2ZM6C

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2zm6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2zm6C02
1N34C 1HR0C 2JMPA 2UUAC 3T1YC 2HJGA 4B3MC 3AF5A 4X64C 3GKUA 2KZFA 2UUBC 4DUYC 1XMOC 1VLAA 2VQEC 1LQLA 1N2FA 2PT7G 1USPA 2E5LC 1XNQC 5BR8C 1USPB 3J7AD 2UU9C 4DR3C 3AF6A 2ASBA 4DCSA 4DCUA 4LF6C 1N32C 4DV2C 4JI8C 4JI7C 1I94C 4LF4C 5FLXD 3EERA 4KHPC 4DV3C 3T1HC 5IT9D 1MKYA 1JOSA 5IWAC 4JI1C 2UUCC 4JI4C 2CY1A 4B3RC 4YHHC 1PA4A 5LMNC 1NYEA 2ZM6C 3IEUA 4LFCC 3J81D 3R9XA 3R9WA 4GKKC 4JI2C 4JV5C 1HNXC 2UXCC 4DV6C 2HHHC 1WF3A 4DR5C 2CXCA 4AQYC 4B3TC 4JI6C 4BSZA 4LF7C 2F4VC 4DCVA 4DV0C 3I07A 4LF8C 4JYAC 2UXBC 2E8CA 2BJOA 1IBMC 2E8EA 2OPLB 3JAMD 2EGTA 4DR4C 4JI0C 2OPLA 4NXNC 4X62C 1IBLC 5LMUC 4DCTA 1N36C 1L2FA 3LUSA 4LF9C 1XNRC 4NXMC 5A2QD 2UXDC 2ONFA 4K0KC 1EGAA 4LFBC 4XX2A 4LF5C 4YY3C 4MTNA 1ZB9A 2E7GA 4DR1C 2XR1A 1K0RA 1J5EC 2PN2A 3CJEA 4X66C 1ML8A 2QL8A 4DR6C 1HNWC 4DV1C 2D7VA 2ATWA 3IEVA 4GKJC 1KKGA 4X65C 2YCBA 4DV4C 1HH2P 4DV5C 4MH4A 4JI3C 1HNZC 4DV7C 4OX9C 4DR2C 1WH9A 1N33C 4LFAC 4NOZA 4DUZC 4JI5C 1IBKC 1XMQC 4DR7C 2DYJA 1QWIA 2VQFC 3J80D 2E8FA 4B3SC 1UKKA 3OTOC 1FJGC 1ZB8A
chains in the Genus database with same CATH superfamily
1NY8A 5E7QA 2P2FA 3PBKA 3AF5A 4B3MC 3GKUA 1XNQC 3G7SA 3NYRA 4DG8A 1USPB 2VSQA 2ZTBA 2BH1X 1PG4A 2JNVA 3DAYA 2ASBA 3EQ6A 4DCUA 2D1SA 2KDNA 4JI8C 1I94C 3UX2A 2D1TA 4GS5A 2OBVA 3TUFA 5FLXD 5LCIA 4KHPC 3VNRA 5IT9D 1MKYA 1JOSA 5KYTA 4IZ6A 2UUCC 4JI4C 5KYVA 1PA4A 4JI2C 2UXCC 2PG1E 2AYAA 2HHHC 4LF7C 4AQYC 3GR1A 5T8TA 3I07A 4LF8C 2E8CA 3FM7A 1P7LA 3H2TA 1XRCA 2YWBA 2OPLB 2EGTA 3NYQA 4FUQA 1IBLC 1N36C 4EATA 3CW8X 5T8SA 5K8FA 4LF9C 3CW9A 2ONFA 1BA3A 4LFBC 3IPLA 3A25A 4DR1C 1V60A 1K0RA 1J5EC 3CJEA 2Z51A 4BBYA 4L4QA 3GPCA 4D4IA 2MM9A 3ETOA 4ZJZA 4DV4C 1TH5A 3UOWA 4WV3A 1MXAA 4JI3C 3DHVA 2YX1A 1O90A 5DV9A 4DR2C 3KXWA 4LFAC 4NOZA 3LGXA 4WS9A 4LE5A 4DR7C 4FTFA 2PROA 1M6XA 5CZVA 2VQFC 5AE2A 3ETCA 4ODJA 4G36A 2JMPA 4GXQA 3T1YC 2KZFA 4DUYC 2P2JA 4R1MA 5K85A 1N2FA 1USPA 2E5LC 4FUTA 4L7IA 5BR8C 2WD9A 2UU9C 1UWDA 4K0BA 4LF6C 1V25A 1MXBA 4D56A 3EERA 4L2ZA 2ZZNA 3UX3A 4D57A 4B3RC 4YHHC 3A4IA 5LMNC 2D1RA 2ZM6C 5A19A 3L95X 2OO4A 3IEUA 3R9XA 4GKKC 1HNXC 3E7WA 4PUGA 4DR5C 4JI6C 2CXCA 4DV0C 3NI2A 3R44A 1IBMC 1FUGA 5H9UA 4RVOA 2P2BA 3SO4A 5JRHA 5LMUC 3LUSA 4RLQA 4NXMC 2P20A 4ZLPA 1GPMA 3LNOA 5BURA 4K0KC 1O93A 3DLPX 3RV2A 4LF5C 2E7GA 4RVNA 3O2EA 2PN2A 4DV1C 4RM3A 3IEVA 4GKJC 1KKGA 5GTDA 2MCQA 3NPDA 4DV5C 1HNZC 4OX9C 4D4GA 3A26A 4IR7A 3UEBA 2P02A 1N33C 4JI5C 1IBKC 2Y4OA 2VZEA 5IFIA 2E8FA 4I9GA 4B3SC 1MXCA 2ZZMA 4RM2A 1N34C 4DG9A 2HJGA 4PROC 1M6XC 2UUBC 4I9FA 1XMOC 1VLAA 1LCIA 1LQLA 3A9UA 2KZ0A 1YJ7A 4BC7A 3B7WA 3J7AD 2YWCA 4DCSA 1V26A 5BUQA 4JI7C 5CZXA 1XRBA 3LNVA 4G1IA 4LF4C 2Y27A 2D1QA 4JI1C 4PUHA 2MMAB 2CY1A 4LFCC 1WCJA 3J81D 4HPVA 4JV5C 2M5HA 4RLFA 1VEHA 4JYAC 4DCVA 3N54B 2P2QA 1O9TA 2E8EA 4BCAA 3IMLA 2E0GA 1P4EC 3GR0A 3JAMD 5A1GA 4DR4C 4JI0C 4X62C 2WP0C 4JM1A 1XDXA 5BSWA 1XRAA 5AE1A 1MD9A 2P2MA 1XNRC 2QVYX 3UZ0A 3VNSA 5A2QD 2UXDC 1T5HX 3FCEA 4TPSB 5BSRA 4YY3C 4MTNA 1XS3A 3TDEA 1MDBA 1P4EA 2XR1A 4OXIA 5BSMA 4X66C 1FLOA 1ML8A 4DR6C 1QM4A 4R1LA 1HNWC 2NCLA 3VNQA 3I08A 4X65C 1ULTA 2Y4NA 4PHTA 1HH2P 4MH4A 4DV7C 3PROC 3K6RA 3E7XA 4PUIA 4DUZC 1QWIA 2V7BA 4RMNA 1UKKA 4DV3C 3A9VA 1HR0C 4NDNA 2UUAC 4X64C 2VQEC 2PT7G 5KEIA 2CU6A 5BSVA 4DR3C 1T5DX 2QW0X 3AF6A 5AE3A 1N32C 4DV2C 4U5YD 4BC9A 4KTTA 5BUSA 1RY2A 4GXRA 1YGTA 3T1HC 1IB8A 2DHMA 5IWAC 3C5EA 1MDFA 2QVZX 1AMUA 4ISBA 3PESA 5A1IA 2DPLA 1NYEA 2M5OA 3R9WA 3AY0A 4DV6C 1WF3A 4B3TC 2F4VC 4BSZA 2UXBC 2BJOA 4OYCA 4G37A 3TQIA 2OPLA 5BSUA 4NXNC 3N2QA 1PG3A 4DCTA 3S82A 1L2FA 4R0MA 3TR3A 1XHJA 1O92A 2QVXX 1EGAA 4XX2A 3RG2A 1ZB9A 3L8CA 4PZPA 2D28C 2QL8A 2D7VA 2ATWA 3FCCA 4KTVA 2YCBA 3CQ3A 5BSTA 1RG9A 1PU1A 1WH9A 2D27A 3LAXA 1XMQC 2DYJA 3J80D 3OTOC 3CQ2A 1FJGC 1ZB8A 3CQ1A 5ADZA
chains in the Genus database with same CATH topology
5E7QA 2P2FA 3PBKA 3AF5A 4B3MC 3GKUA 1XNQC 3G7SA 3NYRA 4DG8A 1USPB 2VSQA 2BH1X 1PG4A 3DAYA 2ASBA 3EQ6A 4DCUA 2D1SA 4JI8C 1I94C 2D1TA 4GS5A 2OBVA 3TUFA 5FLXD 4KHPC 3VNRA 5IT9D 1MKYA 1JOSA 5KYTA 4IZ6A 2UUCC 4JI4C 5KYVA 1PA4A 4JI2C 2UXCC 2AYAA 2HHHC 4LF7C 4AQYC 3GR1A 5T8TA 3I07A 4LF8C 2E8CA 1P7LA 3H2TA 1XRCA 2YWBA 2OPLB 2EGTA 3NYQA 4FUQA 1IBLC 1N36C 4EATA 3CW8X 5T8SA 5K8FA 4LF9C 3CW9A 2ONFA 1BA3A 4LFBC 3IPLA 4DR1C 1K0RA 1J5EC 3CJEA 4BBYA 4L4QA 3GPCA 4D4IA 3ETOA 4ZJZA 4DV4C 3UOWA 4WV3A 1MXAA 4JI3C 3DHVA 1O90A 5DV9A 4DR2C 3KXWA 4LFAC 4NOZA 3LGXA 4WS9A 4LE5A 4DR7C 4FTFA 2PROA 5CZVA 2VQFC 5AE2A 3ETCA 4ODJA 4G36A 2JMPA 4GXQA 3T1YC 2KZFA 4DUYC 2P2JA 4R1MA 5K85A 1N2FA 1USPA 2E5LC 4FUTA 4L7IA 5BR8C 2WD9A 2UU9C 4K0BA 4LF6C 1V25A 1MXBA 4D56A 3EERA 4L2ZA 4D57A 4B3RC 4YHHC 3A4IA 5LMNC 2D1RA 2ZM6C 5A19A 3L95X 2OO4A 3IEUA 3R9XA 4GKKC 1HNXC 3E7WA 4DR5C 4JI6C 2CXCA 4DV0C 3NI2A 3R44A 1IBMC 1FUGA 5H9UA 4RVOA 2P2BA 3SO4A 5JRHA 5LMUC 3LUSA 4RLQA 4NXMC 2P20A 4ZLPA 1GPMA 5BURA 4K0KC 1O93A 3DLPX 3RV2A 4LF5C 2E7GA 4RVNA 2PN2A 4DV1C 4RM3A 3IEVA 4GKJC 1KKGA 5GTDA 3NPDA 4DV5C 1HNZC 4OX9C 4D4GA 4IR7A 2P02A 1N33C 4JI5C 1IBKC 2Y4OA 2VZEA 5IFIA 2E8FA 4I9GA 4B3SC 1MXCA 4RM2A 1N34C 4DG9A 2HJGA 4PROC 2UUBC 4I9FA 1XMOC 1VLAA 1LCIA 1LQLA 3A9UA 1YJ7A 4BC7A 3B7WA 3J7AD 2YWCA 4DCSA 1V26A 5BUQA 4JI7C 5CZXA 1XRBA 3LNVA 4G1IA 4LF4C 2Y27A 2D1QA 4JI1C 2CY1A 4LFCC 3J81D 4HPVA 4JV5C 4RLFA 4JYAC 4DCVA 3N54B 2P2QA 1O9TA 2E8EA 4BCAA 3IMLA 2E0GA 3GR0A 3JAMD 5A1GA 4DR4C 4JI0C 4X62C 2WP0C 4JM1A 5BSWA 1XRAA 5AE1A 1MD9A 2P2MA 1XNRC 2QVYX 3UZ0A 3VNSA 5A2QD 2UXDC 1T5HX 3FCEA 4TPSB 5BSRA 4YY3C 4MTNA 3TDEA 1MDBA 2XR1A 4OXIA 5BSMA 4X66C 1ML8A 4DR6C 1QM4A 4R1LA 1HNWC 3VNQA 3I08A 4X65C 1ULTA 2Y4NA 4PHTA 1HH2P 4MH4A 4DV7C 3PROC 3E7XA 4DUZC 1QWIA 2V7BA 4RMNA 1UKKA 4DV3C 3A9VA 1HR0C 4NDNA 2UUAC 4X64C 2VQEC 2PT7G 5KEIA 5BSVA 4DR3C 1T5DX 2QW0X 3AF6A 5AE3A 1N32C 4DV2C 4U5YD 4BC9A 4KTTA 5BUSA 1RY2A 4GXRA 3T1HC 5IWAC 3C5EA 1MDFA 2QVZX 1AMUA 4ISBA 3PESA 5A1IA 2DPLA 1NYEA 3R9WA 4DV6C 1WF3A 4B3TC 2F4VC 4BSZA 2UXBC 2BJOA 4OYCA 4G37A 3TQIA 2OPLA 5BSUA 4NXNC 3N2QA 1PG3A 4DCTA 3S82A 1L2FA 4R0MA 1O92A 2QVXX 1EGAA 4XX2A 3RG2A 1ZB9A 3L8CA 4PZPA 2D28C 2QL8A 2D7VA 2ATWA 3FCCA 4KTVA 2YCBA 5BSTA 1RG9A 1WH9A 2D27A 3LAXA 1XMQC 2DYJA 3J80D 3OTOC 1FJGC 1ZB8A 5ADZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 C;  1HR0 C;  2JMP A;  2UUA C;  3T1Y C;  2HJG A;  4B3M C;  3AF5 A;  4X64 C;  3GKU A;  2KZF A;  2UUB C;  4DUY C;  1XMO C;  1VLA A;  2VQE C;  1LQL A;  1N2F A;  2PT7 G;  1USP A;  2E5L C;  1XNQ C;  5BR8 C;  1USP B;  3J7A D;  2UU9 C;  4DR3 C;  3AF6 A;  2ASB A;  4DCS A;  4DCU A;  4LF6 C;  1N32 C;  4DV2 C;  4JI8 C;  4JI7 C;  1I94 C;  4LF4 C;  5FLX D;  3EER A;  4KHP C;  4DV3 C;  3T1H C;  5IT9 D;  1MKY A;  1JOS A;  5IWA C;  4JI1 C;  2UUC C;  4JI4 C;  2CY1 A;  4B3R C;  4YHH C;  1PA4 A;  5LMN C;  1NYE A;  2ZM6 C;  3IEU A;  4LFC C;  3J81 D;  3R9X A;  3R9W A;  4GKK C;  4JI2 C;  4JV5 C;  1HNX C;  2UXC C;  4DV6 C;  2HHH C;  1WF3 A;  4DR5 C;  2CXC A;  4AQY C;  4B3T C;  4JI6 C;  4BSZ A;  4LF7 C;  2F4V C;  4DCV A;  4DV0 C;  3I07 A;  4LF8 C;  4JYA C;  2UXB C;  2E8C A;  2BJO A;  1IBM C;  2E8E A;  2OPL B;  3JAM D;  2EGT A;  4DR4 C;  4JI0 C;  2OPL A;  4NXN C;  4X62 C;  1IBL C;  5LMU C;  4DCT A;  1N36 C;  1L2F A;  3LUS A;  4LF9 C;  1XNR C;  4NXM C;  5A2Q D;  2UXD C;  2ONF A;  4K0K C;  1EGA A;  4LFB C;  4XX2 A;  4LF5 C;  4YY3 C;  4MTN A;  1ZB9 A;  2E7G A;  4DR1 C;  2XR1 A;  1K0R A;  1J5E C;  2PN2 A;  3CJE A;  4X66 C;  1ML8 A;  2QL8 A;  4DR6 C;  1HNW C;  4DV1 C;  2D7V A;  2ATW A;  3IEV A;  4GKJ C;  1KKG A;  4X65 C;  2YCB A;  4DV4 C;  1HH2 P;  4DV5 C;  4MH4 A;  4JI3 C;  1HNZ C;  4DV7 C;  4OX9 C;  4DR2 C;  1WH9 A;  1N33 C;  4LFA C;  4NOZ A;  4DUZ C;  4JI5 C;  1IBK C;  1XMQ C;  4DR7 C;  2DYJ A;  1QWI A;  2VQF C;  3J80 D;  2E8F A;  4B3S C;  1UKK A;  3OTO C;  1FJG C;  1ZB8 A; 
#chains in the Genus database with same CATH topology
 1NY8 A;  5E7Q A;  2P2F A;  3PBK A;  3AF5 A;  4B3M C;  3GKU A;  1XNQ C;  3G7S A;  3NYR A;  4DG8 A;  1USP B;  2VSQ A;  2ZTB A;  2BH1 X;  1PG4 A;  2JNV A;  3DAY A;  2ASB A;  3EQ6 A;  4DCU A;  2D1S A;  2KDN A;  4JI8 C;  1I94 C;  3UX2 A;  2D1T A;  4GS5 A;  2OBV A;  3TUF A;  5FLX D;  5LCI A;  4KHP C;  3VNR A;  5IT9 D;  1MKY A;  1JOS A;  5KYT A;  4IZ6 A;  2UUC C;  4JI4 C;  5KYV A;  1PA4 A;  4JI2 C;  2UXC C;  2PG1 E;  2AYA A;  2HHH C;  4LF7 C;  4AQY C;  3GR1 A;  5T8T A;  3I07 A;  4LF8 C;  2E8C A;  3FM7 A;  1P7L A;  3H2T A;  1XRC A;  2YWB A;  2OPL B;  2EGT A;  3NYQ A;  4FUQ A;  1IBL C;  1N36 C;  4EAT A;  3CW8 X;  5T8S A;  5K8F A;  4LF9 C;  3CW9 A;  2ONF A;  1BA3 A;  4LFB C;  3IPL A;  3A25 A;  4DR1 C;  1V60 A;  1K0R A;  1J5E C;  3CJE A;  2Z51 A;  4BBY A;  4L4Q A;  3GPC A;  4D4I A;  2MM9 A;  3ETO A;  4ZJZ A;  4DV4 C;  1TH5 A;  3UOW A;  4WV3 A;  1MXA A;  4JI3 C;  3DHV A;  2YX1 A;  1O90 A;  5DV9 A;  4DR2 C;  3KXW A;  4LFA C;  4NOZ A;  3LGX A;  4WS9 A;  4LE5 A;  4DR7 C;  4FTF A;  2PRO A;  1M6X A;  5CZV A;  2VQF C;  5AE2 A;  3ETC A;  4ODJ A;  4G36 A;  2JMP A;  4GXQ A;  3T1Y C;  2KZF A;  4DUY C;  2P2J A;  4R1M A;  5K85 A;  1N2F A;  1USP A;  2E5L C;  4FUT A;  4L7I A;  5BR8 C;  2WD9 A;  2UU9 C;  1UWD A;  4K0B A;  4LF6 C;  1V25 A;  1MXB A;  4D56 A;  3EER A;  4L2Z A;  2ZZN A;  3UX3 A;  4D57 A;  4B3R C;  4YHH C;  3A4I A;  5LMN C;  2D1R A;  2ZM6 C;  5A19 A;  3L95 X;  2OO4 A;  3IEU A;  3R9X A;  4GKK C;  1HNX C;  3E7W A;  4PUG A;  4DR5 C;  4JI6 C;  2CXC A;  4DV0 C;  3NI2 A;  3R44 A;  1IBM C;  1FUG A;  5H9U A;  4RVO A;  2P2B A;  3SO4 A;  5JRH A;  5LMU C;  3LUS A;  4RLQ A;  4NXM C;  2P20 A;  4ZLP A;  1GPM A;  3LNO A;  5BUR A;  4K0K C;  1O93 A;  3DLP X;  3RV2 A;  4LF5 C;  2E7G A;  4RVN A;  3O2E A;  2PN2 A;  4DV1 C;  4RM3 A;  3IEV A;  4GKJ C;  1KKG A;  5GTD A;  2MCQ A;  3NPD A;  4DV5 C;  1HNZ C;  4OX9 C;  4D4G A;  3A26 A;  4IR7 A;  3UEB A;  2P02 A;  1N33 C;  4JI5 C;  1IBK C;  2Y4O A;  2VZE A;  5IFI A;  2E8F A;  4I9G A;  4B3S C;  1MXC A;  2ZZM A;  4RM2 A;  1N34 C;  4DG9 A;  2HJG A;  4PRO C;  1M6X C;  2UUB C;  4I9F A;  1XMO C;  1VLA A;  1LCI A;  1LQL A;  3A9U A;  2KZ0 A;  1YJ7 A;  4BC7 A;  3B7W A;  3J7A D;  2YWC A;  4DCS A;  1V26 A;  5BUQ A;  4JI7 C;  5CZX A;  1XRB A;  3LNV A;  4G1I A;  4LF4 C;  2Y27 A;  2D1Q A;  4JI1 C;  4PUH A;  2MMA B;  2CY1 A;  4LFC C;  1WCJ A;  3J81 D;  4HPV A;  4JV5 C;  2M5H A;  4RLF A;  1VEH A;  4JYA C;  4DCV A;  3N54 B;  2P2Q A;  1O9T A;  2E8E A;  4BCA A;  3IML A;  2E0G A;  1P4E C;  3GR0 A;  3JAM D;  5A1G A;  4DR4 C;  4JI0 C;  4X62 C;  2WP0 C;  4JM1 A;  1XDX A;  5BSW A;  1XRA A;  5AE1 A;  1MD9 A;  2P2M A;  1XNR C;  2QVY X;  3UZ0 A;  3VNS A;  5A2Q D;  2UXD C;  1T5H X;  3FCE A;  4TPS B;  5BSR A;  4YY3 C;  4MTN A;  1XS3 A;  3TDE A;  1MDB A;  1P4E A;  2XR1 A;  4OXI A;  5BSM A;  4X66 C;  1FLO A;  1ML8 A;  4DR6 C;  1QM4 A;  4R1L A;  1HNW C;  2NCL A;  3VNQ A;  3I08 A;  4X65 C;  1ULT A;  2Y4N A;  4PHT A;  1HH2 P;  4MH4 A;  4DV7 C;  3PRO C;  3K6R A;  3E7X A;  4PUI A;  4DUZ C;  1QWI A;  2V7B A;  4RMN A;  1UKK A;  4DV3 C;  3A9V A;  1HR0 C;  4NDN A;  2UUA C;  4X64 C;  2VQE C;  2PT7 G;  5KEI A;  2CU6 A;  5BSV A;  4DR3 C;  1T5D X;  2QW0 X;  3AF6 A;  5AE3 A;  1N32 C;  4DV2 C;  4U5Y D;  4BC9 A;  4KTT A;  5BUS A;  1RY2 A;  4GXR A;  1YGT A;  3T1H C;  1IB8 A;  2DHM A;  5IWA C;  3C5E A;  1MDF A;  2QVZ X;  1AMU A;  4ISB A;  3PES A;  5A1I A;  2DPL A;  1NYE A;  2M5O A;  3R9W A;  3AY0 A;  4DV6 C;  1WF3 A;  4B3T C;  2F4V C;  4BSZ A;  2UXB C;  2BJO A;  4OYC A;  4G37 A;  3TQI A;  2OPL A;  5BSU A;  4NXN C;  3N2Q A;  1PG3 A;  4DCT A;  3S82 A;  1L2F A;  4R0M A;  3TR3 A;  1XHJ A;  1O92 A;  2QVX X;  1EGA A;  4XX2 A;  3RG2 A;  1ZB9 A;  3L8C A;  4PZP A;  2D28 C;  2QL8 A;  2D7V A;  2ATW A;  3FCC A;  4KTV A;  2YCB A;  3CQ3 A;  5BST A;  1RG9 A;  1PU1 A;  1WH9 A;  2D27 A;  3LAX A;  1XMQ C;  2DYJ A;  3J80 D;  3OTO C;  3CQ2 A;  1FJG C;  1ZB8 A;  3CQ1 A;  5ADZ A; 
#chains in the Genus database with same CATH homology
 5E7Q A;  2P2F A;  3PBK A;  3AF5 A;  4B3M C;  3GKU A;  1XNQ C;  3G7S A;  3NYR A;  4DG8 A;  1USP B;  2VSQ A;  2BH1 X;  1PG4 A;  3DAY A;  2ASB A;  3EQ6 A;  4DCU A;  2D1S A;  4JI8 C;  1I94 C;  2D1T A;  4GS5 A;  2OBV A;  3TUF A;  5FLX D;  4KHP C;  3VNR A;  5IT9 D;  1MKY A;  1JOS A;  5KYT A;  4IZ6 A;  2UUC C;  4JI4 C;  5KYV A;  1PA4 A;  4JI2 C;  2UXC C;  2AYA A;  2HHH C;  4LF7 C;  4AQY C;  3GR1 A;  5T8T A;  3I07 A;  4LF8 C;  2E8C A;  1P7L A;  3H2T A;  1XRC A;  2YWB A;  2OPL B;  2EGT A;  3NYQ A;  4FUQ A;  1IBL C;  1N36 C;  4EAT A;  3CW8 X;  5T8S A;  5K8F A;  4LF9 C;  3CW9 A;  2ONF A;  1BA3 A;  4LFB C;  3IPL A;  4DR1 C;  1K0R A;  1J5E C;  3CJE A;  4BBY A;  4L4Q A;  3GPC A;  4D4I A;  3ETO A;  4ZJZ A;  4DV4 C;  3UOW A;  4WV3 A;  1MXA A;  4JI3 C;  3DHV A;  1O90 A;  5DV9 A;  4DR2 C;  3KXW A;  4LFA C;  4NOZ A;  3LGX A;  4WS9 A;  4LE5 A;  4DR7 C;  4FTF A;  2PRO A;  5CZV A;  2VQF C;  5AE2 A;  3ETC A;  4ODJ A;  4G36 A;  2JMP A;  4GXQ A;  3T1Y C;  2KZF A;  4DUY C;  2P2J A;  4R1M A;  5K85 A;  1N2F A;  1USP A;  2E5L C;  4FUT A;  4L7I A;  5BR8 C;  2WD9 A;  2UU9 C;  4K0B A;  4LF6 C;  1V25 A;  1MXB A;  4D56 A;  3EER A;  4L2Z A;  4D57 A;  4B3R C;  4YHH C;  3A4I A;  5LMN C;  2D1R A;  2ZM6 C;  5A19 A;  3L95 X;  2OO4 A;  3IEU A;  3R9X A;  4GKK C;  1HNX C;  3E7W A;  4DR5 C;  4JI6 C;  2CXC A;  4DV0 C;  3NI2 A;  3R44 A;  1IBM C;  1FUG A;  5H9U A;  4RVO A;  2P2B A;  3SO4 A;  5JRH A;  5LMU C;  3LUS A;  4RLQ A;  4NXM C;  2P20 A;  4ZLP A;  1GPM A;  5BUR A;  4K0K C;  1O93 A;  3DLP X;  3RV2 A;  4LF5 C;  2E7G A;  4RVN A;  2PN2 A;  4DV1 C;  4RM3 A;  3IEV A;  4GKJ C;  1KKG A;  5GTD A;  3NPD A;  4DV5 C;  1HNZ C;  4OX9 C;  4D4G A;  4IR7 A;  2P02 A;  1N33 C;  4JI5 C;  1IBK C;  2Y4O A;  2VZE A;  5IFI A;  2E8F A;  4I9G A;  4B3S C;  1MXC A;  4RM2 A;  1N34 C;  4DG9 A;  2HJG A;  4PRO C;  2UUB C;  4I9F A;  1XMO C;  1VLA A;  1LCI A;  1LQL A;  3A9U A;  1YJ7 A;  4BC7 A;  3B7W A;  3J7A D;  2YWC A;  4DCS A;  1V26 A;  5BUQ A;  4JI7 C;  5CZX A;  1XRB A;  3LNV A;  4G1I A;  4LF4 C;  2Y27 A;  2D1Q A;  4JI1 C;  2CY1 A;  4LFC C;  3J81 D;  4HPV A;  4JV5 C;  4RLF A;  4JYA C;  4DCV A;  3N54 B;  2P2Q A;  1O9T A;  2E8E A;  4BCA A;  3IML A;  2E0G A;  3GR0 A;  3JAM D;  5A1G A;  4DR4 C;  4JI0 C;  4X62 C;  2WP0 C;  4JM1 A;  5BSW A;  1XRA A;  5AE1 A;  1MD9 A;  2P2M A;  1XNR C;  2QVY X;  3UZ0 A;  3VNS A;  5A2Q D;  2UXD C;  1T5H X;  3FCE A;  4TPS B;  5BSR A;  4YY3 C;  4MTN A;  3TDE A;  1MDB A;  2XR1 A;  4OXI A;  5BSM A;  4X66 C;  1ML8 A;  4DR6 C;  1QM4 A;  4R1L A;  1HNW C;  3VNQ A;  3I08 A;  4X65 C;  1ULT A;  2Y4N A;  4PHT A;  1HH2 P;  4MH4 A;  4DV7 C;  3PRO C;  3E7X A;  4DUZ C;  1QWI A;  2V7B A;  4RMN A;  1UKK A;  4DV3 C;  3A9V A;  1HR0 C;  4NDN A;  2UUA C;  4X64 C;  2VQE C;  2PT7 G;  5KEI A;  5BSV A;  4DR3 C;  1T5D X;  2QW0 X;  3AF6 A;  5AE3 A;  1N32 C;  4DV2 C;  4U5Y D;  4BC9 A;  4KTT A;  5BUS A;  1RY2 A;  4GXR A;  3T1H C;  5IWA C;  3C5E A;  1MDF A;  2QVZ X;  1AMU A;  4ISB A;  3PES A;  5A1I A;  2DPL A;  1NYE A;  3R9W A;  4DV6 C;  1WF3 A;  4B3T C;  2F4V C;  4BSZ A;  2UXB C;  2BJO A;  4OYC A;  4G37 A;  3TQI A;  2OPL A;  5BSU A;  4NXN C;  3N2Q A;  1PG3 A;  4DCT A;  3S82 A;  1L2F A;  4R0M A;  1O92 A;  2QVX X;  1EGA A;  4XX2 A;  3RG2 A;  1ZB9 A;  3L8C A;  4PZP A;  2D28 C;  2QL8 A;  2D7V A;  2ATW A;  3FCC A;  4KTV A;  2YCB A;  5BST A;  1RG9 A;  1WH9 A;  2D27 A;  3LAX A;  1XMQ C;  2DYJ A;  3J80 D;  3OTO C;  1FJG C;  1ZB8 A;  5ADZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...