4AQYC

Structure of ribosome-apramycin complexes
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 39
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4aqyC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4aqyC02
1WH9A 2E8EA 3CJEA 4JV5C 4YY3C 3AF6A 2OPLB 1XMOC 4DR6C 2CY1A 3EERA 4LF5C 4X65C 4DV0C 1QWIA 2E8FA 4OX9C 4LFCC 1XNQC 3GKUA 2BJOA 1MKYA 4DUYC 4LFAC 3IEVA 1HNWC 1PA4A 4DCUA 2PN2A 4DV3C 2UUBC 1EGAA 2QL8A 1IBLC 2UXCC 2YCBA 4NOZA 4JYAC 2HHHC 1LQLA 1HR0C 3R9XA 4DCSA 4JI8C 1N33C 2D7VA 4LF7C 4GKJC 2UXDC 4LF4C 4NXNC 5LMUC 3J81D 3T1YC 3OTOC 3I07A 4JI7C 1XNRC 2UUCC 1HNZC 1N36C 1JOSA 4DCVA 1UKKA 1USPA 1ZB8A 3AF5A 1N34C 2UXBC 2EGTA 1XMQC 4B3RC 3R9WA 1IBMC 4DV7C 2ONFA 2DYJA 4DV2C 5LMNC 1I94C 4B3MC 1N32C 1ML8A 2F4VC 3J7AD 4BSZA 1FJGC 2PT7G 5IT9D 4JI3C 4X66C 4DV4C 4DR5C 1NYEA 2JMPA 2XR1A 2UUAC 3J80D 4JI5C 5IWAC 3LUSA 4DUZC 4JI4C 4X64C 1J5EC 4DR2C 1HH2P 4DR4C 1VLAA 2E7GA 4DCTA 2ZM6C 1WF3A 5FLXD 4LF8C 2VQFC 4LFBC 2UU9C 1USPB 4DR1C 5A2QD 2OPLA 4JI1C 1L2FA 2ATWA 2ASBA 2KZFA 4JI0C 1N2FA 3JAMD 4LF9C 4AQYC 4DV5C 4X62C 2HJGA 4DV6C 2E8CA 1KKGA 1ZB9A 4K0KC 2CXCA 4MTNA 4NXMC 4GKKC 4JI2C 2VQEC 4YHHC 4XX2A 4KHPC 1HNXC 2E5LC 4LF6C 3T1HC 1IBKC 4B3SC 4JI6C 4DR3C 1K0RA 4DR7C 5BR8C 4B3TC 4DV1C 3IEUA 4MH4A
chains in the Genus database with same CATH superfamily
3CJEA 2D27A 2YX1A 3FM7A 1PU1A 1XMOC 1YGTA 2E8FA 5BSMA 1MKYA 4DUYC 2QVZX 4LFAC 5BSWA 4DV3C 2Y27A 1IBLC 4D57A 3KXWA 2YCBA 4JYAC 2HHHC 2D1RA 2KZ0A 1HR0C 2QVXX 5BSUA 1N33C 4LF4C 4NXNC 3TR3A 5LMUC 3RG2A 3GPCA 3L95X 1MXAA 5AE2A 1WCJA 1HNZC 3A9UA 1JOSA 4PHTA 1UKKA 2Z51A 4PUGA 1N34C 2UXBC 3CW8X 4PUIA 1MXCA 1YJ7A 2P2QA 4BCAA 2DYJA 2ONFA 1ML8A 4GXRA 4LE5A 4JI3C 3NPDA 3UZ0A 4DV4C 1MDFA 1M6XA 4GS5A 4G1IA 4RM3A 3CQ2A 4L4QA 4X64C 1XHJA 4DR2C 1J5EC 4DR4C 2ZTBA 2ZM6C 4WV3A 5FLXD 4LFBC 1USPB 3DHVA 3ETCA 1L2FA 2P2BA 1N2FA 1T5DX 2ZZNA 4R0MA 4AQYC 3S82A 2P2FA 2HJGA 2E8CA 4ISBA 4K0KC 3A26A 4GKKC 2VQEC 4PROC 4KTTA 4KHPC 1FLOA 1HNXC 2OBVA 4FUTA 1IBKC 4B3SC 4KTVA 1K0RA 5T8SA 5BR8C 1O92A 4B3TC 4RVNA 3IEUA 4MH4A 4YY3C 3VNQA 4BBYA 4RLFA 3GR1A 1AMUA 5KYTA 4X65C 4LFCC 5AE1A 4FUQA 2D1SA 1PG4A 4IR7A 3IEVA 1PA4A 4DCUA 1XRAA 2UXCC 3B7WA 4NOZA 5BSVA 2ZZMA 4I9GA 4JM1A 1MXBA 3UX3A 4DCSA 1BA3A 1MD9A 2D7VA 4GKJC 2UXDC 3O2EA 3N54B 4G37A 3T1YC 3I07A 3LNOA 3UX2A 4DCVA 4GXQA 3DLPX 1XRCA 3PROC 3R9WA 5JRHA 5DV9A 2Y4OA 2F4VC 3J7AD 4BSZA 2PT7G 5BSRA 3R44A 1M6XC 2JMPA 3NYQA 3J80D 2NCLA 5A1IA 3LUSA 3LAXA 2DPLA 1XDXA 1HH2P 4PZPA 4LF8C 3A4IA 4NDNA 2OO4A 4L7IA 2YWCA 2OPLA 5CZXA 3PBKA 3G7SA 2QW0X 3DAYA 4LF9C 1PG3A 2M5OA 4DV5C 4X62C 1KKGA 4MTNA 5IFIA 5BURA 5GTDA 4FTFA 4TPSB 4LF6C 1FUGA 1LCIA 5A19A 4DR7C 3TDEA 1WH9A 2AYAA 2E8EA 2PROA 3E7WA 4JV5C 2VSQA 4BC7A 1P4EA 2OPLB 2CY1A 4LF5C 3SO4A 1QWIA 4OX9C 4D4GA 2BJOA 1HNWC 2PN2A 2UUBC 1EGAA 4DG9A 2QL8A 2E0GA 1V60A 3K6RA 2PG1E 3VNRA 1P4EC 4EATA 3NI2A 2BH1X 3OTOC 3I08A 3AY0A 5K85A 3H2TA 1MDBA 1USPA 1ZB8A 1XMQC 4R1LA 4DV7C 1IBMC 3IMLA 1O9TA 4DV2C 2WD9A 4B3MC 1N32C 3C5EA 4ZLPA 1FJGC 1V26A 5IT9D 2MMAB 3N2QA 2D1TA 4DR5C 1NYEA 3A9VA 2XR1A 3TQIA 2UUAC 3CQ1A 5T8TA 2WP0C 4JI5C 1VEHA 4HPVA 1VLAA 2E7GA 3GR0A 5H9UA 2VQFC 2UU9C 3LGXA 5AE3A 2P20A 5LCIA 3L8CA 4JI1C 1NY8A 2ASBA 2KZFA 4OXIA 1O93A 1T5HX 3UOWA 4DV6C 5BUQA 1ZB9A 4R1MA 2CXCA 2M5HA 4U5YD 4NXMC 1O90A 2D1QA 3A25A 4ZJZA 3NYRA 2E5LC 3T1HC 4OYCA 2P02A 2P2JA 4DV1C 4RMNA 4DG8A 1XS3A 3AF6A 1XRBA 4DR6C 3EERA 3IPLA 4DV0C 1RG9A 1XNQC 2QVYX 3GKUA 3RV2A 3PESA 1RY2A 4K0BA 4IZ6A 5BUSA 1LQLA 1UWDA 2P2MA 3R9XA 4WS9A 2JNVA 5E7QA 4JI8C 2Y4NA 4LF7C 5A1GA 2V7BA 3J81D 1GPMA 4JI7C 1XNRC 2UUCC 1N36C 1TH5A 4BC9A 3EQ6A 3UEBA 3AF5A 2EGTA 4L2ZA 5BSTA 4B3RC 2VZEA 2CU6A 5CZVA 2MM9A 4PUHA 5LMNC 1I94C 4RM2A 5KYVA 4X66C 4I9FA 5K8FA 2DHMA 5IWAC 2KDNA 4DUZC 4JI4C 3VNSA 4ODJA 3ETOA 4RLQA 3FCCA 4DCTA 1WF3A 3LNVA 4D4IA 2MCQA 3TUFA 4DR1C 5A2QD 1V25A 2ATWA 2YWBA 3E7XA 4G36A 4JI0C 3JAMD 1IB8A 4RVOA 5KEIA 3FCEA 3CW9A 4JI2C 4YHHC 4XX2A 3CQ3A 5ADZA 1P7LA 1QM4A 2D28C 4JI6C 4D56A 4DR3C 1ULTA
chains in the Genus database with same CATH topology
3CJEA 2D27A 1XMOC 2E8FA 5BSMA 1MKYA 4DUYC 2QVZX 4LFAC 5BSWA 4DV3C 2Y27A 1IBLC 4D57A 3KXWA 2YCBA 4JYAC 2HHHC 2D1RA 1HR0C 2QVXX 5BSUA 1N33C 4LF4C 4NXNC 5LMUC 3RG2A 3GPCA 3L95X 1MXAA 5AE2A 1HNZC 3A9UA 1JOSA 4PHTA 1UKKA 1N34C 2UXBC 3CW8X 1MXCA 1YJ7A 2P2QA 4BCAA 2DYJA 2ONFA 1ML8A 4GXRA 4LE5A 4JI3C 3NPDA 3UZ0A 4DV4C 1MDFA 4GS5A 4G1IA 4RM3A 4L4QA 4X64C 1J5EC 4DR2C 4DR4C 2ZM6C 4WV3A 5FLXD 4LFBC 1USPB 3DHVA 3ETCA 1L2FA 2P2BA 1N2FA 1T5DX 4R0MA 4AQYC 3S82A 2P2FA 2HJGA 2E8CA 4ISBA 4K0KC 4GKKC 2VQEC 4PROC 4KTTA 4KHPC 1HNXC 2OBVA 4FUTA 1IBKC 4B3SC 4KTVA 1K0RA 5T8SA 5BR8C 1O92A 4B3TC 4RVNA 3IEUA 4MH4A 4YY3C 3VNQA 4BBYA 4RLFA 3GR1A 1AMUA 5KYTA 4X65C 4LFCC 5AE1A 4FUQA 2D1SA 1PG4A 4IR7A 3IEVA 1PA4A 4DCUA 1XRAA 2UXCC 3B7WA 4NOZA 5BSVA 4I9GA 4JM1A 1MXBA 4DCSA 1BA3A 1MD9A 2D7VA 4GKJC 2UXDC 3N54B 4G37A 3T1YC 3I07A 4DCVA 4GXQA 3DLPX 1XRCA 3PROC 3R9WA 5JRHA 5DV9A 2Y4OA 2F4VC 3J7AD 4BSZA 2PT7G 5BSRA 3R44A 2JMPA 3NYQA 3J80D 5A1IA 3LUSA 3LAXA 2DPLA 1HH2P 4PZPA 4LF8C 3A4IA 4NDNA 2OO4A 4L7IA 2YWCA 2OPLA 5CZXA 3PBKA 3G7SA 2QW0X 3DAYA 4LF9C 1PG3A 4DV5C 4X62C 1KKGA 4MTNA 5IFIA 5BURA 5GTDA 4FTFA 4TPSB 4LF6C 1FUGA 1LCIA 5A19A 4DR7C 3TDEA 1WH9A 2AYAA 2E8EA 2PROA 3E7WA 4JV5C 2VSQA 4BC7A 2OPLB 2CY1A 4LF5C 3SO4A 1QWIA 4OX9C 4D4GA 2BJOA 1HNWC 2PN2A 2UUBC 1EGAA 4DG9A 2QL8A 2E0GA 3VNRA 4EATA 3NI2A 2BH1X 3OTOC 3I08A 5K85A 3H2TA 1MDBA 1USPA 1ZB8A 1XMQC 4R1LA 4DV7C 1IBMC 3IMLA 1O9TA 4DV2C 2WD9A 4B3MC 1N32C 3C5EA 4ZLPA 1FJGC 1V26A 5IT9D 3N2QA 2D1TA 4DR5C 1NYEA 3A9VA 2XR1A 3TQIA 2UUAC 5T8TA 2WP0C 4JI5C 4HPVA 1VLAA 2E7GA 3GR0A 5H9UA 2VQFC 2UU9C 3LGXA 5AE3A 2P20A 3L8CA 4JI1C 2ASBA 2KZFA 4OXIA 1O93A 1T5HX 3UOWA 4DV6C 5BUQA 1ZB9A 4R1MA 2CXCA 4U5YD 4NXMC 1O90A 2D1QA 4ZJZA 3NYRA 2E5LC 3T1HC 4OYCA 2P02A 2P2JA 4DV1C 4RMNA 4DG8A 3AF6A 1XRBA 4DR6C 3EERA 3IPLA 4DV0C 1RG9A 1XNQC 2QVYX 3GKUA 3RV2A 3PESA 1RY2A 4K0BA 4IZ6A 5BUSA 1LQLA 2P2MA 3R9XA 4WS9A 5E7QA 4JI8C 2Y4NA 4LF7C 5A1GA 2V7BA 3J81D 1GPMA 4JI7C 1XNRC 2UUCC 1N36C 4BC9A 3EQ6A 3AF5A 2EGTA 4L2ZA 5BSTA 4B3RC 2VZEA 5CZVA 5LMNC 1I94C 4RM2A 5KYVA 4X66C 4I9FA 5K8FA 5IWAC 4DUZC 4JI4C 3VNSA 4ODJA 3ETOA 4RLQA 3FCCA 4DCTA 1WF3A 3LNVA 4D4IA 3TUFA 4DR1C 5A2QD 1V25A 2ATWA 2YWBA 3E7XA 4G36A 4JI0C 3JAMD 4RVOA 5KEIA 3FCEA 3CW9A 4JI2C 4YHHC 4XX2A 5ADZA 1P7LA 1QM4A 2D28C 4JI6C 4D56A 4DR3C 1ULTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WH9 A;  2E8E A;  3CJE A;  4JV5 C;  4YY3 C;  3AF6 A;  2OPL B;  1XMO C;  4DR6 C;  2CY1 A;  3EER A;  4LF5 C;  4X65 C;  4DV0 C;  1QWI A;  2E8F A;  4OX9 C;  4LFC C;  1XNQ C;  3GKU A;  2BJO A;  1MKY A;  4DUY C;  4LFA C;  3IEV A;  1HNW C;  1PA4 A;  4DCU A;  2PN2 A;  4DV3 C;  2UUB C;  1EGA A;  2QL8 A;  1IBL C;  2UXC C;  2YCB A;  4NOZ A;  4JYA C;  2HHH C;  1LQL A;  1HR0 C;  3R9X A;  4DCS A;  4JI8 C;  1N33 C;  2D7V A;  4LF7 C;  4GKJ C;  2UXD C;  4LF4 C;  4NXN C;  5LMU C;  3J81 D;  3T1Y C;  3OTO C;  3I07 A;  4JI7 C;  1XNR C;  2UUC C;  1HNZ C;  1N36 C;  1JOS A;  4DCV A;  1UKK A;  1USP A;  1ZB8 A;  3AF5 A;  1N34 C;  2UXB C;  2EGT A;  1XMQ C;  4B3R C;  3R9W A;  1IBM C;  4DV7 C;  2ONF A;  2DYJ A;  4DV2 C;  5LMN C;  1I94 C;  4B3M C;  1N32 C;  1ML8 A;  2F4V C;  3J7A D;  4BSZ A;  1FJG C;  2PT7 G;  5IT9 D;  4JI3 C;  4X66 C;  4DV4 C;  4DR5 C;  1NYE A;  2JMP A;  2XR1 A;  2UUA C;  3J80 D;  4JI5 C;  5IWA C;  3LUS A;  4DUZ C;  4JI4 C;  4X64 C;  1J5E C;  4DR2 C;  1HH2 P;  4DR4 C;  1VLA A;  2E7G A;  4DCT A;  2ZM6 C;  1WF3 A;  5FLX D;  4LF8 C;  2VQF C;  4LFB C;  2UU9 C;  1USP B;  4DR1 C;  5A2Q D;  2OPL A;  4JI1 C;  1L2F A;  2ATW A;  2ASB A;  2KZF A;  4JI0 C;  1N2F A;  3JAM D;  4LF9 C;  4AQY C;  4DV5 C;  4X62 C;  2HJG A;  4DV6 C;  2E8C A;  1KKG A;  1ZB9 A;  4K0K C;  2CXC A;  4MTN A;  4NXM C;  4GKK C;  4JI2 C;  2VQE C;  4YHH C;  4XX2 A;  4KHP C;  1HNX C;  2E5L C;  4LF6 C;  3T1H C;  1IBK C;  4B3S C;  4JI6 C;  4DR3 C;  1K0R A;  4DR7 C;  5BR8 C;  4B3T C;  4DV1 C;  3IEU A;  4MH4 A; 
#chains in the Genus database with same CATH topology
 3CJE A;  2D27 A;  2YX1 A;  3FM7 A;  1PU1 A;  1XMO C;  1YGT A;  2E8F A;  5BSM A;  1MKY A;  4DUY C;  2QVZ X;  4LFA C;  5BSW A;  4DV3 C;  2Y27 A;  1IBL C;  4D57 A;  3KXW A;  2YCB A;  4JYA C;  2HHH C;  2D1R A;  2KZ0 A;  1HR0 C;  2QVX X;  5BSU A;  1N33 C;  4LF4 C;  4NXN C;  3TR3 A;  5LMU C;  3RG2 A;  3GPC A;  3L95 X;  1MXA A;  5AE2 A;  1WCJ A;  1HNZ C;  3A9U A;  1JOS A;  4PHT A;  1UKK A;  2Z51 A;  4PUG A;  1N34 C;  2UXB C;  3CW8 X;  4PUI A;  1MXC A;  1YJ7 A;  2P2Q A;  4BCA A;  2DYJ A;  2ONF A;  1ML8 A;  4GXR A;  4LE5 A;  4JI3 C;  3NPD A;  3UZ0 A;  4DV4 C;  1MDF A;  1M6X A;  4GS5 A;  4G1I A;  4RM3 A;  3CQ2 A;  4L4Q A;  4X64 C;  1XHJ A;  4DR2 C;  1J5E C;  4DR4 C;  2ZTB A;  2ZM6 C;  4WV3 A;  5FLX D;  4LFB C;  1USP B;  3DHV A;  3ETC A;  1L2F A;  2P2B A;  1N2F A;  1T5D X;  2ZZN A;  4R0M A;  4AQY C;  3S82 A;  2P2F A;  2HJG A;  2E8C A;  4ISB A;  4K0K C;  3A26 A;  4GKK C;  2VQE C;  4PRO C;  4KTT A;  4KHP C;  1FLO A;  1HNX C;  2OBV A;  4FUT A;  1IBK C;  4B3S C;  4KTV A;  1K0R A;  5T8S A;  5BR8 C;  1O92 A;  4B3T C;  4RVN A;  3IEU A;  4MH4 A;  4YY3 C;  3VNQ A;  4BBY A;  4RLF A;  3GR1 A;  1AMU A;  5KYT A;  4X65 C;  4LFC C;  5AE1 A;  4FUQ A;  2D1S A;  1PG4 A;  4IR7 A;  3IEV A;  1PA4 A;  4DCU A;  1XRA A;  2UXC C;  3B7W A;  4NOZ A;  5BSV A;  2ZZM A;  4I9G A;  4JM1 A;  1MXB A;  3UX3 A;  4DCS A;  1BA3 A;  1MD9 A;  2D7V A;  4GKJ C;  2UXD C;  3O2E A;  3N54 B;  4G37 A;  3T1Y C;  3I07 A;  3LNO A;  3UX2 A;  4DCV A;  4GXQ A;  3DLP X;  1XRC A;  3PRO C;  3R9W A;  5JRH A;  5DV9 A;  2Y4O A;  2F4V C;  3J7A D;  4BSZ A;  2PT7 G;  5BSR A;  3R44 A;  1M6X C;  2JMP A;  3NYQ A;  3J80 D;  2NCL A;  5A1I A;  3LUS A;  3LAX A;  2DPL A;  1XDX A;  1HH2 P;  4PZP A;  4LF8 C;  3A4I A;  4NDN A;  2OO4 A;  4L7I A;  2YWC A;  2OPL A;  5CZX A;  3PBK A;  3G7S A;  2QW0 X;  3DAY A;  4LF9 C;  1PG3 A;  2M5O A;  4DV5 C;  4X62 C;  1KKG A;  4MTN A;  5IFI A;  5BUR A;  5GTD A;  4FTF A;  4TPS B;  4LF6 C;  1FUG A;  1LCI A;  5A19 A;  4DR7 C;  3TDE A;  1WH9 A;  2AYA A;  2E8E A;  2PRO A;  3E7W A;  4JV5 C;  2VSQ A;  4BC7 A;  1P4E A;  2OPL B;  2CY1 A;  4LF5 C;  3SO4 A;  1QWI A;  4OX9 C;  4D4G A;  2BJO A;  1HNW C;  2PN2 A;  2UUB C;  1EGA A;  4DG9 A;  2QL8 A;  2E0G A;  1V60 A;  3K6R A;  2PG1 E;  3VNR A;  1P4E C;  4EAT A;  3NI2 A;  2BH1 X;  3OTO C;  3I08 A;  3AY0 A;  5K85 A;  3H2T A;  1MDB A;  1USP A;  1ZB8 A;  1XMQ C;  4R1L A;  4DV7 C;  1IBM C;  3IML A;  1O9T A;  4DV2 C;  2WD9 A;  4B3M C;  1N32 C;  3C5E A;  4ZLP A;  1FJG C;  1V26 A;  5IT9 D;  2MMA B;  3N2Q A;  2D1T A;  4DR5 C;  1NYE A;  3A9V A;  2XR1 A;  3TQI A;  2UUA C;  3CQ1 A;  5T8T A;  2WP0 C;  4JI5 C;  1VEH A;  4HPV A;  1VLA A;  2E7G A;  3GR0 A;  5H9U A;  2VQF C;  2UU9 C;  3LGX A;  5AE3 A;  2P20 A;  5LCI A;  3L8C A;  4JI1 C;  1NY8 A;  2ASB A;  2KZF A;  4OXI A;  1O93 A;  1T5H X;  3UOW A;  4DV6 C;  5BUQ A;  1ZB9 A;  4R1M A;  2CXC A;  2M5H A;  4U5Y D;  4NXM C;  1O90 A;  2D1Q A;  3A25 A;  4ZJZ A;  3NYR A;  2E5L C;  3T1H C;  4OYC A;  2P02 A;  2P2J A;  4DV1 C;  4RMN A;  4DG8 A;  1XS3 A;  3AF6 A;  1XRB A;  4DR6 C;  3EER A;  3IPL A;  4DV0 C;  1RG9 A;  1XNQ C;  2QVY X;  3GKU A;  3RV2 A;  3PES A;  1RY2 A;  4K0B A;  4IZ6 A;  5BUS A;  1LQL A;  1UWD A;  2P2M A;  3R9X A;  4WS9 A;  2JNV A;  5E7Q A;  4JI8 C;  2Y4N A;  4LF7 C;  5A1G A;  2V7B A;  3J81 D;  1GPM A;  4JI7 C;  1XNR C;  2UUC C;  1N36 C;  1TH5 A;  4BC9 A;  3EQ6 A;  3UEB A;  3AF5 A;  2EGT A;  4L2Z A;  5BST A;  4B3R C;  2VZE A;  2CU6 A;  5CZV A;  2MM9 A;  4PUH A;  5LMN C;  1I94 C;  4RM2 A;  5KYV A;  4X66 C;  4I9F A;  5K8F A;  2DHM A;  5IWA C;  2KDN A;  4DUZ C;  4JI4 C;  3VNS A;  4ODJ A;  3ETO A;  4RLQ A;  3FCC A;  4DCT A;  1WF3 A;  3LNV A;  4D4I A;  2MCQ A;  3TUF A;  4DR1 C;  5A2Q D;  1V25 A;  2ATW A;  2YWB A;  3E7X A;  4G36 A;  4JI0 C;  3JAM D;  1IB8 A;  4RVO A;  5KEI A;  3FCE A;  3CW9 A;  4JI2 C;  4YHH C;  4XX2 A;  3CQ3 A;  5ADZ A;  1P7L A;  1QM4 A;  2D28 C;  4JI6 C;  4D56 A;  4DR3 C;  1ULT A; 
#chains in the Genus database with same CATH homology
 3CJE A;  2D27 A;  1XMO C;  2E8F A;  5BSM A;  1MKY A;  4DUY C;  2QVZ X;  4LFA C;  5BSW A;  4DV3 C;  2Y27 A;  1IBL C;  4D57 A;  3KXW A;  2YCB A;  4JYA C;  2HHH C;  2D1R A;  1HR0 C;  2QVX X;  5BSU A;  1N33 C;  4LF4 C;  4NXN C;  5LMU C;  3RG2 A;  3GPC A;  3L95 X;  1MXA A;  5AE2 A;  1HNZ C;  3A9U A;  1JOS A;  4PHT A;  1UKK A;  1N34 C;  2UXB C;  3CW8 X;  1MXC A;  1YJ7 A;  2P2Q A;  4BCA A;  2DYJ A;  2ONF A;  1ML8 A;  4GXR A;  4LE5 A;  4JI3 C;  3NPD A;  3UZ0 A;  4DV4 C;  1MDF A;  4GS5 A;  4G1I A;  4RM3 A;  4L4Q A;  4X64 C;  1J5E C;  4DR2 C;  4DR4 C;  2ZM6 C;  4WV3 A;  5FLX D;  4LFB C;  1USP B;  3DHV A;  3ETC A;  1L2F A;  2P2B A;  1N2F A;  1T5D X;  4R0M A;  4AQY C;  3S82 A;  2P2F A;  2HJG A;  2E8C A;  4ISB A;  4K0K C;  4GKK C;  2VQE C;  4PRO C;  4KTT A;  4KHP C;  1HNX C;  2OBV A;  4FUT A;  1IBK C;  4B3S C;  4KTV A;  1K0R A;  5T8S A;  5BR8 C;  1O92 A;  4B3T C;  4RVN A;  3IEU A;  4MH4 A;  4YY3 C;  3VNQ A;  4BBY A;  4RLF A;  3GR1 A;  1AMU A;  5KYT A;  4X65 C;  4LFC C;  5AE1 A;  4FUQ A;  2D1S A;  1PG4 A;  4IR7 A;  3IEV A;  1PA4 A;  4DCU A;  1XRA A;  2UXC C;  3B7W A;  4NOZ A;  5BSV A;  4I9G A;  4JM1 A;  1MXB A;  4DCS A;  1BA3 A;  1MD9 A;  2D7V A;  4GKJ C;  2UXD C;  3N54 B;  4G37 A;  3T1Y C;  3I07 A;  4DCV A;  4GXQ A;  3DLP X;  1XRC A;  3PRO C;  3R9W A;  5JRH A;  5DV9 A;  2Y4O A;  2F4V C;  3J7A D;  4BSZ A;  2PT7 G;  5BSR A;  3R44 A;  2JMP A;  3NYQ A;  3J80 D;  5A1I A;  3LUS A;  3LAX A;  2DPL A;  1HH2 P;  4PZP A;  4LF8 C;  3A4I A;  4NDN A;  2OO4 A;  4L7I A;  2YWC A;  2OPL A;  5CZX A;  3PBK A;  3G7S A;  2QW0 X;  3DAY A;  4LF9 C;  1PG3 A;  4DV5 C;  4X62 C;  1KKG A;  4MTN A;  5IFI A;  5BUR A;  5GTD A;  4FTF A;  4TPS B;  4LF6 C;  1FUG A;  1LCI A;  5A19 A;  4DR7 C;  3TDE A;  1WH9 A;  2AYA A;  2E8E A;  2PRO A;  3E7W A;  4JV5 C;  2VSQ A;  4BC7 A;  2OPL B;  2CY1 A;  4LF5 C;  3SO4 A;  1QWI A;  4OX9 C;  4D4G A;  2BJO A;  1HNW C;  2PN2 A;  2UUB C;  1EGA A;  4DG9 A;  2QL8 A;  2E0G A;  3VNR A;  4EAT A;  3NI2 A;  2BH1 X;  3OTO C;  3I08 A;  5K85 A;  3H2T A;  1MDB A;  1USP A;  1ZB8 A;  1XMQ C;  4R1L A;  4DV7 C;  1IBM C;  3IML A;  1O9T A;  4DV2 C;  2WD9 A;  4B3M C;  1N32 C;  3C5E A;  4ZLP A;  1FJG C;  1V26 A;  5IT9 D;  3N2Q A;  2D1T A;  4DR5 C;  1NYE A;  3A9V A;  2XR1 A;  3TQI A;  2UUA C;  5T8T A;  2WP0 C;  4JI5 C;  4HPV A;  1VLA A;  2E7G A;  3GR0 A;  5H9U A;  2VQF C;  2UU9 C;  3LGX A;  5AE3 A;  2P20 A;  3L8C A;  4JI1 C;  2ASB A;  2KZF A;  4OXI A;  1O93 A;  1T5H X;  3UOW A;  4DV6 C;  5BUQ A;  1ZB9 A;  4R1M A;  2CXC A;  4U5Y D;  4NXM C;  1O90 A;  2D1Q A;  4ZJZ A;  3NYR A;  2E5L C;  3T1H C;  4OYC A;  2P02 A;  2P2J A;  4DV1 C;  4RMN A;  4DG8 A;  3AF6 A;  1XRB A;  4DR6 C;  3EER A;  3IPL A;  4DV0 C;  1RG9 A;  1XNQ C;  2QVY X;  3GKU A;  3RV2 A;  3PES A;  1RY2 A;  4K0B A;  4IZ6 A;  5BUS A;  1LQL A;  2P2M A;  3R9X A;  4WS9 A;  5E7Q A;  4JI8 C;  2Y4N A;  4LF7 C;  5A1G A;  2V7B A;  3J81 D;  1GPM A;  4JI7 C;  1XNR C;  2UUC C;  1N36 C;  4BC9 A;  3EQ6 A;  3AF5 A;  2EGT A;  4L2Z A;  5BST A;  4B3R C;  2VZE A;  5CZV A;  5LMN C;  1I94 C;  4RM2 A;  5KYV A;  4X66 C;  4I9F A;  5K8F A;  5IWA C;  4DUZ C;  4JI4 C;  3VNS A;  4ODJ A;  3ETO A;  4RLQ A;  3FCC A;  4DCT A;  1WF3 A;  3LNV A;  4D4I A;  3TUF A;  4DR1 C;  5A2Q D;  1V25 A;  2ATW A;  2YWB A;  3E7X A;  4G36 A;  4JI0 C;  3JAM D;  4RVO A;  5KEI A;  3FCE A;  3CW9 A;  4JI2 C;  4YHH C;  4XX2 A;  5ADZ A;  1P7L A;  1QM4 A;  2D28 C;  4JI6 C;  4D56 A;  4DR3 C;  1ULT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...