4AQYC

Structure of ribosome-apramycin complexes
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
total genus 39
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4aqyC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4aqyC02
4GKKC 4JI5C 3T1YC 4JI4C 2XR1A 1IBLC 4DV7C 5IT9D 2UU9C 5LMNC 1N36C 1JOSA 4JYAC 4DR3C 1MKYA 5LMUC 1ZB8A 3IEVA 4NOZA 4JI3C 4X65C 1N34C 4DV6C 4DCVA 4DR6C 4X66C 2DYJA 1N32C 4YHHC 4AQYC 2UUBC 2UXCC 4MTNA 4LF8C 4LF7C 5BR8C 2YCBA 1USPA 1WF3A 4JI8C 3T1HC 4DV1C 3J80D 1HH2P 1WH9A 2EGTA 4DR5C 3EERA 4B3RC 1QWIA 2PN2A 2HJGA 1N33C 1N2FA 4DUYC 4B3TC 4LF9C 2UUAC 2OPLA 3LUSA 4B3SC 4JI0C 1FJGC 4NXMC 2KZFA 2BJOA 3R9WA 1J5EC 4LFAC 2VQFC 5IWAC 2HHHC 4NXNC 4KHPC 1K0RA 2UXDC 2ONFA 1XMQC 4LFBC 1XNQC 1XNRC 4DR2C 2UUCC 4DUZC 1ML8A 2E8FA 4JI1C 2QL8A 1LQLA 4LF6C 4DV2C 1IBKC 2E5LC 1ZB9A 1USPB 4DV4C 1VLAA 3GKUA 4DV5C 4K0KC 1KKGA 2CY1A 3J7AD 3IEUA 2E8EA 2UXBC 3OTOC 4DCSA 1UKKA 4BSZA 4MH4A 4DCTA 2E7GA 3J81D 2VQEC 4JI6C 4X64C 1NYEA 4DV0C 4GKJC 2ATWA 3AF5A 4X62C 4JI7C 4OX9C 1PA4A 1HNXC 3R9XA 2JMPA 1EGAA 4JV5C 2F4VC 1HNZC 4LFCC 2ZM6C 2E8CA 2PT7G 4DR1C 4LF4C 3AF6A 4YY3C 2D7VA 3JAMD 1HR0C 4JI2C 1L2FA 4XX2A 1XMOC 4LF5C 2CXCA 3I07A 2ASBA 1IBMC 5FLXD 5A2QD 4DR4C 2OPLB 1I94C 1HNWC 4DV3C 4DR7C 4DCUA 3CJEA 4B3MC
chains in the Genus database with same CATH superfamily
4JI5C 3T1YC 5IT9D 3FM7A 2E0GA 4R1LA 1JOSA 1QM4A 4JYAC 3NYRA 4FUQA 2Y27A 1MKYA 1T5HX 1ZB8A 2MCQA 4JI3C 5BSTA 3A26A 1N34C 4DV6C 2DYJA 1N32C 2UXCC 4LF8C 3C5EA 5BR8C 1USPA 2MMAB 2VZEA 2Y4OA 3FCEA 4L7IA 3EERA 2V7BA 1QWIA 3K6RA 1V60A 2UUAC 3GR1A 4B3SC 4OYCA 3SO4A 4NXMC 2KZFA 1MDFA 2OO4A 4NDNA 5BSVA 2UXDC 1XMQC 4LFBC 1YJ7A 1BA3A 3NPDA 3ETOA 4DV2C 1ZB9A 1P4EA 3GKUA 4GXRA 1KKGA 2CY1A 4RLFA 3UEBA 4DCSA 3J81D 2E7GA 4JI6C 4EATA 3AF5A 4G37A 5ADZA 3PBKA 4OX9C 1MXCA 2JMPA 3L8CA 1XHJA 2PT7G 3AF6A 4FUTA 1YGTA 5BUSA 3DLPX 3NI2A 5CZVA 2MM9A 1XMOC 2P2MA 3I07A 1IBMC 5A2QD 4IR7A 3I08A 5IFIA 1XRAA 1PU1A 5KYTA 2P2JA 1V25A 2UU9C 1XDXA 1NY8A 4NOZA 4G36A 4RVNA 4DG8A 4X65C 4L4QA 3CQ1A 5E7QA 4U5YD 5A1GA 3S82A 4DCVA 4DR6C 4YHHC 3GR0A 4PZPA 1TH5A 3IPLA 4JI8C 3DAYA 4DV1C 2DPLA 1WH9A 4ODJA 4DR5C 5K8FA 2P2FA 4LE5A 5BUQA 3CW8X 2PN2A 4DUYC 4B3TC 1O92A 3A25A 3A9UA 4JI0C 4D4IA 3E7WA 5BSMA 1M6XC 3KXWA 4HPVA 4KTTA 2PG1E 4R0MA 1XNQC 4BC7A 2P2BA 3TR3A 1ML8A 3AY0A 3VNRA 4LF6C 1USPB 5BSWA 4DV5C 4RMNA 2BH1X 4GXQA 5A1IA 5KEIA 3J7AD 3IEUA 4L2ZA 3O2EA 3UZ0A 3OTOC 2KZ0A 3DHVA 4I9GA 4RM3A 2VQEC 4MH4A 5DV9A 3H2TA 2ATWA 3FCCA 2P02A 1T5DX 4JV5C 1EGAA 2F4VC 4LFCC 3RG2A 2ZTBA 5H9UA 2AYAA 4YY3C 5CZXA 1RY2A 1VEHA 2CXCA 2M5OA 5FLXD 4DR4C 4DG9A 3LAXA 4WV3A 1V26A 2OPLB 4JM1A 1LCIA 1HNWC 2DHMA 4DV3C 4DCUA 4B3MC 4D57A 4GKKC 3ETCA 1IBLC 4DV7C 1RG9A 1N36C 4GS5A 2QVXX 2WD9A 4DR3C 5LCIA 2ZZMA 3IEVA 3LNVA 3EQ6A 2QW0X 4R1MA 4AQYC 2UUBC 2JNVA 4MTNA 2WP0C 2YCBA 2YWCA 2D1TA 1HH2P 1AMUA 5JRHA 4B3RC 3E7XA 2HJGA 1N33C 3LUSA 3TQIA 5AE1A 3VNSA 1XRCA 2BJOA 1J5EC 2VQFC 2HHHC 4NXNC 1K0RA 2ONFA 4BC9A 4PUIA 2QVZX 1XNRC 4DR2C 4DUZC 4JI1C 2QL8A 3R44A 1LQLA 2Z51A 1IBKC 4K0BA 1PG4A 1VLAA 3L95X 2M5HA 3CW9A 1IB8A 5GTDA 4BSZA 4DCTA 4ZJZA 1GPMA 4X64C 4RVOA 4DV0C 4GKJC 2YWBA 4JI7C 2OBVA 1PA4A 5BSRA 1HNXC 3R9XA 1HNZC 3N54B 2ZM6C 1XS3A 4LF4C 1MXAA 3JAMD 1HR0C 2D1SA 4JI2C 3GPCA 4ISBA 1O93A 2P2QA 3LNOA 4PUHA 3TDEA 1MD9A 5A19A 1MXBA 1O90A 5K85A 4DR7C 2D28C 3UOWA 4JI4C 2XR1A 5BURA 1PG3A 5LMNC 3NYQA 3N2QA 5BSUA 1WCJA 4D56A 5LMUC 3PESA 4IZ6A 4BCAA 3PROC 4TPSB 4X66C 5AE3A 3CQ3A 2VSQA 2QVYX 4I9FA 3TUFA 5KYVA 3A9VA 4LF7C 2D1QA 1WF3A 3T1HC 3J80D 4G1IA 4RM2A 2EGTA 2ZZNA 1N2FA 5AE2A 4LF9C 2OPLA 4ZLPA 1FJGC 2D27A 3UX3A 4RLQA 3R9WA 4LFAC 5IWAC 4KHPC 4PUGA 4KTVA 2KDNA 1ULTA 2UUCC 2E8FA 2PROA 1M6XA 2E5LC 4DV4C 4K0KC 2CU6A 1XRBA 1UWDA 3UX2A 2NCLA 3A4IA 2YX1A 2E8EA 2UXBC 1FLOA 3CQ2A 3IMLA 1UKKA 4PHTA 5T8SA 1NYEA 1P4EC 4X62C 2P20A 3G7SA 1FUGA 4PROC 2Y4NA 2E8CA 4WS9A 4OXIA 4D4GA 4DR1C 2D7VA 3B7WA 1L2FA 4XX2A 4LF5C 4BBYA 2ASBA 2D1RA 3VNQA 3LGXA 1O9TA 1MDBA 1I94C 1P7LA 5T8TA 4FTFA 3CJEA 3RV2A
chains in the Genus database with same CATH topology
4JI5C 3T1YC 5IT9D 2E0GA 4R1LA 1JOSA 1QM4A 4JYAC 3NYRA 4FUQA 2Y27A 1MKYA 1T5HX 1ZB8A 4JI3C 5BSTA 1N34C 4DV6C 2DYJA 1N32C 2UXCC 4LF8C 3C5EA 5BR8C 1USPA 2VZEA 2Y4OA 3FCEA 4L7IA 3EERA 2V7BA 1QWIA 2UUAC 3GR1A 4B3SC 4OYCA 3SO4A 4NXMC 2KZFA 1MDFA 2OO4A 4NDNA 5BSVA 2UXDC 1XMQC 4LFBC 1YJ7A 1BA3A 3NPDA 3ETOA 4DV2C 1ZB9A 3GKUA 4GXRA 1KKGA 2CY1A 4RLFA 4DCSA 3J81D 2E7GA 4JI6C 4EATA 3AF5A 4G37A 5ADZA 3PBKA 4OX9C 1MXCA 2JMPA 3L8CA 2PT7G 3AF6A 4FUTA 5BUSA 3DLPX 3NI2A 5CZVA 1XMOC 2P2MA 3I07A 1IBMC 5A2QD 4IR7A 3I08A 5IFIA 1XRAA 5KYTA 2P2JA 1V25A 2UU9C 4NOZA 4G36A 4RVNA 4DG8A 4X65C 4L4QA 5E7QA 4U5YD 5A1GA 3S82A 4DCVA 4DR6C 4YHHC 3GR0A 4PZPA 3IPLA 4JI8C 3DAYA 4DV1C 2DPLA 1WH9A 4ODJA 4DR5C 5K8FA 2P2FA 4LE5A 5BUQA 3CW8X 2PN2A 4DUYC 4B3TC 1O92A 3A9UA 4JI0C 4D4IA 3E7WA 5BSMA 3KXWA 4HPVA 4KTTA 4R0MA 1XNQC 4BC7A 2P2BA 1ML8A 4LF6C 3VNRA 1USPB 5BSWA 4DV5C 4RMNA 2BH1X 4GXQA 5A1IA 5KEIA 3J7AD 3IEUA 4L2ZA 3UZ0A 3OTOC 4RM3A 3DHVA 4I9GA 2VQEC 4MH4A 5DV9A 3H2TA 2ATWA 3FCCA 2P02A 1T5DX 4JV5C 1EGAA 2F4VC 4LFCC 3RG2A 5H9UA 2AYAA 4YY3C 5CZXA 1RY2A 2CXCA 5FLXD 4DR4C 4DG9A 3LAXA 4WV3A 1V26A 2OPLB 4JM1A 1LCIA 1HNWC 4DV3C 4DCUA 4B3MC 4D57A 4GKKC 3ETCA 1IBLC 4DV7C 1RG9A 1N36C 4GS5A 2QVXX 2WD9A 4DR3C 3IEVA 3LNVA 3EQ6A 2QW0X 4R1MA 4AQYC 2UUBC 4MTNA 2WP0C 2YCBA 2YWCA 2D1TA 1HH2P 1AMUA 5JRHA 4B3RC 3E7XA 2HJGA 1N33C 3LUSA 3TQIA 5AE1A 3VNSA 1XRCA 2BJOA 1J5EC 2VQFC 2HHHC 4NXNC 1K0RA 2ONFA 4BC9A 2QVZX 1XNRC 4DR2C 4DUZC 4JI1C 2QL8A 3R44A 1LQLA 1IBKC 4K0BA 1PG4A 1VLAA 3L95X 3CW9A 5GTDA 4BSZA 4DCTA 4ZJZA 1GPMA 4X64C 4RVOA 4DV0C 4GKJC 2YWBA 4JI7C 2OBVA 1PA4A 5BSRA 1HNXC 3R9XA 1HNZC 3N54B 2ZM6C 4LF4C 1MXAA 3JAMD 1HR0C 2D1SA 4JI2C 3GPCA 4ISBA 1O93A 2P2QA 3TDEA 1MD9A 5A19A 1MXBA 1O90A 5K85A 4DR7C 2D28C 3UOWA 4JI4C 2XR1A 5BURA 1PG3A 5LMNC 3NYQA 3N2QA 5BSUA 4D56A 5LMUC 3PESA 4IZ6A 4BCAA 3PROC 4TPSB 4X66C 5AE3A 2VSQA 2QVYX 4I9FA 3TUFA 5KYVA 3A9VA 4LF7C 2D1QA 1WF3A 3T1HC 3J80D 4G1IA 4RM2A 2EGTA 1N2FA 5AE2A 4LF9C 2OPLA 4ZLPA 1FJGC 2D27A 4RLQA 3R9WA 4LFAC 5IWAC 4KHPC 4KTVA 1ULTA 2UUCC 2E8FA 2PROA 2E5LC 4DV4C 4K0KC 1XRBA 3A4IA 2E8EA 2UXBC 3IMLA 1UKKA 4PHTA 5T8SA 1NYEA 4X62C 2P20A 3G7SA 1FUGA 4PROC 2Y4NA 2E8CA 4DR1C 4OXIA 4WS9A 4D4GA 2D7VA 3B7WA 1L2FA 4XX2A 4LF5C 4BBYA 2ASBA 2D1RA 3VNQA 3LGXA 1O9TA 1MDBA 1I94C 1P7LA 5T8TA 4FTFA 3CJEA 3RV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK C;  4JI5 C;  3T1Y C;  4JI4 C;  2XR1 A;  1IBL C;  4DV7 C;  5IT9 D;  2UU9 C;  5LMN C;  1N36 C;  1JOS A;  4JYA C;  4DR3 C;  1MKY A;  5LMU C;  1ZB8 A;  3IEV A;  4NOZ A;  4JI3 C;  4X65 C;  1N34 C;  4DV6 C;  4DCV A;  4DR6 C;  4X66 C;  2DYJ A;  1N32 C;  4YHH C;  4AQY C;  2UUB C;  2UXC C;  4MTN A;  4LF8 C;  4LF7 C;  5BR8 C;  2YCB A;  1USP A;  1WF3 A;  4JI8 C;  3T1H C;  4DV1 C;  3J80 D;  1HH2 P;  1WH9 A;  2EGT A;  4DR5 C;  3EER A;  4B3R C;  1QWI A;  2PN2 A;  2HJG A;  1N33 C;  1N2F A;  4DUY C;  4B3T C;  4LF9 C;  2UUA C;  2OPL A;  3LUS A;  4B3S C;  4JI0 C;  1FJG C;  4NXM C;  2KZF A;  2BJO A;  3R9W A;  1J5E C;  4LFA C;  2VQF C;  5IWA C;  2HHH C;  4NXN C;  4KHP C;  1K0R A;  2UXD C;  2ONF A;  1XMQ C;  4LFB C;  1XNQ C;  1XNR C;  4DR2 C;  2UUC C;  4DUZ C;  1ML8 A;  2E8F A;  4JI1 C;  2QL8 A;  1LQL A;  4LF6 C;  4DV2 C;  1IBK C;  2E5L C;  1ZB9 A;  1USP B;  4DV4 C;  1VLA A;  3GKU A;  4DV5 C;  4K0K C;  1KKG A;  2CY1 A;  3J7A D;  3IEU A;  2E8E A;  2UXB C;  3OTO C;  4DCS A;  1UKK A;  4BSZ A;  4MH4 A;  4DCT A;  2E7G A;  3J81 D;  2VQE C;  4JI6 C;  4X64 C;  1NYE A;  4DV0 C;  4GKJ C;  2ATW A;  3AF5 A;  4X62 C;  4JI7 C;  4OX9 C;  1PA4 A;  1HNX C;  3R9X A;  2JMP A;  1EGA A;  4JV5 C;  2F4V C;  1HNZ C;  4LFC C;  2ZM6 C;  2E8C A;  2PT7 G;  4DR1 C;  4LF4 C;  3AF6 A;  4YY3 C;  2D7V A;  3JAM D;  1HR0 C;  4JI2 C;  1L2F A;  4XX2 A;  1XMO C;  4LF5 C;  2CXC A;  3I07 A;  2ASB A;  1IBM C;  5FLX D;  5A2Q D;  4DR4 C;  2OPL B;  1I94 C;  1HNW C;  4DV3 C;  4DR7 C;  4DCU A;  3CJE A;  4B3M C; 
#chains in the Genus database with same CATH topology
 4JI5 C;  3T1Y C;  5IT9 D;  3FM7 A;  2E0G A;  4R1L A;  1JOS A;  1QM4 A;  4JYA C;  3NYR A;  4FUQ A;  2Y27 A;  1MKY A;  1T5H X;  1ZB8 A;  2MCQ A;  4JI3 C;  5BST A;  3A26 A;  1N34 C;  4DV6 C;  2DYJ A;  1N32 C;  2UXC C;  4LF8 C;  3C5E A;  5BR8 C;  1USP A;  2MMA B;  2VZE A;  2Y4O A;  3FCE A;  4L7I A;  3EER A;  2V7B A;  1QWI A;  3K6R A;  1V60 A;  2UUA C;  3GR1 A;  4B3S C;  4OYC A;  3SO4 A;  4NXM C;  2KZF A;  1MDF A;  2OO4 A;  4NDN A;  5BSV A;  2UXD C;  1XMQ C;  4LFB C;  1YJ7 A;  1BA3 A;  3NPD A;  3ETO A;  4DV2 C;  1ZB9 A;  1P4E A;  3GKU A;  4GXR A;  1KKG A;  2CY1 A;  4RLF A;  3UEB A;  4DCS A;  3J81 D;  2E7G A;  4JI6 C;  4EAT A;  3AF5 A;  4G37 A;  5ADZ A;  3PBK A;  4OX9 C;  1MXC A;  2JMP A;  3L8C A;  1XHJ A;  2PT7 G;  3AF6 A;  4FUT A;  1YGT A;  5BUS A;  3DLP X;  3NI2 A;  5CZV A;  2MM9 A;  1XMO C;  2P2M A;  3I07 A;  1IBM C;  5A2Q D;  4IR7 A;  3I08 A;  5IFI A;  1XRA A;  1PU1 A;  5KYT A;  2P2J A;  1V25 A;  2UU9 C;  1XDX A;  1NY8 A;  4NOZ A;  4G36 A;  4RVN A;  4DG8 A;  4X65 C;  4L4Q A;  3CQ1 A;  5E7Q A;  4U5Y D;  5A1G A;  3S82 A;  4DCV A;  4DR6 C;  4YHH C;  3GR0 A;  4PZP A;  1TH5 A;  3IPL A;  4JI8 C;  3DAY A;  4DV1 C;  2DPL A;  1WH9 A;  4ODJ A;  4DR5 C;  5K8F A;  2P2F A;  4LE5 A;  5BUQ A;  3CW8 X;  2PN2 A;  4DUY C;  4B3T C;  1O92 A;  3A25 A;  3A9U A;  4JI0 C;  4D4I A;  3E7W A;  5BSM A;  1M6X C;  3KXW A;  4HPV A;  4KTT A;  2PG1 E;  4R0M A;  1XNQ C;  4BC7 A;  2P2B A;  3TR3 A;  1ML8 A;  3AY0 A;  3VNR A;  4LF6 C;  1USP B;  5BSW A;  4DV5 C;  4RMN A;  2BH1 X;  4GXQ A;  5A1I A;  5KEI A;  3J7A D;  3IEU A;  4L2Z A;  3O2E A;  3UZ0 A;  3OTO C;  2KZ0 A;  3DHV A;  4I9G A;  4RM3 A;  2VQE C;  4MH4 A;  5DV9 A;  3H2T A;  2ATW A;  3FCC A;  2P02 A;  1T5D X;  4JV5 C;  1EGA A;  2F4V C;  4LFC C;  3RG2 A;  2ZTB A;  5H9U A;  2AYA A;  4YY3 C;  5CZX A;  1RY2 A;  1VEH A;  2CXC A;  2M5O A;  5FLX D;  4DR4 C;  4DG9 A;  3LAX A;  4WV3 A;  1V26 A;  2OPL B;  4JM1 A;  1LCI A;  1HNW C;  2DHM A;  4DV3 C;  4DCU A;  4B3M C;  4D57 A;  4GKK C;  3ETC A;  1IBL C;  4DV7 C;  1RG9 A;  1N36 C;  4GS5 A;  2QVX X;  2WD9 A;  4DR3 C;  5LCI A;  2ZZM A;  3IEV A;  3LNV A;  3EQ6 A;  2QW0 X;  4R1M A;  4AQY C;  2UUB C;  2JNV A;  4MTN A;  2WP0 C;  2YCB A;  2YWC A;  2D1T A;  1HH2 P;  1AMU A;  5JRH A;  4B3R C;  3E7X A;  2HJG A;  1N33 C;  3LUS A;  3TQI A;  5AE1 A;  3VNS A;  1XRC A;  2BJO A;  1J5E C;  2VQF C;  2HHH C;  4NXN C;  1K0R A;  2ONF A;  4BC9 A;  4PUI A;  2QVZ X;  1XNR C;  4DR2 C;  4DUZ C;  4JI1 C;  2QL8 A;  3R44 A;  1LQL A;  2Z51 A;  1IBK C;  4K0B A;  1PG4 A;  1VLA A;  3L95 X;  2M5H A;  3CW9 A;  1IB8 A;  5GTD A;  4BSZ A;  4DCT A;  4ZJZ A;  1GPM A;  4X64 C;  4RVO A;  4DV0 C;  4GKJ C;  2YWB A;  4JI7 C;  2OBV A;  1PA4 A;  5BSR A;  1HNX C;  3R9X A;  1HNZ C;  3N54 B;  2ZM6 C;  1XS3 A;  4LF4 C;  1MXA A;  3JAM D;  1HR0 C;  2D1S A;  4JI2 C;  3GPC A;  4ISB A;  1O93 A;  2P2Q A;  3LNO A;  4PUH A;  3TDE A;  1MD9 A;  5A19 A;  1MXB A;  1O90 A;  5K85 A;  4DR7 C;  2D28 C;  3UOW A;  4JI4 C;  2XR1 A;  5BUR A;  1PG3 A;  5LMN C;  3NYQ A;  3N2Q A;  5BSU A;  1WCJ A;  4D56 A;  5LMU C;  3PES A;  4IZ6 A;  4BCA A;  3PRO C;  4TPS B;  4X66 C;  5AE3 A;  3CQ3 A;  2VSQ A;  2QVY X;  4I9F A;  3TUF A;  5KYV A;  3A9V A;  4LF7 C;  2D1Q A;  1WF3 A;  3T1H C;  3J80 D;  4G1I A;  4RM2 A;  2EGT A;  2ZZN A;  1N2F A;  5AE2 A;  4LF9 C;  2OPL A;  4ZLP A;  1FJG C;  2D27 A;  3UX3 A;  4RLQ A;  3R9W A;  4LFA C;  5IWA C;  4KHP C;  4PUG A;  4KTV A;  2KDN A;  1ULT A;  2UUC C;  2E8F A;  2PRO A;  1M6X A;  2E5L C;  4DV4 C;  4K0K C;  2CU6 A;  1XRB A;  1UWD A;  3UX2 A;  2NCL A;  3A4I A;  2YX1 A;  2E8E A;  2UXB C;  1FLO A;  3CQ2 A;  3IML A;  1UKK A;  4PHT A;  5T8S A;  1NYE A;  1P4E C;  4X62 C;  2P20 A;  3G7S A;  1FUG A;  4PRO C;  2Y4N A;  2E8C A;  4WS9 A;  4OXI A;  4D4G A;  4DR1 C;  2D7V A;  3B7W A;  1L2F A;  4XX2 A;  4LF5 C;  4BBY A;  2ASB A;  2D1R A;  3VNQ A;  3LGX A;  1O9T A;  1MDB A;  1I94 C;  1P7L A;  5T8T A;  4FTF A;  3CJE A;  3RV2 A; 
#chains in the Genus database with same CATH homology
 4JI5 C;  3T1Y C;  5IT9 D;  2E0G A;  4R1L A;  1JOS A;  1QM4 A;  4JYA C;  3NYR A;  4FUQ A;  2Y27 A;  1MKY A;  1T5H X;  1ZB8 A;  4JI3 C;  5BST A;  1N34 C;  4DV6 C;  2DYJ A;  1N32 C;  2UXC C;  4LF8 C;  3C5E A;  5BR8 C;  1USP A;  2VZE A;  2Y4O A;  3FCE A;  4L7I A;  3EER A;  2V7B A;  1QWI A;  2UUA C;  3GR1 A;  4B3S C;  4OYC A;  3SO4 A;  4NXM C;  2KZF A;  1MDF A;  2OO4 A;  4NDN A;  5BSV A;  2UXD C;  1XMQ C;  4LFB C;  1YJ7 A;  1BA3 A;  3NPD A;  3ETO A;  4DV2 C;  1ZB9 A;  3GKU A;  4GXR A;  1KKG A;  2CY1 A;  4RLF A;  4DCS A;  3J81 D;  2E7G A;  4JI6 C;  4EAT A;  3AF5 A;  4G37 A;  5ADZ A;  3PBK A;  4OX9 C;  1MXC A;  2JMP A;  3L8C A;  2PT7 G;  3AF6 A;  4FUT A;  5BUS A;  3DLP X;  3NI2 A;  5CZV A;  1XMO C;  2P2M A;  3I07 A;  1IBM C;  5A2Q D;  4IR7 A;  3I08 A;  5IFI A;  1XRA A;  5KYT A;  2P2J A;  1V25 A;  2UU9 C;  4NOZ A;  4G36 A;  4RVN A;  4DG8 A;  4X65 C;  4L4Q A;  5E7Q A;  4U5Y D;  5A1G A;  3S82 A;  4DCV A;  4DR6 C;  4YHH C;  3GR0 A;  4PZP A;  3IPL A;  4JI8 C;  3DAY A;  4DV1 C;  2DPL A;  1WH9 A;  4ODJ A;  4DR5 C;  5K8F A;  2P2F A;  4LE5 A;  5BUQ A;  3CW8 X;  2PN2 A;  4DUY C;  4B3T C;  1O92 A;  3A9U A;  4JI0 C;  4D4I A;  3E7W A;  5BSM A;  3KXW A;  4HPV A;  4KTT A;  4R0M A;  1XNQ C;  4BC7 A;  2P2B A;  1ML8 A;  4LF6 C;  3VNR A;  1USP B;  5BSW A;  4DV5 C;  4RMN A;  2BH1 X;  4GXQ A;  5A1I A;  5KEI A;  3J7A D;  3IEU A;  4L2Z A;  3UZ0 A;  3OTO C;  4RM3 A;  3DHV A;  4I9G A;  2VQE C;  4MH4 A;  5DV9 A;  3H2T A;  2ATW A;  3FCC A;  2P02 A;  1T5D X;  4JV5 C;  1EGA A;  2F4V C;  4LFC C;  3RG2 A;  5H9U A;  2AYA A;  4YY3 C;  5CZX A;  1RY2 A;  2CXC A;  5FLX D;  4DR4 C;  4DG9 A;  3LAX A;  4WV3 A;  1V26 A;  2OPL B;  4JM1 A;  1LCI A;  1HNW C;  4DV3 C;  4DCU A;  4B3M C;  4D57 A;  4GKK C;  3ETC A;  1IBL C;  4DV7 C;  1RG9 A;  1N36 C;  4GS5 A;  2QVX X;  2WD9 A;  4DR3 C;  3IEV A;  3LNV A;  3EQ6 A;  2QW0 X;  4R1M A;  4AQY C;  2UUB C;  4MTN A;  2WP0 C;  2YCB A;  2YWC A;  2D1T A;  1HH2 P;  1AMU A;  5JRH A;  4B3R C;  3E7X A;  2HJG A;  1N33 C;  3LUS A;  3TQI A;  5AE1 A;  3VNS A;  1XRC A;  2BJO A;  1J5E C;  2VQF C;  2HHH C;  4NXN C;  1K0R A;  2ONF A;  4BC9 A;  2QVZ X;  1XNR C;  4DR2 C;  4DUZ C;  4JI1 C;  2QL8 A;  3R44 A;  1LQL A;  1IBK C;  4K0B A;  1PG4 A;  1VLA A;  3L95 X;  3CW9 A;  5GTD A;  4BSZ A;  4DCT A;  4ZJZ A;  1GPM A;  4X64 C;  4RVO A;  4DV0 C;  4GKJ C;  2YWB A;  4JI7 C;  2OBV A;  1PA4 A;  5BSR A;  1HNX C;  3R9X A;  1HNZ C;  3N54 B;  2ZM6 C;  4LF4 C;  1MXA A;  3JAM D;  1HR0 C;  2D1S A;  4JI2 C;  3GPC A;  4ISB A;  1O93 A;  2P2Q A;  3TDE A;  1MD9 A;  5A19 A;  1MXB A;  1O90 A;  5K85 A;  4DR7 C;  2D28 C;  3UOW A;  4JI4 C;  2XR1 A;  5BUR A;  1PG3 A;  5LMN C;  3NYQ A;  3N2Q A;  5BSU A;  4D56 A;  5LMU C;  3PES A;  4IZ6 A;  4BCA A;  3PRO C;  4TPS B;  4X66 C;  5AE3 A;  2VSQ A;  2QVY X;  4I9F A;  3TUF A;  5KYV A;  3A9V A;  4LF7 C;  2D1Q A;  1WF3 A;  3T1H C;  3J80 D;  4G1I A;  4RM2 A;  2EGT A;  1N2F A;  5AE2 A;  4LF9 C;  2OPL A;  4ZLP A;  1FJG C;  2D27 A;  4RLQ A;  3R9W A;  4LFA C;  5IWA C;  4KHP C;  4KTV A;  1ULT A;  2UUC C;  2E8F A;  2PRO A;  2E5L C;  4DV4 C;  4K0K C;  1XRB A;  3A4I A;  2E8E A;  2UXB C;  3IML A;  1UKK A;  4PHT A;  5T8S A;  1NYE A;  4X62 C;  2P20 A;  3G7S A;  1FUG A;  4PRO C;  2Y4N A;  2E8C A;  4DR1 C;  4OXI A;  4WS9 A;  4D4G A;  2D7V A;  3B7W A;  1L2F A;  4XX2 A;  4LF5 C;  4BBY A;  2ASB A;  2D1R A;  3VNQ A;  3LGX A;  1O9T A;  1MDB A;  1I94 C;  1P7L A;  5T8T A;  4FTF A;  3CJE A;  3RV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...