4AQYC

Structure of ribosome-apramycin complexes
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 39
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4aqyC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4aqyC02
4LF4C 3AF6A 4X64C 1WF3A 1N34C 2OPLB 4LF5C 2UUBC 5BR8C 4DR4C 4DR2C 1UKKA 3OTOC 2UUCC 4X62C 4NOZA 3EERA 3GKUA 3LUSA 4JI8C 4NXNC 2E7GA 3T1HC 1XNQC 4JI3C 1ZB9A 3I07A 1PA4A 4LFCC 1HH2P 4JI2C 1KKGA 2CXCA 4DR3C 5LMUC 4JV5C 4BSZA 2KZFA 5IWAC 3IEUA 1LQLA 2E8FA 3J81D 4YY3C 4B3SC 4LF8C 2UUAC 2DYJA 2BJOA 4YHHC 2ZM6C 4DR1C 4DCTA 1XMQC 2ATWA 4B3MC 4DCVA 4DV5C 4LFAC 4NXMC 4DCSA 1WH9A 2HHHC 2UXCC 1USPB 1HR0C 2UXBC 2XR1A 3J80D 4LF7C 1XMOC 1HNXC 1VLAA 1USPA 4DV6C 1XNRC 4DV3C 1N2FA 1NYEA 4JI7C 4AQYC 2OPLA 3R9XA 1HNWC 1N32C 1JOSA 4DCUA 2YCBA 4DV7C 4LFBC 4LF6C 4XX2A 1FJGC 1ML8A 4JI0C 1IBMC 2UXDC 3JAMD 4DV0C 1J5EC 4GKKC 2QL8A 4DV1C 3T1YC 1N33C 4DR6C 4K0KC 1L2FA 1N36C 2VQEC 1I94C 4LF9C 4B3RC 2CY1A 1MKYA 4DV2C 1EGAA 3IEVA 2VQFC 2E8EA 2E8CA 5A2QD 1HNZC 4B3TC 3AF5A 3J7AD 2JMPA 1IBLC 2ASBA 4DR5C 5FLXD 4DV4C 4X65C 4OX9C 4JI4C 2UU9C 4X66C 4DR7C 2EGTA 1ZB8A 2HJGA 4MH4A 4DUZC 2F4VC 3CJEA 4MTNA 1QWIA 4DUYC 4JYAC 2ONFA 5LMNC 2D7VA 1IBKC 4JI5C 2PN2A 2E5LC 4JI6C 4JI1C 1K0RA 3R9WA 2PT7G 4GKJC 4KHPC 5IT9D
chains in the Genus database with same CATH superfamily
3UX2A 2D28C 4X64C 5BSUA 2WD9A 3SO4A 3G7SA 2UUCC 3TQIA 3A9VA 2WP0C 3EERA 3GKUA 4BC9A 4JI8C 3T1HC 4G37A 1FLOA 4ISBA 1V25A 3S82A 1P4EA 4LFCC 4D4IA 3AY0A 2CXCA 5CZVA 5LMUC 2JNVA 1IB8A 3GR0A 5IWAC 3ETCA 1LQLA 2VSQA 2OO4A 5A1GA 3LGXA 2YX1A 1MXAA 5BURA 2ATWA 5DV9A 1WCJA 3A26A 1TH5A 1WH9A 1O92A 3VNSA 1XRBA 3L8CA 1XDXA 1XMOC 1VLAA 5A19A 4JI7C 1NYEA 3R9XA 4AQYC 2OPLA 1HNWC 3DHVA 3A4IA 1N32C 4DV7C 2P02A 1FJGC 5BUSA 3FM7A 4GXRA 2CU6A 1AMUA 3PROC 2M5OA 4DV0C 4GKKC 1O90A 2AYAA 4DV1C 4WV3A 2P2BA 5KEIA 4DR6C 2PROA 1P4EC 4G36A 2CY1A 4BC7A 2E8CA 2D1QA 1YGTA 1HNZC 4BBYA 5T8TA 2P20A 3DAYA 4DR5C 1PG3A 1V60A 5KYTA 4X66C 2Y4OA 3UOWA 2KDNA 4MH4A 4GXQA 4DUZC 5H9UA 4MTNA 4DUYC 4JYAC 4ZLPA 2ONFA 4JI5C 3CW9A 1LCIA 2PN2A 2E5LC 1K0RA 5K8FA 3IMLA 3I08A 3N54B 1XS3A 2PT7G 3GPCA 4GKJC 4LF4C 4IZ6A 3NYQA 2OPLB 4LF5C 2UUBC 2D1RA 4X62C 1BA3A 4PROC 2QVYX 2VZEA 3E7WA 2D1SA 3DLPX 1KKGA 4G1IA 4JV5C 4BSZA 2YWBA 4ZJZA 3CQ2A 4YY3C 2P2JA 4L2ZA 2UUAC 4WS9A 4YHHC 2ZM6C 1MDFA 4DCVA 2P2QA 4NXMC 2UXCC 3RG2A 4R1LA 3J80D 4LF7C 4D56A 5BSMA 1N2FA 3UZ0A 5IFIA 3N2QA 1QM4A 5GTDA 2YCBA 4LFBC 5BSTA 2QW0X 1O93A 4JI0C 1IBMC 2UXDC 3JAMD 1MD9A 1UWDA 3CQ1A 2YWCA 3FCEA 1N33C 4D57A 2ZZMA 1NY8A 1N36C 1EGAA 1M6XA 5BSWA 2VQFC 1XRCA 3AF5A 1P7LA 2JMPA 1IBLC 4DV4C 4TPSB 2PG1E 4PUGA 3IPLA 4PHTA 3NI2A 5E7QA 3C5EA 5AE1A 3CJEA 3CQ3A 1GPMA 2D7VA 4PUIA 5LCIA 4JI6C 2P2MA 4JI1C 2DPLA 4KHPC 3EQ6A 4RMNA 4FTFA 2D1TA 1N34C 4RLQA 1T5HX 5BR8C 4NDNA 4DR4C 1UKKA 5T8SA 4I9FA 2BH1X 4L7IA 4U5YD 3LUSA 4KTTA 3CW8X 4JI3C 4PZPA 5KYVA 1PA4A 1O9TA 4JI2C 4DR3C 2KZFA 1XRAA 3UX3A 4DG9A 3PESA 4FUTA 5BUQA 1ULTA 2ZZNA 2MMAB 4LFAC 2HHHC 3O2EA 1HNXC 3LAXA 2KZ0A 1USPA 2V7BA 4DV6C 4DV3C 2QVXX 1MXBA 3PBKA 1JOSA 4DCUA 3NPDA 4LF6C 1YJ7A 4XX2A 3UEBA 4JM1A 4OXIA 1ML8A 3VNRA 2OBVA 1RY2A 2M5HA 4K0BA 1J5EC 5ADZA 3T1YC 3KXWA 2Z51A 1L2FA 3E7XA 5JRHA 5A1IA 1MKYA 3IEVA 4L4QA 4B3TC 3J7AD 2ASBA 4OX9C 4JI4C 5AE3A 2UU9C 3VNQA 3A25A 3NYRA 1T5DX 2F4VC 1QWIA 4LE5A 5LMNC 1IBKC 1XHJA 5CZXA 2QVZX 4EATA 3AF6A 3TR3A 2ZTBA 1WF3A 3B7WA 2D27A 4R1MA 4DR2C 3OTOC 4NOZA 4RVOA 4NXNC 2E7GA 5BSRA 1XNQC 1ZB9A 4BCAA 2Y4NA 3I07A 4I9GA 1HH2P 4FUQA 2NCLA 5K85A 3IEUA 4KTVA 2E8FA 3J81D 4B3SC 4LF8C 1M6XC 2P2FA 2MM9A 4PUHA 2DYJA 4RM3A 2BJOA 4DR1C 1XMQC 4DCTA 4B3MC 1VEHA 2Y27A 4DV5C 4DCSA 4RVNA 2E0GA 1USPB 1MXCA 1HR0C 3GR1A 2XR1A 3L95X 1PU1A 2UXBC 3R44A 1XNRC 4RLFA 3LNOA 3TUFA 3TDEA 5AE2A 3LNVA 4GS5A 4D4GA 1PG4A 5BSVA 2QL8A 3ETOA 4K0KC 4IR7A 2VQEC 1I94C 4LF9C 4B3RC 4DV2C 2DHMA 2E8EA 5A2QD 1V26A 4RM2A 1RG9A 4DG8A 5FLXD 4X65C 1MDBA 3RV2A 3A9UA 2MCQA 4DR7C 2EGTA 1ZB8A 2HJGA 4HPVA 3K6RA 4R0MA 1FUGA 4ODJA 3R9WA 3FCCA 3H2TA 4OYCA 5IT9D
chains in the Genus database with same CATH topology
2D28C 4X64C 5BSUA 2WD9A 3SO4A 3G7SA 2UUCC 3TQIA 3A9VA 2WP0C 3EERA 3GKUA 4BC9A 4JI8C 3T1HC 4G37A 4ISBA 1V25A 3S82A 4LFCC 4D4IA 2CXCA 5CZVA 5LMUC 3GR0A 5IWAC 3ETCA 1LQLA 2VSQA 2OO4A 5A1GA 3LGXA 5BURA 1MXAA 2ATWA 5DV9A 1WH9A 1O92A 3VNSA 1XRBA 3L8CA 1XMOC 1VLAA 5A19A 4JI7C 1NYEA 3R9XA 4AQYC 2OPLA 1HNWC 3DHVA 3A4IA 1N32C 4DV7C 2P02A 1FJGC 5BUSA 4GXRA 1AMUA 3PROC 4DV0C 4GKKC 1O90A 2AYAA 4WV3A 4DV1C 2P2BA 5KEIA 4DR6C 2PROA 4G36A 2CY1A 4BC7A 2E8CA 2D1QA 1HNZC 4BBYA 5T8TA 2P20A 3DAYA 4DR5C 1PG3A 5KYTA 4X66C 2Y4OA 3UOWA 4MH4A 4GXQA 4DUZC 5H9UA 4MTNA 4DUYC 4JYAC 4ZLPA 2ONFA 4JI5C 3CW9A 1LCIA 2PN2A 2E5LC 1K0RA 5K8FA 3IMLA 3I08A 3N54B 2PT7G 3GPCA 4GKJC 4LF4C 4IZ6A 3NYQA 2OPLB 4LF5C 2UUBC 2D1RA 4X62C 1BA3A 4PROC 2QVYX 2VZEA 3E7WA 2D1SA 3DLPX 1KKGA 4G1IA 4JV5C 4BSZA 2YWBA 4ZJZA 4YY3C 2P2JA 4L2ZA 2UUAC 4WS9A 4YHHC 2ZM6C 1MDFA 4DCVA 2P2QA 4NXMC 2UXCC 3RG2A 4R1LA 3J80D 4LF7C 4D56A 5BSMA 1N2FA 3UZ0A 5IFIA 3N2QA 1QM4A 5GTDA 2YCBA 4LFBC 5BSTA 2QW0X 1O93A 4JI0C 1IBMC 2UXDC 3JAMD 1MD9A 2YWCA 3FCEA 1N33C 4D57A 1N36C 1EGAA 5BSWA 2VQFC 1XRCA 3AF5A 1P7LA 2JMPA 1IBLC 4DV4C 4TPSB 3IPLA 4PHTA 3NI2A 5E7QA 3C5EA 5AE1A 3CJEA 1GPMA 2D7VA 4JI6C 2P2MA 4JI1C 2DPLA 4KHPC 3EQ6A 4RMNA 4FTFA 2D1TA 1N34C 4RLQA 1T5HX 5BR8C 4NDNA 4DR4C 1UKKA 5T8SA 4I9FA 2BH1X 4L7IA 4U5YD 3LUSA 4KTTA 3CW8X 4JI3C 4PZPA 5KYVA 1PA4A 1O9TA 4JI2C 4DR3C 2KZFA 1XRAA 4DG9A 3PESA 4FUTA 5BUQA 1ULTA 4LFAC 2HHHC 1HNXC 3LAXA 1USPA 2V7BA 4DV6C 4DV3C 2QVXX 1MXBA 3PBKA 1JOSA 4DCUA 3NPDA 4LF6C 1YJ7A 4XX2A 4JM1A 4OXIA 1ML8A 3VNRA 2OBVA 1RY2A 4K0BA 1J5EC 5ADZA 3T1YC 3KXWA 1L2FA 3E7XA 5JRHA 5A1IA 1MKYA 3IEVA 4L4QA 4B3TC 3J7AD 2ASBA 4OX9C 4JI4C 5AE3A 2UU9C 3VNQA 3NYRA 1T5DX 2F4VC 1QWIA 4LE5A 5LMNC 1IBKC 5CZXA 2QVZX 4EATA 3AF6A 1WF3A 3B7WA 2D27A 4R1MA 4DR2C 3OTOC 4NOZA 4RVOA 4NXNC 2E7GA 5BSRA 1XNQC 1ZB9A 4BCAA 2Y4NA 3I07A 4I9GA 1HH2P 4FUQA 5K85A 3IEUA 4KTVA 2E8FA 3J81D 4B3SC 4LF8C 2P2FA 2DYJA 4RM3A 2BJOA 4DR1C 1XMQC 4DCTA 4B3MC 4DV5C 2Y27A 4DCSA 4RVNA 2E0GA 1USPB 1MXCA 1HR0C 3GR1A 2XR1A 3L95X 2UXBC 3R44A 1XNRC 4RLFA 3TUFA 3TDEA 5AE2A 3LNVA 4GS5A 4D4GA 1PG4A 5BSVA 2QL8A 3ETOA 4K0KC 4IR7A 2VQEC 1I94C 4LF9C 4B3RC 4DV2C 2E8EA 5A2QD 1V26A 4RM2A 1RG9A 4DG8A 5FLXD 4X65C 1MDBA 3RV2A 3A9UA 4DR7C 2EGTA 1ZB8A 2HJGA 4HPVA 4R0MA 1FUGA 4ODJA 3R9WA 3FCCA 3H2TA 4OYCA 5IT9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 C;  3AF6 A;  4X64 C;  1WF3 A;  1N34 C;  2OPL B;  4LF5 C;  2UUB C;  5BR8 C;  4DR4 C;  4DR2 C;  1UKK A;  3OTO C;  2UUC C;  4X62 C;  4NOZ A;  3EER A;  3GKU A;  3LUS A;  4JI8 C;  4NXN C;  2E7G A;  3T1H C;  1XNQ C;  4JI3 C;  1ZB9 A;  3I07 A;  1PA4 A;  4LFC C;  1HH2 P;  4JI2 C;  1KKG A;  2CXC A;  4DR3 C;  5LMU C;  4JV5 C;  4BSZ A;  2KZF A;  5IWA C;  3IEU A;  1LQL A;  2E8F A;  3J81 D;  4YY3 C;  4B3S C;  4LF8 C;  2UUA C;  2DYJ A;  2BJO A;  4YHH C;  2ZM6 C;  4DR1 C;  4DCT A;  1XMQ C;  2ATW A;  4B3M C;  4DCV A;  4DV5 C;  4LFA C;  4NXM C;  4DCS A;  1WH9 A;  2HHH C;  2UXC C;  1USP B;  1HR0 C;  2UXB C;  2XR1 A;  3J80 D;  4LF7 C;  1XMO C;  1HNX C;  1VLA A;  1USP A;  4DV6 C;  1XNR C;  4DV3 C;  1N2F A;  1NYE A;  4JI7 C;  4AQY C;  2OPL A;  3R9X A;  1HNW C;  1N32 C;  1JOS A;  4DCU A;  2YCB A;  4DV7 C;  4LFB C;  4LF6 C;  4XX2 A;  1FJG C;  1ML8 A;  4JI0 C;  1IBM C;  2UXD C;  3JAM D;  4DV0 C;  1J5E C;  4GKK C;  2QL8 A;  4DV1 C;  3T1Y C;  1N33 C;  4DR6 C;  4K0K C;  1L2F A;  1N36 C;  2VQE C;  1I94 C;  4LF9 C;  4B3R C;  2CY1 A;  1MKY A;  4DV2 C;  1EGA A;  3IEV A;  2VQF C;  2E8E A;  2E8C A;  5A2Q D;  1HNZ C;  4B3T C;  3AF5 A;  3J7A D;  2JMP A;  1IBL C;  2ASB A;  4DR5 C;  5FLX D;  4DV4 C;  4X65 C;  4OX9 C;  4JI4 C;  2UU9 C;  4X66 C;  4DR7 C;  2EGT A;  1ZB8 A;  2HJG A;  4MH4 A;  4DUZ C;  2F4V C;  3CJE A;  4MTN A;  1QWI A;  4DUY C;  4JYA C;  2ONF A;  5LMN C;  2D7V A;  1IBK C;  4JI5 C;  2PN2 A;  2E5L C;  4JI6 C;  4JI1 C;  1K0R A;  3R9W A;  2PT7 G;  4GKJ C;  4KHP C;  5IT9 D; 
#chains in the Genus database with same CATH topology
 3UX2 A;  2D28 C;  4X64 C;  5BSU A;  2WD9 A;  3SO4 A;  3G7S A;  2UUC C;  3TQI A;  3A9V A;  2WP0 C;  3EER A;  3GKU A;  4BC9 A;  4JI8 C;  3T1H C;  4G37 A;  1FLO A;  4ISB A;  1V25 A;  3S82 A;  1P4E A;  4LFC C;  4D4I A;  3AY0 A;  2CXC A;  5CZV A;  5LMU C;  2JNV A;  1IB8 A;  3GR0 A;  5IWA C;  3ETC A;  1LQL A;  2VSQ A;  2OO4 A;  5A1G A;  3LGX A;  2YX1 A;  1MXA A;  5BUR A;  2ATW A;  5DV9 A;  1WCJ A;  3A26 A;  1TH5 A;  1WH9 A;  1O92 A;  3VNS A;  1XRB A;  3L8C A;  1XDX A;  1XMO C;  1VLA A;  5A19 A;  4JI7 C;  1NYE A;  3R9X A;  4AQY C;  2OPL A;  1HNW C;  3DHV A;  3A4I A;  1N32 C;  4DV7 C;  2P02 A;  1FJG C;  5BUS A;  3FM7 A;  4GXR A;  2CU6 A;  1AMU A;  3PRO C;  2M5O A;  4DV0 C;  4GKK C;  1O90 A;  2AYA A;  4DV1 C;  4WV3 A;  2P2B A;  5KEI A;  4DR6 C;  2PRO A;  1P4E C;  4G36 A;  2CY1 A;  4BC7 A;  2E8C A;  2D1Q A;  1YGT A;  1HNZ C;  4BBY A;  5T8T A;  2P20 A;  3DAY A;  4DR5 C;  1PG3 A;  1V60 A;  5KYT A;  4X66 C;  2Y4O A;  3UOW A;  2KDN A;  4MH4 A;  4GXQ A;  4DUZ C;  5H9U A;  4MTN A;  4DUY C;  4JYA C;  4ZLP A;  2ONF A;  4JI5 C;  3CW9 A;  1LCI A;  2PN2 A;  2E5L C;  1K0R A;  5K8F A;  3IML A;  3I08 A;  3N54 B;  1XS3 A;  2PT7 G;  3GPC A;  4GKJ C;  4LF4 C;  4IZ6 A;  3NYQ A;  2OPL B;  4LF5 C;  2UUB C;  2D1R A;  4X62 C;  1BA3 A;  4PRO C;  2QVY X;  2VZE A;  3E7W A;  2D1S A;  3DLP X;  1KKG A;  4G1I A;  4JV5 C;  4BSZ A;  2YWB A;  4ZJZ A;  3CQ2 A;  4YY3 C;  2P2J A;  4L2Z A;  2UUA C;  4WS9 A;  4YHH C;  2ZM6 C;  1MDF A;  4DCV A;  2P2Q A;  4NXM C;  2UXC C;  3RG2 A;  4R1L A;  3J80 D;  4LF7 C;  4D56 A;  5BSM A;  1N2F A;  3UZ0 A;  5IFI A;  3N2Q A;  1QM4 A;  5GTD A;  2YCB A;  4LFB C;  5BST A;  2QW0 X;  1O93 A;  4JI0 C;  1IBM C;  2UXD C;  3JAM D;  1MD9 A;  1UWD A;  3CQ1 A;  2YWC A;  3FCE A;  1N33 C;  4D57 A;  2ZZM A;  1NY8 A;  1N36 C;  1EGA A;  1M6X A;  5BSW A;  2VQF C;  1XRC A;  3AF5 A;  1P7L A;  2JMP A;  1IBL C;  4DV4 C;  4TPS B;  2PG1 E;  4PUG A;  3IPL A;  4PHT A;  3NI2 A;  5E7Q A;  3C5E A;  5AE1 A;  3CJE A;  3CQ3 A;  1GPM A;  2D7V A;  4PUI A;  5LCI A;  4JI6 C;  2P2M A;  4JI1 C;  2DPL A;  4KHP C;  3EQ6 A;  4RMN A;  4FTF A;  2D1T A;  1N34 C;  4RLQ A;  1T5H X;  5BR8 C;  4NDN A;  4DR4 C;  1UKK A;  5T8S A;  4I9F A;  2BH1 X;  4L7I A;  4U5Y D;  3LUS A;  4KTT A;  3CW8 X;  4JI3 C;  4PZP A;  5KYV A;  1PA4 A;  1O9T A;  4JI2 C;  4DR3 C;  2KZF A;  1XRA A;  3UX3 A;  4DG9 A;  3PES A;  4FUT A;  5BUQ A;  1ULT A;  2ZZN A;  2MMA B;  4LFA C;  2HHH C;  3O2E A;  1HNX C;  3LAX A;  2KZ0 A;  1USP A;  2V7B A;  4DV6 C;  4DV3 C;  2QVX X;  1MXB A;  3PBK A;  1JOS A;  4DCU A;  3NPD A;  4LF6 C;  1YJ7 A;  4XX2 A;  3UEB A;  4JM1 A;  4OXI A;  1ML8 A;  3VNR A;  2OBV A;  1RY2 A;  2M5H A;  4K0B A;  1J5E C;  5ADZ A;  3T1Y C;  3KXW A;  2Z51 A;  1L2F A;  3E7X A;  5JRH A;  5A1I A;  1MKY A;  3IEV A;  4L4Q A;  4B3T C;  3J7A D;  2ASB A;  4OX9 C;  4JI4 C;  5AE3 A;  2UU9 C;  3VNQ A;  3A25 A;  3NYR A;  1T5D X;  2F4V C;  1QWI A;  4LE5 A;  5LMN C;  1IBK C;  1XHJ A;  5CZX A;  2QVZ X;  4EAT A;  3AF6 A;  3TR3 A;  2ZTB A;  1WF3 A;  3B7W A;  2D27 A;  4R1M A;  4DR2 C;  3OTO C;  4NOZ A;  4RVO A;  4NXN C;  2E7G A;  5BSR A;  1XNQ C;  1ZB9 A;  4BCA A;  2Y4N A;  3I07 A;  4I9G A;  1HH2 P;  4FUQ A;  2NCL A;  5K85 A;  3IEU A;  4KTV A;  2E8F A;  3J81 D;  4B3S C;  4LF8 C;  1M6X C;  2P2F A;  2MM9 A;  4PUH A;  2DYJ A;  4RM3 A;  2BJO A;  4DR1 C;  1XMQ C;  4DCT A;  4B3M C;  1VEH A;  2Y27 A;  4DV5 C;  4DCS A;  4RVN A;  2E0G A;  1USP B;  1MXC A;  1HR0 C;  3GR1 A;  2XR1 A;  3L95 X;  1PU1 A;  2UXB C;  3R44 A;  1XNR C;  4RLF A;  3LNO A;  3TUF A;  3TDE A;  5AE2 A;  3LNV A;  4GS5 A;  4D4G A;  1PG4 A;  5BSV A;  2QL8 A;  3ETO A;  4K0K C;  4IR7 A;  2VQE C;  1I94 C;  4LF9 C;  4B3R C;  4DV2 C;  2DHM A;  2E8E A;  5A2Q D;  1V26 A;  4RM2 A;  1RG9 A;  4DG8 A;  5FLX D;  4X65 C;  1MDB A;  3RV2 A;  3A9U A;  2MCQ A;  4DR7 C;  2EGT A;  1ZB8 A;  2HJG A;  4HPV A;  3K6R A;  4R0M A;  1FUG A;  4ODJ A;  3R9W A;  3FCC A;  3H2T A;  4OYC A;  5IT9 D; 
#chains in the Genus database with same CATH homology
 2D28 C;  4X64 C;  5BSU A;  2WD9 A;  3SO4 A;  3G7S A;  2UUC C;  3TQI A;  3A9V A;  2WP0 C;  3EER A;  3GKU A;  4BC9 A;  4JI8 C;  3T1H C;  4G37 A;  4ISB A;  1V25 A;  3S82 A;  4LFC C;  4D4I A;  2CXC A;  5CZV A;  5LMU C;  3GR0 A;  5IWA C;  3ETC A;  1LQL A;  2VSQ A;  2OO4 A;  5A1G A;  3LGX A;  5BUR A;  1MXA A;  2ATW A;  5DV9 A;  1WH9 A;  1O92 A;  3VNS A;  1XRB A;  3L8C A;  1XMO C;  1VLA A;  5A19 A;  4JI7 C;  1NYE A;  3R9X A;  4AQY C;  2OPL A;  1HNW C;  3DHV A;  3A4I A;  1N32 C;  4DV7 C;  2P02 A;  1FJG C;  5BUS A;  4GXR A;  1AMU A;  3PRO C;  4DV0 C;  4GKK C;  1O90 A;  2AYA A;  4WV3 A;  4DV1 C;  2P2B A;  5KEI A;  4DR6 C;  2PRO A;  4G36 A;  2CY1 A;  4BC7 A;  2E8C A;  2D1Q A;  1HNZ C;  4BBY A;  5T8T A;  2P20 A;  3DAY A;  4DR5 C;  1PG3 A;  5KYT A;  4X66 C;  2Y4O A;  3UOW A;  4MH4 A;  4GXQ A;  4DUZ C;  5H9U A;  4MTN A;  4DUY C;  4JYA C;  4ZLP A;  2ONF A;  4JI5 C;  3CW9 A;  1LCI A;  2PN2 A;  2E5L C;  1K0R A;  5K8F A;  3IML A;  3I08 A;  3N54 B;  2PT7 G;  3GPC A;  4GKJ C;  4LF4 C;  4IZ6 A;  3NYQ A;  2OPL B;  4LF5 C;  2UUB C;  2D1R A;  4X62 C;  1BA3 A;  4PRO C;  2QVY X;  2VZE A;  3E7W A;  2D1S A;  3DLP X;  1KKG A;  4G1I A;  4JV5 C;  4BSZ A;  2YWB A;  4ZJZ A;  4YY3 C;  2P2J A;  4L2Z A;  2UUA C;  4WS9 A;  4YHH C;  2ZM6 C;  1MDF A;  4DCV A;  2P2Q A;  4NXM C;  2UXC C;  3RG2 A;  4R1L A;  3J80 D;  4LF7 C;  4D56 A;  5BSM A;  1N2F A;  3UZ0 A;  5IFI A;  3N2Q A;  1QM4 A;  5GTD A;  2YCB A;  4LFB C;  5BST A;  2QW0 X;  1O93 A;  4JI0 C;  1IBM C;  2UXD C;  3JAM D;  1MD9 A;  2YWC A;  3FCE A;  1N33 C;  4D57 A;  1N36 C;  1EGA A;  5BSW A;  2VQF C;  1XRC A;  3AF5 A;  1P7L A;  2JMP A;  1IBL C;  4DV4 C;  4TPS B;  3IPL A;  4PHT A;  3NI2 A;  5E7Q A;  3C5E A;  5AE1 A;  3CJE A;  1GPM A;  2D7V A;  4JI6 C;  2P2M A;  4JI1 C;  2DPL A;  4KHP C;  3EQ6 A;  4RMN A;  4FTF A;  2D1T A;  1N34 C;  4RLQ A;  1T5H X;  5BR8 C;  4NDN A;  4DR4 C;  1UKK A;  5T8S A;  4I9F A;  2BH1 X;  4L7I A;  4U5Y D;  3LUS A;  4KTT A;  3CW8 X;  4JI3 C;  4PZP A;  5KYV A;  1PA4 A;  1O9T A;  4JI2 C;  4DR3 C;  2KZF A;  1XRA A;  4DG9 A;  3PES A;  4FUT A;  5BUQ A;  1ULT A;  4LFA C;  2HHH C;  1HNX C;  3LAX A;  1USP A;  2V7B A;  4DV6 C;  4DV3 C;  2QVX X;  1MXB A;  3PBK A;  1JOS A;  4DCU A;  3NPD A;  4LF6 C;  1YJ7 A;  4XX2 A;  4JM1 A;  4OXI A;  1ML8 A;  3VNR A;  2OBV A;  1RY2 A;  4K0B A;  1J5E C;  5ADZ A;  3T1Y C;  3KXW A;  1L2F A;  3E7X A;  5JRH A;  5A1I A;  1MKY A;  3IEV A;  4L4Q A;  4B3T C;  3J7A D;  2ASB A;  4OX9 C;  4JI4 C;  5AE3 A;  2UU9 C;  3VNQ A;  3NYR A;  1T5D X;  2F4V C;  1QWI A;  4LE5 A;  5LMN C;  1IBK C;  5CZX A;  2QVZ X;  4EAT A;  3AF6 A;  1WF3 A;  3B7W A;  2D27 A;  4R1M A;  4DR2 C;  3OTO C;  4NOZ A;  4RVO A;  4NXN C;  2E7G A;  5BSR A;  1XNQ C;  1ZB9 A;  4BCA A;  2Y4N A;  3I07 A;  4I9G A;  1HH2 P;  4FUQ A;  5K85 A;  3IEU A;  4KTV A;  2E8F A;  3J81 D;  4B3S C;  4LF8 C;  2P2F A;  2DYJ A;  4RM3 A;  2BJO A;  4DR1 C;  1XMQ C;  4DCT A;  4B3M C;  4DV5 C;  2Y27 A;  4DCS A;  4RVN A;  2E0G A;  1USP B;  1MXC A;  1HR0 C;  3GR1 A;  2XR1 A;  3L95 X;  2UXB C;  3R44 A;  1XNR C;  4RLF A;  3TUF A;  3TDE A;  5AE2 A;  3LNV A;  4GS5 A;  4D4G A;  1PG4 A;  5BSV A;  2QL8 A;  3ETO A;  4K0K C;  4IR7 A;  2VQE C;  1I94 C;  4LF9 C;  4B3R C;  4DV2 C;  2E8E A;  5A2Q D;  1V26 A;  4RM2 A;  1RG9 A;  4DG8 A;  5FLX D;  4X65 C;  1MDB A;  3RV2 A;  3A9U A;  4DR7 C;  2EGT A;  1ZB8 A;  2HJG A;  4HPV A;  4R0M A;  1FUG A;  4ODJ A;  3R9W A;  3FCC A;  3H2T A;  4OYC A;  5IT9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...