4AQYC

Structure of ribosome-apramycin complexes
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 39
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4aqyC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4aqyC02
1IBLC 4LFBC 4DCSA 4B3RC 2VQFC 4JI3C 2VQEC 3GKUA 4DCTA 1IBKC 1HNZC 1LQLA 2OPLA 2CY1A 4DV1C 4KHPC 4MTNA 2HHHC 5IT9D 2PT7G 4JI1C 2UXDC 4NXMC 1N2FA 4DUYC 4JI8C 3LUSA 3AF5A 2HJGA 2UUAC 4JI4C 4B3MC 4JI7C 3CJEA 4MH4A 4DCVA 4DR7C 3IEVA 1USPB 1VLAA 1QWIA 4JV5C 1N32C 2UXCC 1N36C 4B3SC 3I07A 1XMQC 1XMOC 4DV0C 1UKKA 2ATWA 4X62C 4JI5C 2D7VA 4X66C 1XNQC 2E8CA 2KZFA 3R9XA 5LMUC 4XX2A 2JMPA 3JAMD 4DV3C 4BSZA 1K0RA 1PA4A 1HR0C 2UXBC 1ZB8A 4X64C 4LF4C 3IEUA 3J80D 1N33C 1I94C 3AF6A 3T1YC 4DV5C 2UU9C 1HNWC 2UUBC 4LF6C 2ONFA 4OX9C 2BJOA 1KKGA 1L2FA 4JYAC 2XR1A 1N34C 4DR2C 4JI0C 2DYJA 2EGTA 1HH2P 3OTOC 1ZB9A 5A2QD 4DR3C 2E8EA 4DV2C 2OPLB 1EGAA 4YY3C 4LF5C 1NYEA 3EERA 4X65C 5BR8C 1JOSA 3J81D 4LF8C 4DV7C 4DR1C 2E7GA 4DCUA 2ZM6C 1ML8A 4AQYC 2E5LC 2E8FA 4NXNC 4LF9C 1FJGC 5LMNC 1WH9A 1HNXC 4LFCC 4GKKC 1USPA 4YHHC 5FLXD 4DR4C 4DV4C 4DV6C 4NOZA 4B3TC 3R9WA 2QL8A 2ASBA 2PN2A 4K0KC 2F4VC 4LF7C 1IBMC 3T1HC 1J5EC 4GKJC 1MKYA 4JI2C 2UUCC 3J7AD 1XNRC 4DR5C 4LFAC 1WF3A 2CXCA 4DR6C 4JI6C 4DUZC 2YCBA 5IWAC
chains in the Genus database with same CATH superfamily
4B3RC 2VQEC 5BSUA 1O92A 1IBKC 2OBVA 2CY1A 1BA3A 4DV1C 5K8FA 3I08A 5AE2A 5E7QA 2MCQA 4JI1C 4D4IA 2V7BA 5CZVA 4RM2A 3CQ2A 4JI8C 1O93A 2HJGA 3TQIA 4JI7C 4FTFA 3UEBA 4I9FA 1N36C 3I07A 4DV0C 2ATWA 4X62C 1RG9A 3TR3A 3IPLA 2DHMA 3R9XA 3EQ6A 4BBYA 3JAMD 4DV3C 4BSZA 1K0RA 3J80D 4RMNA 1I94C 3LNOA 3TDEA 4DV5C 2UU9C 4PUIA 4IZ6A 1MDFA 4GXRA 3A25A 2D1SA 2P2BA 1AMUA 1N34C 1V60A 4G36A 5BSTA 1UWDA 1V26A 3B7WA 2EGTA 3OTOC 4OXIA 4IR7A 2E8EA 1EGAA 3PBKA 4JM1A 4LF8C 4KTTA 4OYCA 4DCUA 2JNVA 2E5LC 1RY2A 1WH9A 4LFCC 3A4IA 4BC9A 4DV4C 1MD9A 2M5OA 3PESA 3R9WA 3SO4A 4D56A 2PN2A 4K0KC 2F4VC 3A26A 1XRAA 1IBMC 2KDNA 3T1HC 3N54B 2MMAB 2PG1E 4GS5A 4LFAC 5AE1A 2NCLA 2YCBA 1TH5A 1IBLC 4LFBC 2QVYX 3IMLA 5H9UA 5KYTA 3FM7A 5T8SA 3GKUA 4DCTA 3C5EA 4R1LA 4GXQA 4PUGA 3UX3A 4KHPC 3L95X 2PT7G 2D1TA 2UXDC 5BSVA 1MXAA 4DUYC 4PZPA 2CU6A 4BCAA 3AF5A 4BC7A 2UUAC 4B3MC 2YWBA 2DPLA 1VLAA 1QWIA 4PROC 2UXCC 3S82A 1XMOC 3UZ0A 2D7VA 4X66C 2E8CA 1PA4A 3CW9A 1FLOA 3IEUA 3GR1A 2OO4A 4ZLPA 3AF6A 2YX1A 1HNWC 2ONFA 2BJOA 1MXBA 3NYQA 1PG4A 2DYJA 3VNSA 5A2QD 4ISBA 2P20A 4X65C 1JOSA 4G37A 2MM9A 1XRBA 1XHJA 4AQYC 4G1IA 1P4EC 4NXNC 4LF9C 1M6XC 1FJGC 1USPA 3L8CA 5A1IA 3PROC 1LCIA 5IFIA 1NY8A 5BSMA 2D27A 2M5HA 4GKJC 1PU1A 1QM4A 1MKYA 3GPCA 5BUSA 2P2MA 3J7AD 2QVZX 3KXWA 4WS9A 1WF3A 3DLPX 4DUZC 5K85A 4KTVA 5IWAC 4RVNA 2Y27A 1T5DX 4L2ZA 3E7WA 1M6XA 1LQLA 2VSQA 3NPDA 2OPLA 4RVOA 4DG8A 5A1GA 4WV3A 4L7IA 3VNRA 1IB8A 3DHVA 4NXMC 3LAXA 2D1RA 3UOWA 4FUQA 3CQ1A 2P2JA 4I9GA 4K0BA 4MH4A 1P7LA 2QVXX 2WD9A 5BSRA 5LCIA 1USPB 3IEVA 3ETCA 4JV5C 3RG2A 4B3SC 1XMQC 4JI5C 2KZFA 4HPVA 5LMUC 4XX2A 1HR0C 2UXBC 4LF4C 3T1YC 2D1QA 2UUBC 4LF6C 3N2QA 4OX9C 5KYVA 1KKGA 4L4QA 4JYAC 2XR1A 4JI0C 1HH2P 1ZB9A 4DR3C 4EATA 4RLQA 3LGXA 4DV2C 2OPLB 5CZXA 4YY3C 4LF5C 1NYEA 1ULTA 5BR8C 3NYRA 3J81D 3NI2A 2E8FA 3CW8X 3FCEA 3VNQA 5ADZA 4DV6C 2D28C 1YJ7A 2QL8A 3AY0A 4R1MA 1XRCA 4LF7C 5JRHA 5DV9A 1J5EC 4FUTA 2ZTBA 1FUGA 2UUCC 3A9VA 4DR5C 1V25A 3DAYA 4DR6C 1MXCA 3TUFA 2PROA 4DG9A 1MDBA 3ETOA 4DCSA 5BUQA 4ODJA 2VQFC 4JI3C 2Y4NA 4PHTA 1O90A 1HNZC 2ZZMA 2P02A 1VEHA 1XDXA 2QW0X 4MTNA 2HHHC 5IT9D 4RM3A 3K6RA 3A9UA 5T8TA 1N2FA 3LUSA 5GTDA 4ZJZA 4U5YD 4JI4C 2VZEA 3CJEA 4DCVA 1P4EA 4NDNA 1XS3A 4DR7C 3O2EA 1N32C 1PG3A 2YWCA 1UKKA 1XNQC 3LNVA 2AYAA 2JMPA 4D4GA 1ZB8A 4X64C 1N33C 2P2FA 2BH1X 1L2FA 3H2TA 1T5HX 4LE5A 4D57A 2P2QA 5AE3A 3EERA 4DV7C 4DR1C 1O9TA 2E7GA 3E7XA 3CQ3A 2ZM6C 1ML8A 3FCCA 3GR0A 4PUHA 5LMNC 1HNXC 2ZZNA 4GKKC 2E0GA 2WP0C 4YHHC 1YGTA 5FLXD 4DR4C 2KZ0A 4TPSB 4NOZA 4B3TC 4R0MA 5KEIA 2ASBA 2Z51A 2Y4OA 5BURA 5A19A 4JI2C 3G7SA 5BSWA 1GPMA 1XNRC 3R44A 2CXCA 4RLFA 3UX2A 4JI6C 3RV2A 1WCJA 4DR2C
chains in the Genus database with same CATH topology
4B3RC 2VQEC 5BSUA 1O92A 1IBKC 2OBVA 2CY1A 1BA3A 4DV1C 5K8FA 3I08A 5AE2A 5E7QA 4JI1C 4D4IA 2V7BA 5CZVA 4RM2A 4JI8C 1O93A 2HJGA 3TQIA 4JI7C 4FTFA 4I9FA 1N36C 3I07A 4DV0C 2ATWA 4X62C 1RG9A 3IPLA 3R9XA 3EQ6A 4BBYA 3JAMD 4DV3C 4BSZA 1K0RA 3J80D 4RMNA 1I94C 3TDEA 4DV5C 2UU9C 4IZ6A 1MDFA 4GXRA 2D1SA 2P2BA 1AMUA 1N34C 4G36A 5BSTA 1V26A 3B7WA 2EGTA 3OTOC 4OXIA 4IR7A 2E8EA 1EGAA 3PBKA 4JM1A 4LF8C 4KTTA 4OYCA 4DCUA 2E5LC 1RY2A 1WH9A 4LFCC 3A4IA 4BC9A 4DV4C 1MD9A 3PESA 3R9WA 3SO4A 4D56A 2PN2A 4K0KC 2F4VC 1XRAA 1IBMC 3T1HC 3N54B 4GS5A 4LFAC 5AE1A 2YCBA 1IBLC 4LFBC 2QVYX 3IMLA 5H9UA 5KYTA 5T8SA 3GKUA 4DCTA 3C5EA 4R1LA 4GXQA 4KHPC 3L95X 2PT7G 2D1TA 2UXDC 5BSVA 1MXAA 4DUYC 4PZPA 4BCAA 3AF5A 4BC7A 2UUAC 4B3MC 2YWBA 2DPLA 1VLAA 1QWIA 4PROC 2UXCC 3S82A 1XMOC 3UZ0A 2D7VA 4X66C 2E8CA 1PA4A 3CW9A 3IEUA 3GR1A 2OO4A 4ZLPA 3AF6A 1HNWC 2ONFA 2BJOA 1MXBA 3NYQA 1PG4A 2DYJA 3VNSA 5A2QD 4ISBA 2P20A 4X65C 1JOSA 4G37A 1XRBA 4AQYC 4G1IA 4NXNC 4LF9C 1FJGC 1USPA 3L8CA 5A1IA 3PROC 1LCIA 5IFIA 5BSMA 2D27A 4GKJC 1QM4A 1MKYA 3GPCA 5BUSA 2P2MA 3J7AD 2QVZX 3KXWA 4WS9A 1WF3A 3DLPX 4DUZC 5K85A 4KTVA 5IWAC 4RVNA 2Y27A 1T5DX 4L2ZA 3E7WA 1LQLA 2VSQA 3NPDA 2OPLA 4RVOA 4DG8A 5A1GA 4WV3A 4L7IA 3VNRA 3DHVA 4NXMC 3LAXA 2D1RA 3UOWA 4FUQA 2P2JA 4I9GA 4K0BA 4MH4A 1P7LA 2QVXX 2WD9A 5BSRA 3IEVA 1USPB 3ETCA 4JV5C 3RG2A 4B3SC 1XMQC 4JI5C 2KZFA 4HPVA 5LMUC 4XX2A 1HR0C 2UXBC 4LF4C 3T1YC 2D1QA 2UUBC 4LF6C 3N2QA 4OX9C 5KYVA 1KKGA 4L4QA 4JYAC 2XR1A 4JI0C 1HH2P 1ZB9A 4DR3C 4EATA 4RLQA 3LGXA 4DV2C 2OPLB 5CZXA 4YY3C 4LF5C 1NYEA 1ULTA 5BR8C 3NYRA 3J81D 3NI2A 2E8FA 3CW8X 3FCEA 3VNQA 5ADZA 4DV6C 2D28C 1YJ7A 2QL8A 4R1MA 1XRCA 4LF7C 5JRHA 5DV9A 1J5EC 4FUTA 1FUGA 2UUCC 3A9VA 4DR5C 1V25A 3DAYA 4DR6C 1MXCA 3TUFA 2PROA 4DG9A 1MDBA 3ETOA 4DCSA 5BUQA 4ODJA 2VQFC 4JI3C 2Y4NA 4PHTA 1O90A 1HNZC 2P02A 2QW0X 4MTNA 2HHHC 5IT9D 4RM3A 3A9UA 5T8TA 1N2FA 3LUSA 5GTDA 4ZJZA 4U5YD 4JI4C 2VZEA 3CJEA 4DCVA 4NDNA 4DR7C 1N32C 1PG3A 2YWCA 1UKKA 1XNQC 3LNVA 2AYAA 2JMPA 4D4GA 1ZB8A 4X64C 1N33C 2P2FA 2BH1X 1L2FA 3H2TA 1T5HX 4LE5A 4D57A 2P2QA 5AE3A 3EERA 4DV7C 4DR1C 1O9TA 2E7GA 3E7XA 2ZM6C 1ML8A 3FCCA 3GR0A 5LMNC 1HNXC 4GKKC 2E0GA 2WP0C 4YHHC 5FLXD 4DR4C 4TPSB 4NOZA 4B3TC 4R0MA 5KEIA 2ASBA 2Y4OA 5BURA 5A19A 4JI2C 3G7SA 5BSWA 1GPMA 1XNRC 3R44A 2CXCA 4RLFA 4JI6C 3RV2A 4DR2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL C;  4LFB C;  4DCS A;  4B3R C;  2VQF C;  4JI3 C;  2VQE C;  3GKU A;  4DCT A;  1IBK C;  1HNZ C;  1LQL A;  2OPL A;  2CY1 A;  4DV1 C;  4KHP C;  4MTN A;  2HHH C;  5IT9 D;  2PT7 G;  4JI1 C;  2UXD C;  4NXM C;  1N2F A;  4DUY C;  4JI8 C;  3LUS A;  3AF5 A;  2HJG A;  2UUA C;  4JI4 C;  4B3M C;  4JI7 C;  3CJE A;  4MH4 A;  4DCV A;  4DR7 C;  3IEV A;  1USP B;  1VLA A;  1QWI A;  4JV5 C;  1N32 C;  2UXC C;  1N36 C;  4B3S C;  3I07 A;  1XMQ C;  1XMO C;  4DV0 C;  1UKK A;  2ATW A;  4X62 C;  4JI5 C;  2D7V A;  4X66 C;  1XNQ C;  2E8C A;  2KZF A;  3R9X A;  5LMU C;  4XX2 A;  2JMP A;  3JAM D;  4DV3 C;  4BSZ A;  1K0R A;  1PA4 A;  1HR0 C;  2UXB C;  1ZB8 A;  4X64 C;  4LF4 C;  3IEU A;  3J80 D;  1N33 C;  1I94 C;  3AF6 A;  3T1Y C;  4DV5 C;  2UU9 C;  1HNW C;  2UUB C;  4LF6 C;  2ONF A;  4OX9 C;  2BJO A;  1KKG A;  1L2F A;  4JYA C;  2XR1 A;  1N34 C;  4DR2 C;  4JI0 C;  2DYJ A;  2EGT A;  1HH2 P;  3OTO C;  1ZB9 A;  5A2Q D;  4DR3 C;  2E8E A;  4DV2 C;  2OPL B;  1EGA A;  4YY3 C;  4LF5 C;  1NYE A;  3EER A;  4X65 C;  5BR8 C;  1JOS A;  3J81 D;  4LF8 C;  4DV7 C;  4DR1 C;  2E7G A;  4DCU A;  2ZM6 C;  1ML8 A;  4AQY C;  2E5L C;  2E8F A;  4NXN C;  4LF9 C;  1FJG C;  5LMN C;  1WH9 A;  1HNX C;  4LFC C;  4GKK C;  1USP A;  4YHH C;  5FLX D;  4DR4 C;  4DV4 C;  4DV6 C;  4NOZ A;  4B3T C;  3R9W A;  2QL8 A;  2ASB A;  2PN2 A;  4K0K C;  2F4V C;  4LF7 C;  1IBM C;  3T1H C;  1J5E C;  4GKJ C;  1MKY A;  4JI2 C;  2UUC C;  3J7A D;  1XNR C;  4DR5 C;  4LFA C;  1WF3 A;  2CXC A;  4DR6 C;  4JI6 C;  4DUZ C;  2YCB A;  5IWA C; 
#chains in the Genus database with same CATH topology
 4B3R C;  2VQE C;  5BSU A;  1O92 A;  1IBK C;  2OBV A;  2CY1 A;  1BA3 A;  4DV1 C;  5K8F A;  3I08 A;  5AE2 A;  5E7Q A;  2MCQ A;  4JI1 C;  4D4I A;  2V7B A;  5CZV A;  4RM2 A;  3CQ2 A;  4JI8 C;  1O93 A;  2HJG A;  3TQI A;  4JI7 C;  4FTF A;  3UEB A;  4I9F A;  1N36 C;  3I07 A;  4DV0 C;  2ATW A;  4X62 C;  1RG9 A;  3TR3 A;  3IPL A;  2DHM A;  3R9X A;  3EQ6 A;  4BBY A;  3JAM D;  4DV3 C;  4BSZ A;  1K0R A;  3J80 D;  4RMN A;  1I94 C;  3LNO A;  3TDE A;  4DV5 C;  2UU9 C;  4PUI A;  4IZ6 A;  1MDF A;  4GXR A;  3A25 A;  2D1S A;  2P2B A;  1AMU A;  1N34 C;  1V60 A;  4G36 A;  5BST A;  1UWD A;  1V26 A;  3B7W A;  2EGT A;  3OTO C;  4OXI A;  4IR7 A;  2E8E A;  1EGA A;  3PBK A;  4JM1 A;  4LF8 C;  4KTT A;  4OYC A;  4DCU A;  2JNV A;  2E5L C;  1RY2 A;  1WH9 A;  4LFC C;  3A4I A;  4BC9 A;  4DV4 C;  1MD9 A;  2M5O A;  3PES A;  3R9W A;  3SO4 A;  4D56 A;  2PN2 A;  4K0K C;  2F4V C;  3A26 A;  1XRA A;  1IBM C;  2KDN A;  3T1H C;  3N54 B;  2MMA B;  2PG1 E;  4GS5 A;  4LFA C;  5AE1 A;  2NCL A;  2YCB A;  1TH5 A;  1IBL C;  4LFB C;  2QVY X;  3IML A;  5H9U A;  5KYT A;  3FM7 A;  5T8S A;  3GKU A;  4DCT A;  3C5E A;  4R1L A;  4GXQ A;  4PUG A;  3UX3 A;  4KHP C;  3L95 X;  2PT7 G;  2D1T A;  2UXD C;  5BSV A;  1MXA A;  4DUY C;  4PZP A;  2CU6 A;  4BCA A;  3AF5 A;  4BC7 A;  2UUA C;  4B3M C;  2YWB A;  2DPL A;  1VLA A;  1QWI A;  4PRO C;  2UXC C;  3S82 A;  1XMO C;  3UZ0 A;  2D7V A;  4X66 C;  2E8C A;  1PA4 A;  3CW9 A;  1FLO A;  3IEU A;  3GR1 A;  2OO4 A;  4ZLP A;  3AF6 A;  2YX1 A;  1HNW C;  2ONF A;  2BJO A;  1MXB A;  3NYQ A;  1PG4 A;  2DYJ A;  3VNS A;  5A2Q D;  4ISB A;  2P20 A;  4X65 C;  1JOS A;  4G37 A;  2MM9 A;  1XRB A;  1XHJ A;  4AQY C;  4G1I A;  1P4E C;  4NXN C;  4LF9 C;  1M6X C;  1FJG C;  1USP A;  3L8C A;  5A1I A;  3PRO C;  1LCI A;  5IFI A;  1NY8 A;  5BSM A;  2D27 A;  2M5H A;  4GKJ C;  1PU1 A;  1QM4 A;  1MKY A;  3GPC A;  5BUS A;  2P2M A;  3J7A D;  2QVZ X;  3KXW A;  4WS9 A;  1WF3 A;  3DLP X;  4DUZ C;  5K85 A;  4KTV A;  5IWA C;  4RVN A;  2Y27 A;  1T5D X;  4L2Z A;  3E7W A;  1M6X A;  1LQL A;  2VSQ A;  3NPD A;  2OPL A;  4RVO A;  4DG8 A;  5A1G A;  4WV3 A;  4L7I A;  3VNR A;  1IB8 A;  3DHV A;  4NXM C;  3LAX A;  2D1R A;  3UOW A;  4FUQ A;  3CQ1 A;  2P2J A;  4I9G A;  4K0B A;  4MH4 A;  1P7L A;  2QVX X;  2WD9 A;  5BSR A;  5LCI A;  1USP B;  3IEV A;  3ETC A;  4JV5 C;  3RG2 A;  4B3S C;  1XMQ C;  4JI5 C;  2KZF A;  4HPV A;  5LMU C;  4XX2 A;  1HR0 C;  2UXB C;  4LF4 C;  3T1Y C;  2D1Q A;  2UUB C;  4LF6 C;  3N2Q A;  4OX9 C;  5KYV A;  1KKG A;  4L4Q A;  4JYA C;  2XR1 A;  4JI0 C;  1HH2 P;  1ZB9 A;  4DR3 C;  4EAT A;  4RLQ A;  3LGX A;  4DV2 C;  2OPL B;  5CZX A;  4YY3 C;  4LF5 C;  1NYE A;  1ULT A;  5BR8 C;  3NYR A;  3J81 D;  3NI2 A;  2E8F A;  3CW8 X;  3FCE A;  3VNQ A;  5ADZ A;  4DV6 C;  2D28 C;  1YJ7 A;  2QL8 A;  3AY0 A;  4R1M A;  1XRC A;  4LF7 C;  5JRH A;  5DV9 A;  1J5E C;  4FUT A;  2ZTB A;  1FUG A;  2UUC C;  3A9V A;  4DR5 C;  1V25 A;  3DAY A;  4DR6 C;  1MXC A;  3TUF A;  2PRO A;  4DG9 A;  1MDB A;  3ETO A;  4DCS A;  5BUQ A;  4ODJ A;  2VQF C;  4JI3 C;  2Y4N A;  4PHT A;  1O90 A;  1HNZ C;  2ZZM A;  2P02 A;  1VEH A;  1XDX A;  2QW0 X;  4MTN A;  2HHH C;  5IT9 D;  4RM3 A;  3K6R A;  3A9U A;  5T8T A;  1N2F A;  3LUS A;  5GTD A;  4ZJZ A;  4U5Y D;  4JI4 C;  2VZE A;  3CJE A;  4DCV A;  1P4E A;  4NDN A;  1XS3 A;  4DR7 C;  3O2E A;  1N32 C;  1PG3 A;  2YWC A;  1UKK A;  1XNQ C;  3LNV A;  2AYA A;  2JMP A;  4D4G A;  1ZB8 A;  4X64 C;  1N33 C;  2P2F A;  2BH1 X;  1L2F A;  3H2T A;  1T5H X;  4LE5 A;  4D57 A;  2P2Q A;  5AE3 A;  3EER A;  4DV7 C;  4DR1 C;  1O9T A;  2E7G A;  3E7X A;  3CQ3 A;  2ZM6 C;  1ML8 A;  3FCC A;  3GR0 A;  4PUH A;  5LMN C;  1HNX C;  2ZZN A;  4GKK C;  2E0G A;  2WP0 C;  4YHH C;  1YGT A;  5FLX D;  4DR4 C;  2KZ0 A;  4TPS B;  4NOZ A;  4B3T C;  4R0M A;  5KEI A;  2ASB A;  2Z51 A;  2Y4O A;  5BUR A;  5A19 A;  4JI2 C;  3G7S A;  5BSW A;  1GPM A;  1XNR C;  3R44 A;  2CXC A;  4RLF A;  3UX2 A;  4JI6 C;  3RV2 A;  1WCJ A;  4DR2 C; 
#chains in the Genus database with same CATH homology
 4B3R C;  2VQE C;  5BSU A;  1O92 A;  1IBK C;  2OBV A;  2CY1 A;  1BA3 A;  4DV1 C;  5K8F A;  3I08 A;  5AE2 A;  5E7Q A;  4JI1 C;  4D4I A;  2V7B A;  5CZV A;  4RM2 A;  4JI8 C;  1O93 A;  2HJG A;  3TQI A;  4JI7 C;  4FTF A;  4I9F A;  1N36 C;  3I07 A;  4DV0 C;  2ATW A;  4X62 C;  1RG9 A;  3IPL A;  3R9X A;  3EQ6 A;  4BBY A;  3JAM D;  4DV3 C;  4BSZ A;  1K0R A;  3J80 D;  4RMN A;  1I94 C;  3TDE A;  4DV5 C;  2UU9 C;  4IZ6 A;  1MDF A;  4GXR A;  2D1S A;  2P2B A;  1AMU A;  1N34 C;  4G36 A;  5BST A;  1V26 A;  3B7W A;  2EGT A;  3OTO C;  4OXI A;  4IR7 A;  2E8E A;  1EGA A;  3PBK A;  4JM1 A;  4LF8 C;  4KTT A;  4OYC A;  4DCU A;  2E5L C;  1RY2 A;  1WH9 A;  4LFC C;  3A4I A;  4BC9 A;  4DV4 C;  1MD9 A;  3PES A;  3R9W A;  3SO4 A;  4D56 A;  2PN2 A;  4K0K C;  2F4V C;  1XRA A;  1IBM C;  3T1H C;  3N54 B;  4GS5 A;  4LFA C;  5AE1 A;  2YCB A;  1IBL C;  4LFB C;  2QVY X;  3IML A;  5H9U A;  5KYT A;  5T8S A;  3GKU A;  4DCT A;  3C5E A;  4R1L A;  4GXQ A;  4KHP C;  3L95 X;  2PT7 G;  2D1T A;  2UXD C;  5BSV A;  1MXA A;  4DUY C;  4PZP A;  4BCA A;  3AF5 A;  4BC7 A;  2UUA C;  4B3M C;  2YWB A;  2DPL A;  1VLA A;  1QWI A;  4PRO C;  2UXC C;  3S82 A;  1XMO C;  3UZ0 A;  2D7V A;  4X66 C;  2E8C A;  1PA4 A;  3CW9 A;  3IEU A;  3GR1 A;  2OO4 A;  4ZLP A;  3AF6 A;  1HNW C;  2ONF A;  2BJO A;  1MXB A;  3NYQ A;  1PG4 A;  2DYJ A;  3VNS A;  5A2Q D;  4ISB A;  2P20 A;  4X65 C;  1JOS A;  4G37 A;  1XRB A;  4AQY C;  4G1I A;  4NXN C;  4LF9 C;  1FJG C;  1USP A;  3L8C A;  5A1I A;  3PRO C;  1LCI A;  5IFI A;  5BSM A;  2D27 A;  4GKJ C;  1QM4 A;  1MKY A;  3GPC A;  5BUS A;  2P2M A;  3J7A D;  2QVZ X;  3KXW A;  4WS9 A;  1WF3 A;  3DLP X;  4DUZ C;  5K85 A;  4KTV A;  5IWA C;  4RVN A;  2Y27 A;  1T5D X;  4L2Z A;  3E7W A;  1LQL A;  2VSQ A;  3NPD A;  2OPL A;  4RVO A;  4DG8 A;  5A1G A;  4WV3 A;  4L7I A;  3VNR A;  3DHV A;  4NXM C;  3LAX A;  2D1R A;  3UOW A;  4FUQ A;  2P2J A;  4I9G A;  4K0B A;  4MH4 A;  1P7L A;  2QVX X;  2WD9 A;  5BSR A;  3IEV A;  1USP B;  3ETC A;  4JV5 C;  3RG2 A;  4B3S C;  1XMQ C;  4JI5 C;  2KZF A;  4HPV A;  5LMU C;  4XX2 A;  1HR0 C;  2UXB C;  4LF4 C;  3T1Y C;  2D1Q A;  2UUB C;  4LF6 C;  3N2Q A;  4OX9 C;  5KYV A;  1KKG A;  4L4Q A;  4JYA C;  2XR1 A;  4JI0 C;  1HH2 P;  1ZB9 A;  4DR3 C;  4EAT A;  4RLQ A;  3LGX A;  4DV2 C;  2OPL B;  5CZX A;  4YY3 C;  4LF5 C;  1NYE A;  1ULT A;  5BR8 C;  3NYR A;  3J81 D;  3NI2 A;  2E8F A;  3CW8 X;  3FCE A;  3VNQ A;  5ADZ A;  4DV6 C;  2D28 C;  1YJ7 A;  2QL8 A;  4R1M A;  1XRC A;  4LF7 C;  5JRH A;  5DV9 A;  1J5E C;  4FUT A;  1FUG A;  2UUC C;  3A9V A;  4DR5 C;  1V25 A;  3DAY A;  4DR6 C;  1MXC A;  3TUF A;  2PRO A;  4DG9 A;  1MDB A;  3ETO A;  4DCS A;  5BUQ A;  4ODJ A;  2VQF C;  4JI3 C;  2Y4N A;  4PHT A;  1O90 A;  1HNZ C;  2P02 A;  2QW0 X;  4MTN A;  2HHH C;  5IT9 D;  4RM3 A;  3A9U A;  5T8T A;  1N2F A;  3LUS A;  5GTD A;  4ZJZ A;  4U5Y D;  4JI4 C;  2VZE A;  3CJE A;  4DCV A;  4NDN A;  4DR7 C;  1N32 C;  1PG3 A;  2YWC A;  1UKK A;  1XNQ C;  3LNV A;  2AYA A;  2JMP A;  4D4G A;  1ZB8 A;  4X64 C;  1N33 C;  2P2F A;  2BH1 X;  1L2F A;  3H2T A;  1T5H X;  4LE5 A;  4D57 A;  2P2Q A;  5AE3 A;  3EER A;  4DV7 C;  4DR1 C;  1O9T A;  2E7G A;  3E7X A;  2ZM6 C;  1ML8 A;  3FCC A;  3GR0 A;  5LMN C;  1HNX C;  4GKK C;  2E0G A;  2WP0 C;  4YHH C;  5FLX D;  4DR4 C;  4TPS B;  4NOZ A;  4B3T C;  4R0M A;  5KEI A;  2ASB A;  2Y4O A;  5BUR A;  5A19 A;  4JI2 C;  3G7S A;  5BSW A;  1GPM A;  1XNR C;  3R44 A;  2CXC A;  4RLF A;  4JI6 C;  3RV2 A;  4DR2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...