX 3GR1A 2QW0X 3E7XA 2D1TA 1HR0C 4MTNA 1ULTA 1V26A 2P2JA 4I9GA 4I9FA 4GS5A 4R1MA 4DCVA 1HNXC 3J81D 4JM1A 4BSZA 2DYJA 4RVNA 2WD9A 4OYCA 2OPLA 5BR8C 5E7QA 3VNQA 4JI0C 3IEUA 4R0MA 5AE3A 4DV7C 5BSMA 2QVXX 1XNRC 4HPVA 4L7IA 4DV6C 2P2MA 1RG9A 4LFCC 5CZVA 4DUYC 5DV9A 4B3SC 1XRAA 1XMOC 2EGTA 3GKUA 4DR3C 3DHVA 1XRBA 3PBKA 1N2FA 5LMNC 4DV1C 3NYQA 4IR7A 4DR1C 4XX2A 3LUSA 1PA4A 1ML8A 5GTDA 5A1IA 4GKKC 5A1GA 3TQIA 1IBLC 2D1QA 4RM3A 2YWBA 1BA3A 3VNSA 1WF3A 4X62C 3FCEA 5AE1A 5AE2A 3SO4A 4JI7C 4B3MC 1O9TA 1AMUA 4DR4C 4DCTA 4LF8C 3T1HC 1USPB 3IEVA 5KYVA 5A2QD 4JI2C 1LCIA 2V7BA 4D4GA 1PG4A 2E8FA 4FTFA 4DR6C 3J80D 3KXWA 4DR5C 3I07A 1UKKA 3JAMD 1XRCA 4X64C 4B3TC 2UUCC 2VZEA 4FUTA 4LF7C 3L8CA 3ETOA 2UXCC 2VQFC 1P7LA 3UOWA 5KEIA 2E0GA 3I08A 4PZPA 1N33C 2Y4NA 4LF4C 4LE5A 5IWAC 2OBVA 4BC7A 5IT9D 2AYAA 2ASBA 3UZ0A 2E7GA 3TDEA 2D7VA 4ZLPA 1J5EC 4DR7C 3L95X 1N36C 5CZXA 4RMNA 2CY1A 2BJOA 1T5DX 1MDFA 2P2QA 2VQEC 3GPCA 2QVYX 4ZJZA 1N32C 3R44A 3DAYA 4D56A 5LMUC 1HH2P 1XMQC 2VSQA 4BC9A 4G1IA 1V25A 4LF6C 1N34C 2CXCA 3S82A 4DR2C 4JI5C 2HJGA 5BSUA 3N2QA 4DUZC 2YWCA 2OPLB 1PG3A 3OTOC 3J7AD 2UXDC 2PT7G 1WH9A 2UUBC 2UXBC 4DV3C 1LQLA 4DG8A 4D57A 4MH4A 4GKJC 1MXCA 2DPLA 4TPSB 1O93A 4RLQA 1L2FA 4RVOA 1HNWC 2D27A 4LFAC 3CW8X 2UUAC 4K0BA 2UU9C 4JV5C 3RV2A 1GPMA 3RG2A 1HNZC 4NDNA 3FCCA 3DLPX 4B3RC 1IBMC 2D1SA 1ZB9A 2P2FA 1O90A 4DCUA 5FLXD 5BSWA 2P20A 2HHHC 4RM2A 1YJ7A 4R1LA 3CJEA 1I94C 2ATWA 3A9VA 1FUGA 3R9WA 4YHHC 4JI6C 1QWIA 1IBKC 2E8CA 3ETCA 4KHPC 5BSVA 4NOZA 1MD9A 1USPA 2KZFA 4BBYA 2P2BA 3AF5A 3LGXA 1QM4A 5BUQA 4EATA 1ZB8A 3LAXA 4ISBA 3C5EA 3IPLA 4DG9A 4NXNC 3NI2A 5BURA 4PROC 2Y27A 2YCBA 3E7WA 3PROC 4DV2C 4NXMC 4LF5C 1RY2A 3AF6A 1MXAA 4RLFA 4KTTA 4DV4C 1JOSA 1KKGA 4JYAC 3VNRA 4OX9C 4G37A 3TUFA 4DV5C 3EERA 3R9XA 1NYEA 2OO4A 3H2TA 2P02A 1FJGC 1O92A 4LF9C 2E8EA 4WS9A 2D1RA 5K8FA 4OXIA 2QL8A 3LNVA 4L2ZA 3GR0A 5BSRA 4BCAA 4D4IA 1EGAA 4DV0C 2E5LC 5ADZA 5K85A 4GXQA 4WV3A 3B7WA 4IZ6A 4JI1C 3G7SA 5JRHA 4L4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC C;  2F4V C;  4DUY C;  3R9W A;  1N33 C;  4LF4 C;  4YHH C;  4B3S C;  4JI6 C;  5IWA C;  1QWI A;  1XMO C;  1IBK C;  2EGT A;  2E8C A;  3GKU A;  4KHP C;  4DR3 C;  4NOZ A;  2JMP A;  4JI4 C;  3T1Y C;  4X66 C;  5IT9 D;  1USP A;  2ZM6 C;  2KZF A;  2ASB A;  4LFB C;  3AF5 A;  2E7G A;  1N2F A;  1ZB8 A;  5LMN C;  4DV1 C;  1MKY A;  2D7V A;  1J5E C;  4DR7 C;  1N36 C;  4DR1 C;  4AQY C;  2XR1 A;  2PN2 A;  4XX2 A;  2CY1 A;  2BJO A;  2VQF C;  3LUS A;  4NXN C;  2VQE C;  1PA4 A;  1VLA A;  1N32 C;  1ML8 A;  4K0K C;  5LMU C;  1HH2 P;  1XMQ C;  4GKK C;  2YCB A;  4JI3 C;  4DCS A;  1IBL C;  4X65 C;  4DV2 C;  4YY3 C;  1N34 C;  4LF6 C;  4NXM C;  2CXC A;  4LF5 C;  4JI8 C;  1WF3 A;  2ONF A;  4DR2 C;  4JI5 C;  2HJG A;  3AF6 A;  1XNQ C;  1K0R A;  4DUZ C;  4DV6 C;  4X62 C;  2OPL B;  3OTO C;  4DV4 C;  4JI7 C;  1JOS A;  1KKG A;  4JYA C;  3J7A D;  2UXD C;  2PT7 G;  4B3M C;  1WH9 A;  1HR0 C;  4DR4 C;  2UUB C;  4MTN A;  4DCT A;  4DV3 C;  2UXB C;  4LF8 C;  4OX9 C;  1LQL A;  3T1H C;  4MH4 A;  4GKJ C;  4DCV A;  1USP B;  3IEV A;  1HNX C;  3J81 D;  4DV5 C;  4BSZ A;  3EER A;  2DYJ A;  3R9X A;  1NYE A;  1L2F A;  5A2Q D;  5BR8 C;  1HNW C;  4JI2 C;  4LFA C;  2UUA C;  2E8F A;  4JV5 C;  2UU9 C;  1FJG C;  4JI0 C;  3IEU A;  4LF9 C;  2E8E A;  1HNZ C;  4DR6 C;  3J80 D;  4DV7 C;  4B3R C;  2QL8 A;  4DR5 C;  1IBM C;  1ZB9 A;  3I07 A;  1UKK A;  3JAM D;  1EGA A;  4DV0 C;  4X64 C;  4DCU A;  5FLX D;  2E5L C;  4B3T C;  2UUC C;  2HHH C;  1XNR C;  4JI1 C;  4LF7 C;  3CJE A;  1I94 C;  2ATW A;  2UXC C;  2OPL A; 
#chains in the Genus database with same CATH topology
 5T8S A;  2F4V C;  3PES A;  2PG1 E;  1MXB A;  2WP0 C;  3IML A;  3NPD A;  4GXR A;  5BST A;  2JMP A;  4JI4 C;  5A19 A;  4X66 C;  3T1Y C;  2ZM6 C;  4G36 A;  3EQ6 A;  3NYR A;  4LFB C;  2QVZ X;  4ODJ A;  4KTV A;  5BUS A;  1MKY A;  3A9U A;  2ZTB A;  4AQY C;  2XR1 A;  2PN2 A;  3A4I A;  3N54 B;  2D28 C;  1VLA A;  4FUQ A;  4K0K C;  5KYT A;  4U5Y D;  5H9U A;  3FM7 A;  2BH1 X;  1MDB A;  5LCI A;  4JI3 C;  4DCS A;  4X65 C;  2Y4O A;  4YY3 C;  4PHT A;  1P4E C;  2PRO A;  4JI8 C;  2ONF A;  1XNQ C;  5IFI A;  1K0R A;  5T8T A;  3CW9 A;  1P4E A;  1T5H X;  3GR1 A;  2QW0 X;  3E7X A;  2D1T A;  1HR0 C;  1VEH A;  2KZ0 A;  4MTN A;  1ULT A;  1V26 A;  2P2J A;  4I9G A;  4I9F A;  4GS5 A;  4R1M A;  4DCV A;  3A26 A;  1HNX C;  3J81 D;  1IB8 A;  4JM1 A;  4BSZ A;  3AY0 A;  2DYJ A;  4RVN A;  2WD9 A;  4OYC A;  2OPL A;  5BR8 C;  1XDX A;  5E7Q A;  3VNQ A;  4JI0 C;  3IEU A;  2NCL A;  4R0M A;  5AE3 A;  4DV7 C;  5BSM A;  3A25 A;  2QVX X;  1XNR C;  2M5H A;  4HPV A;  4L7I A;  4DV6 C;  2P2M A;  1RG9 A;  4LFC C;  5CZV A;  4DUY C;  5DV9 A;  4B3S C;  1XRA A;  1XMO C;  2EGT A;  3GKU A;  2KDN A;  4DR3 C;  3DHV A;  1XRB A;  1YGT A;  3CQ1 A;  3PBK A;  1N2F A;  5LMN C;  4DV1 C;  3NYQ A;  4IR7 A;  3UX3 A;  4DR1 C;  4XX2 A;  2Z51 A;  3LUS A;  1PA4 A;  1ML8 A;  1WCJ A;  5GTD A;  5A1I A;  1M6X C;  4GKK C;  5A1G A;  3TQI A;  1IBL C;  2D1Q A;  4RM3 A;  2YWB A;  1M6X A;  1BA3 A;  3VNS A;  1WF3 A;  3CQ3 A;  4X62 C;  3FCE A;  5AE1 A;  5AE2 A;  3SO4 A;  3UEB A;  4JI7 C;  3TR3 A;  4B3M C;  1O9T A;  1AMU A;  4DR4 C;  4DCT A;  4LF8 C;  3CQ2 A;  3T1H C;  1USP B;  3IEV A;  5KYV A;  2DHM A;  5A2Q D;  4JI2 C;  1LCI A;  2V7B A;  4D4G A;  1PG4 A;  2E8F A;  4FTF A;  4DR6 C;  3J80 D;  3KXW A;  4DR5 C;  3I07 A;  1UKK A;  3JAM D;  1XRC A;  4X64 C;  4B3T C;  2UUC C;  2VZE A;  4FUT A;  4LF7 C;  3L8C A;  3ETO A;  1NY8 A;  2UXC C;  2VQF C;  1P7L A;  3UOW A;  5KEI A;  2E0G A;  3I08 A;  4PZP A;  1N33 C;  2Y4N A;  4LF4 C;  4LE5 A;  4PUI A;  1XS3 A;  5IWA C;  2OBV A;  4BC7 A;  5IT9 D;  2AYA A;  2ASB A;  3UZ0 A;  2M5O A;  2E7G A;  2MM9 A;  3TDE A;  2D7V A;  4ZLP A;  1J5E C;  4DR7 C;  3L95 X;  1N36 C;  5CZX A;  4RMN A;  2CU6 A;  2CY1 A;  2BJO A;  1T5D X;  1MDF A;  2P2Q A;  2VQE C;  3GPC A;  2QVY X;  4ZJZ A;  1N32 C;  3R44 A;  3DAY A;  4D56 A;  1XHJ A;  5LMU C;  1HH2 P;  1XMQ C;  2ZZN A;  2VSQ A;  4BC9 A;  4G1I A;  1V25 A;  3UX2 A;  1N34 C;  4LF6 C;  2CXC A;  3S82 A;  4DR2 C;  4JI5 C;  2HJG A;  5BSU A;  3N2Q A;  4DUZ C;  2YWC A;  2OPL B;  1PG3 A;  3OTO C;  3J7A D;  2YX1 A;  2UXD C;  2PT7 G;  1WH9 A;  2UUB C;  2UXB C;  4DV3 C;  1LQL A;  4DG8 A;  4D57 A;  4MH4 A;  4GKJ C;  1MXC A;  2DPL A;  4TPS B;  1O93 A;  4RLQ A;  1L2F A;  4RVO A;  1HNW C;  2D27 A;  1V60 A;  4LFA C;  3CW8 X;  2UUA C;  4K0B A;  2UU9 C;  4JV5 C;  3RV2 A;  1GPM A;  3RG2 A;  1HNZ C;  4NDN A;  3FCC A;  3DLP X;  4B3R C;  1IBM C;  2D1S A;  1ZB9 A;  2P2F A;  2MCQ A;  1O90 A;  4DCU A;  5FLX D;  5BSW A;  2P20 A;  2HHH C;  2ZZM A;  4RM2 A;  1YJ7 A;  4R1L A;  3CJE A;  1I94 C;  2ATW A;  3A9V A;  1FUG A;  3R9W A;  4YHH C;  4JI6 C;  1QWI A;  1IBK C;  2E8C A;  3ETC A;  4KHP C;  5BSV A;  4NOZ A;  1MD9 A;  3K6R A;  1USP A;  2KZF A;  4BBY A;  2P2B A;  3AF5 A;  3LGX A;  1QM4 A;  1UWD A;  4EAT A;  5BUQ A;  4PUG A;  1ZB8 A;  3LAX A;  4ISB A;  3LNO A;  3C5E A;  4PUH A;  3IPL A;  4DG9 A;  4NXN C;  3NI2 A;  5BUR A;  4PRO C;  2Y27 A;  2YCB A;  3E7W A;  3PRO C;  3O2E A;  4DV2 C;  4NXM C;  4LF5 C;  2MMA B;  1RY2 A;  3AF6 A;  1MXA A;  4RLF A;  4KTT A;  4DV4 C;  1FLO A;  1JOS A;  1KKG A;  4JYA C;  3VNR A;  4OX9 C;  4G37 A;  3TUF A;  4DV5 C;  3EER A;  2JNV A;  3R9X A;  1NYE A;  2OO4 A;  3H2T A;  2P02 A;  1FJG C;  1O92 A;  4LF9 C;  2E8E A;  4WS9 A;  2D1R A;  5K8F A;  4OXI A;  2QL8 A;  3LNV A;  4L2Z A;  3GR0 A;  5BSR A;  4BCA A;  4D4I A;  1EGA A;  4DV0 C;  2E5L C;  1PU1 A;  5ADZ A;  5K85 A;  4GXQ A;  4WV3 A;  3B7W A;  4IZ6 A;  4JI1 C;  3G7S A;  1TH5 A;  5JRH A;  4L4Q A; 
#chains in the Genus database with same CATH homology
 5T8S A;  2F4V C;  3PES A;  1MXB A;  2WP0 C;  3IML A;  3NPD A;  4GXR A;  5BST A;  2JMP A;  4JI4 C;  5A19 A;  4X66 C;  3T1Y C;  2ZM6 C;  4G36 A;  3EQ6 A;  3NYR A;  4LFB C;  2QVZ X;  4ODJ A;  4KTV A;  5BUS A;  1MKY A;  3A9U A;  4AQY C;  2XR1 A;  2PN2 A;  3A4I A;  3N54 B;  2D28 C;  1VLA A;  4FUQ A;  4K0K C;  5KYT A;  4U5Y D;  5H9U A;  2BH1 X;  1MDB A;  4JI3 C;  4DCS A;  4X65 C;  2Y4O A;  4YY3 C;  4PHT A;  2PRO A;  4JI8 C;  2ONF A;  1XNQ C;  5IFI A;  1K0R A;  5T8T A;  3CW9 A;  1T5H X;  3GR1 A;  2QW0 X;  3E7X A;  2D1T A;  1HR0 C;  4MTN A;  1ULT A;  1V26 A;  2P2J A;  4I9G A;  4I9F A;  4GS5 A;  4R1M A;  4DCV A;  1HNX C;  3J81 D;  4JM1 A;  4BSZ A;  2DYJ A;  4RVN A;  2WD9 A;  4OYC A;  2OPL A;  5BR8 C;  5E7Q A;  3VNQ A;  4JI0 C;  3IEU A;  4R0M A;  5AE3 A;  4DV7 C;  5BSM A;  2QVX X;  1XNR C;  4HPV A;  4L7I A;  4DV6 C;  2P2M A;  1RG9 A;  4LFC C;  5CZV A;  4DUY C;  5DV9 A;  4B3S C;  1XRA A;  1XMO C;  2EGT A;  3GKU A;  4DR3 C;  3DHV A;  1XRB A;  3PBK A;  1N2F A;  5LMN C;  4DV1 C;  3NYQ A;  4IR7 A;  4DR1 C;  4XX2 A;  3LUS A;  1PA4 A;  1ML8 A;  5GTD A;  5A1I A;  4GKK C;  5A1G A;  3TQI A;  1IBL C;  2D1Q A;  4RM3 A;  2YWB A;  1BA3 A;  3VNS A;  1WF3 A;  4X62 C;  3FCE A;  5AE1 A;  5AE2 A;  3SO4 A;  4JI7 C;  4B3M C;  1O9T A;  1AMU A;  4DR4 C;  4DCT A;  4LF8 C;  3T1H C;  1USP B;  3IEV A;  5KYV A;  5A2Q D;  4JI2 C;  1LCI A;  2V7B A;  4D4G A;  1PG4 A;  2E8F A;  4FTF A;  4DR6 C;  3J80 D;  3KXW A;  4DR5 C;  3I07 A;  1UKK A;  3JAM D;  1XRC A;  4X64 C;  4B3T C;  2UUC C;  2VZE A;  4FUT A;  4LF7 C;  3L8C A;  3ETO A;  2UXC C;  2VQF C;  1P7L A;  3UOW A;  5KEI A;  2E0G A;  3I08 A;  4PZP A;  1N33 C;  2Y4N A;  4LF4 C;  4LE5 A;  5IWA C;  2OBV A;  4BC7 A;  5IT9 D;  2AYA A;  2ASB A;  3UZ0 A;  2E7G A;  3TDE A;  2D7V A;  4ZLP A;  1J5E C;  4DR7 C;  3L95 X;  1N36 C;  5CZX A;  4RMN A;  2CY1 A;  2BJO A;  1T5D X;  1MDF A;  2P2Q A;  2VQE C;  3GPC A;  2QVY X;  4ZJZ A;  1N32 C;  3R44 A;  3DAY A;  4D56 A;  5LMU C;  1HH2 P;  1XMQ C;  2VSQ A;  4BC9 A;  4G1I A;  1V25 A;  4LF6 C;  1N34 C;  2CXC A;  3S82 A;  4DR2 C;  4JI5 C;  2HJG A;  5BSU A;  3N2Q A;  4DUZ C;  2YWC A;  2OPL B;  1PG3 A;  3OTO C;  3J7A D;  2UXD C;  2PT7 G;  1WH9 A;  2UUB C;  2UXB C;  4DV3 C;  1LQL A;  4DG8 A;  4D57 A;  4MH4 A;  4GKJ C;  1MXC A;  2DPL A;  4TPS B;  1O93 A;  4RLQ A;  1L2F A;  4RVO A;  1HNW C;  2D27 A;  4LFA C;  3CW8 X;  2UUA C;  4K0B A;  2UU9 C;  4JV5 C;  3RV2 A;  1GPM A;  3RG2 A;  1HNZ C;  4NDN A;  3FCC A;  3DLP X;  4B3R C;  1IBM C;  2D1S A;  1ZB9 A;  2P2F A;  1O90 A;  4DCU A;  5FLX D;  5BSW A;  2P20 A;  2HHH C;  4RM2 A;  1YJ7 A;  4R1L A;  3CJE A;  1I94 C;  2ATW A;  3A9V A;  1FUG A;  3R9W A;  4YHH C;  4JI6 C;  1QWI A;  1IBK C;  2E8C A;  3ETC A;  4KHP C;  5BSV A;  4NOZ A;  1MD9 A;  1USP A;  2KZF A;  4BBY A;  2P2B A;  3AF5 A;  3LGX A;  1QM4 A;  5BUQ A;  4EAT A;  1ZB8 A;  3LAX A;  4ISB A;  3C5E A;  3IPL A;  4DG9 A;  4NXN C;  3NI2 A;  5BUR A;  4PRO C;  2Y27 A;  2YCB A;  3E7W A;  3PRO C;  4DV2 C;  4NXM C;  4LF5 C;  1RY2 A;  3AF6 A;  1MXA A;  4RLF A;  4KTT A;  4DV4 C;  1JOS A;  1KKG A;  4JYA C;  3VNR A;  4OX9 C;  4G37 A;  3TUF A;  4DV5 C;  3EER A;  3R9X A;  1NYE A;  2OO4 A;  3H2T A;  2P02 A;  1FJG C;  1O92 A;  4LF9 C;  2E8E A;  4WS9 A;  2D1R A;  5K8F A;  4OXI A;  2QL8 A;  3LNV A;  4L2Z A;  3GR0 A;  5BSR A;  4BCA A;  4D4I A;  1EGA A;  4DV0 C;  2E5L C;  5ADZ A;  5K85 A;  4GXQ A;  4WV3 A;  3B7W A;  4IZ6 A;  4JI1 C;  3G7S A;  5JRH A;  4L4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...