4KHPC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 47
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4khpC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4khpC02
1N34C 5IWAC 3GKUA 4DCVA 5A2QD 1EGAA 1USPB 3T1YC 1MKYA 4JI5C 2CY1A 1JOSA 4JI0C 1XMOC 1HR0C 5IT9D 4B3SC 1IBKC 3EERA 2UXDC 4DCUA 4DR7C 4JI7C 4JI4C 4JV5C 2UUAC 4LF9C 2UXCC 3AF6A 2ZM6C 2PT7G 4LF4C 1HNWC 4DV2C 2BJOA 1I94C 3R9WA 4XX2A 1FJGC 4NXNC 4DR3C 4DV3C 4DV4C 4DR5C 1LQLA 2VQEC 3J7AD 4B3TC 2UUCC 1N32C 2E8FA 3LUSA 2ASBA 4AQYC 3J80D 4X64C 2VQFC 1NYEA 2PN2A 4GKKC 4DR4C 2CXCA 4DV1C 1HNXC 4BSZA 3IEVA 4B3RC 1ZB8A 4X66C 1HNZC 2E7GA 2ONFA 4YHHC 4LFAC 4MTNA 1PA4A 4NOZA 1WH9A 4X62C 1XMQC 2OPLA 3CJEA 2UXBC 2F4VC 4JYAC 1K0RA 1USPA 1N36C 1XNRC 1WF3A 1J5EC 4B3MC 1IBLC 2JMPA 4LFBC 1IBMC 1HH2P 4DR6C 1ZB9A 2YCBA 4DV5C 2UU9C 4DCSA 2KZFA 5FLXD 3AF5A 4LF5C 4LFCC 4NXMC 1N33C 1UKKA 4DUZC 4YY3C 4KHPC 5BR8C 1KKGA 2OPLB 2E8CA 4DR2C 3JAMD 2E8EA 1VLAA 4OX9C 1QWIA 3J81D 4JI3C 4LF7C 4K0KC 1L2FA 2DYJA 3I07A 4DUYC 4LF6C 2HHHC 4JI1C 2D7VA 3OTOC 2EGTA 4DV6C 4JI6C 1N2FA 5LMNC 2ATWA 2E5LC 4DR1C 4JI8C 4DV7C 4LF8C 2HJGA 3T1HC 4MH4A 4DCTA 4DV0C 3IEUA 5LMUC 4X65C 2XR1A 4JI2C 2QL8A 2UUBC 4GKJC 1ML8A 1XNQC 3R9XA
chains in the Genus database with same CATH superfamily
1N34C 1ULTA 4DCVA 5AE1A 5A2QD 1FUGA 3RV2A 4I9GA 1MKYA 1O93A 1HR0C 4B3SC 2ZTBA 2QVXX 1IBKC 3EERA 4I9FA 4DR7C 3NPDA 3A25A 1AMUA 3A4IA 4DV2C 2BJOA 3EQ6A 1GPMA 3ETOA 4R1MA 4G36A 3TQIA 5BSVA 1NY8A 3R44A 1P4EC 4X64C 3A9VA 2VQFC 3IEVA 5BUSA 2ZZMA 2DPLA 4X66C 5KYTA 3NI2A 4G1IA 3IPLA 4MTNA 4ZJZA 1PA4A 1WH9A 4K0BA 1XMQC 3N54B 5BUQA 1USPA 1WF3A 3FCEA 3TDEA 2JMPA 2Y4NA 3K6RA 4DV5C 4PROC 4LFCC 5A1GA 4OYCA 5AE2A 4DG8A 3GR0A 1M6XA 2E8CA 3JAMD 2E8EA 1O92A 4L4QA 1V25A 3VNSA 4LF7C 2EGTA 3E7XA 2DHMA 1N2FA 5LMNC 4DR1C 3AY0A 2BH1X 2HJGA 4OXIA 4DCTA 4DV0C 4G37A 3CQ1A 2QL8A 2Z51A 1XMOC 1TH5A 3GKUA 2P2BA 3LNOA 1XHJA 2WD9A 4JI5C 4RLQA 1JOSA 2CU6A 4PHTA 2P2QA 4DCUA 4JI7C 4LF9C 4L7IA 2UXCC 2Y27A 1V26A 1HNWC 4RLFA 3R9WA 2P02A 4XX2A 4NXNC 1LCIA 4KTVA 4BC7A 4DR3C 4DV3C 5ADZA 2MM9A 1N32C 2E8FA 3LUSA 4AQYC 3J80D 2PN2A 3GPCA 5BSMA 3KXWA 4LE5A 4GXRA 1MDBA 4RM3A 1ZB8A 2E0GA 1YGTA 4BCAA 4YHHC 3UX3A 3FCCA 4IR7A 3N2QA 5K8FA 2QW0X 2VZEA 2V7BA 2F4VC 2D1QA 1XNRC 4RVOA 1IBMC 1HH2P 2Y4OA 4U5YD 1ZB9A 2UU9C 2KZFA 3NYRA 3FM7A 1N33C 2PROA 4DR2C 1QWIA 1PU1A 4RMNA 3L8CA 4K0KC 1L2FA 2DYJA 3I07A 3NYQA 4D56A 2HHHC 4JI1C 3C5EA 3O2EA 1XS3A 3A26A 4ZLPA 2ATWA 2VSQA 1YJ7A 4LF8C 3DAYA 4MH4A 3IEUA 2QVZX 1P7LA 2XR1A 4ISBA 3CW9A 4KTTA 3E7WA 2UUBC 2D27A 1ML8A 3B7WA 1USPB 5BSUA 5IT9D 1WCJA 2UXDC 4JI4C 2NCLA 3UEBA 5GTDA 2PT7G 4PUIA 2ZZNA 1XRAA 5T8TA 4LF4C 1T5DX 3CW8X 3CQ3A 3VNQA 4R1LA 4ODJA 4DR5C 1FLOA 2VQEC 3J7AD 4B3TC 2UUCC 2ASBA 4HPVA 3L95X 2JNVA 1NYEA 3S82A 1RY2A 2CXCA 4DV1C 1HNXC 2AYAA 4BSZA 4L2ZA 3GR1A 5BURA 2KDNA 5A19A 5KYVA 4D4GA 4X62C 4GS5A 2OPLA 1P4EA 3CJEA 1M6XC 2D1RA 2QVYX 4FUTA 3LNVA 1J5EC 1IBLC 4LFBC 2P20A 5BSWA 5H9UA 2YCBA 2WP0C 4DCSA 5FLXD 3AF5A 4LF5C 4NXMC 1UKKA 4KHPC 5BR8C 3H2TA 2D1SA 2YWCA 2OPLB 5LCIA 5JRHA 1MD9A 1VLAA 5CZXA 3J81D 3UZ0A 3I08A 4GXQA 4JI3C 4DUYC 3OTOC 4FUQA 1MXCA 4JI8C 3T1HC 2M5OA 3UX2A 4X65C 4JI2C 2M5HA 5IFIA 2D1TA 2MCQA 2KZ0A 1IB8A 3PESA 1XNQC 5IWAC 1EGAA 4JM1A 5BSRA 3T1YC 4PZPA 3RG2A 1PG3A 2YX1A 2CY1A 4JI0C 2OO4A 1MXAA 3LGXA 1XRCA 4JV5C 2UUAC 1MXBA 3VNRA 3AF6A 2ZM6C 1O90A 4FTFA 2D28C 3TR3A 1I94C 4PUHA 5DV9A 4NDNA 5K85A 1PG4A 1FJGC 5BSTA 4DV4C 5CZVA 1XDXA 1LQLA 1O9TA 2P2FA 2OBVA 4DG9A 1RG9A 2P2JA 3DHVA 5E7QA 4GKKC 1VEHA 2PG1E 4DR4C 4EATA 1MDFA 4B3RC 4TPSB 1HNZC 2E7GA 2ONFA 4D57A 4LFAC 3TUFA 3G7SA 4NOZA 3CQ2A 3IMLA 1QM4A 3PROC 4RVNA 4R0MA 3DLPX 2UXBC 4PUGA 4JYAC 1K0RA 1N36C 4BC9A 4B3MC 4D4IA 4DR6C 3LAXA 4BBYA 4DUZC 4YY3C 1KKGA 5AE3A 3PBKA 4IZ6A 4OX9C 1T5HX 2P2MA 3ETCA 3SO4A 4WV3A 5KEIA 4LF6C 4WS9A 2D7VA 1XRBA 4JI6C 4DV6C 1V60A 3A9UA 4RM2A 2E5LC 1BA3A 4DV7C 5T8SA 5LMUC 1UWDA 2YWBA 2MMAB 4GKJC 5A1IA 3R9XA 3UOWA
chains in the Genus database with same CATH topology
1N34C 1ULTA 4DCVA 5AE1A 5A2QD 1FUGA 3RV2A 4I9GA 1MKYA 1O93A 1HR0C 4B3SC 2QVXX 1IBKC 3EERA 4I9FA 4DR7C 3NPDA 1AMUA 3A4IA 4DV2C 2BJOA 3EQ6A 1GPMA 3ETOA 4R1MA 4G36A 3TQIA 5BSVA 3R44A 4X64C 3A9VA 2VQFC 3IEVA 5BUSA 2DPLA 4X66C 5KYTA 3NI2A 4G1IA 3IPLA 4MTNA 4ZJZA 1PA4A 1WH9A 4K0BA 1XMQC 3N54B 5BUQA 1USPA 1WF3A 3FCEA 3TDEA 2JMPA 2Y4NA 4DV5C 4PROC 4LFCC 5A1GA 4OYCA 5AE2A 4DG8A 3GR0A 2E8CA 3JAMD 2E8EA 1O92A 4L4QA 1V25A 3VNSA 4LF7C 2EGTA 3E7XA 1N2FA 5LMNC 4DR1C 2BH1X 2HJGA 4OXIA 4DCTA 4DV0C 4G37A 2QL8A 1XMOC 3GKUA 2P2BA 2WD9A 4JI5C 4RLQA 1JOSA 4PHTA 2P2QA 4DCUA 4JI7C 4LF9C 4L7IA 2UXCC 2Y27A 1V26A 1HNWC 4RLFA 3R9WA 2P02A 4XX2A 4NXNC 1LCIA 4KTVA 4BC7A 4DR3C 4DV3C 5ADZA 1N32C 2E8FA 3LUSA 4AQYC 3J80D 2PN2A 3GPCA 5BSMA 3KXWA 4LE5A 4GXRA 1MDBA 4RM3A 1ZB8A 2E0GA 4BCAA 4YHHC 3FCCA 4IR7A 3N2QA 5K8FA 2QW0X 2VZEA 2V7BA 2F4VC 2D1QA 1XNRC 4RVOA 1IBMC 1HH2P 2Y4OA 4U5YD 1ZB9A 2UU9C 2KZFA 3NYRA 1N33C 2PROA 4DR2C 1QWIA 4RMNA 3L8CA 4K0KC 1L2FA 2DYJA 3I07A 3NYQA 4D56A 2HHHC 4JI1C 3C5EA 4ZLPA 2ATWA 2VSQA 1YJ7A 4LF8C 3DAYA 4MH4A 3IEUA 2QVZX 1P7LA 2XR1A 4ISBA 3CW9A 4KTTA 3E7WA 2UUBC 2D27A 1ML8A 3B7WA 1USPB 5BSUA 5IT9D 2UXDC 4JI4C 5GTDA 2PT7G 1XRAA 5T8TA 4LF4C 1T5DX 3CW8X 3VNQA 4R1LA 4ODJA 4DR5C 2VQEC 3J7AD 4B3TC 2UUCC 2ASBA 4HPVA 3L95X 1NYEA 3S82A 1RY2A 2CXCA 4DV1C 1HNXC 2AYAA 4BSZA 4L2ZA 3GR1A 5BURA 5A19A 5KYVA 4D4GA 4X62C 4GS5A 2OPLA 3CJEA 2D1RA 2QVYX 4FUTA 3LNVA 1J5EC 1IBLC 4LFBC 2P20A 5BSWA 5H9UA 2YCBA 2WP0C 5FLXD 4DCSA 3AF5A 4LF5C 4NXMC 1UKKA 4KHPC 5BR8C 3H2TA 2D1SA 2YWCA 2OPLB 5JRHA 1MD9A 1VLAA 5CZXA 3J81D 3UZ0A 3I08A 4GXQA 4JI3C 4DUYC 3OTOC 4FUQA 1MXCA 4JI8C 3T1HC 4X65C 4JI2C 5IFIA 2D1TA 3PESA 1XNQC 5IWAC 1EGAA 4JM1A 5BSRA 3T1YC 4PZPA 3RG2A 1PG3A 2CY1A 4JI0C 2OO4A 1MXAA 3LGXA 1XRCA 4JV5C 2UUAC 1MXBA 3VNRA 3AF6A 2ZM6C 1O90A 4FTFA 2D28C 1I94C 5DV9A 4NDNA 5K85A 1PG4A 1FJGC 5BSTA 4DV4C 5CZVA 1LQLA 1O9TA 2P2FA 2OBVA 4DG9A 1RG9A 2P2JA 3DHVA 5E7QA 4GKKC 4DR4C 4EATA 1MDFA 4B3RC 4TPSB 1HNZC 2E7GA 2ONFA 4D57A 4LFAC 3TUFA 3G7SA 4NOZA 3IMLA 1QM4A 3PROC 4RVNA 4R0MA 3DLPX 2UXBC 4JYAC 1K0RA 1N36C 4BC9A 4B3MC 4D4IA 4DR6C 3LAXA 4BBYA 4DUZC 4YY3C 1KKGA 5AE3A 3PBKA 4IZ6A 4OX9C 1T5HX 2P2MA 3ETCA 3SO4A 4WV3A 5KEIA 4LF6C 4WS9A 2D7VA 1XRBA 4JI6C 4DV6C 3A9UA 4RM2A 2E5LC 1BA3A 4DV7C 5T8SA 5LMUC 2YWBA 4GKJC 5A1IA 3R9XA 3UOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 C;  5IWA C;  3GKU A;  4DCV A;  5A2Q D;  1EGA A;  1USP B;  3T1Y C;  1MKY A;  4JI5 C;  2CY1 A;  1JOS A;  4JI0 C;  1XMO C;  1HR0 C;  5IT9 D;  4B3S C;  1IBK C;  3EER A;  2UXD C;  4DCU A;  4DR7 C;  4JI7 C;  4JI4 C;  4JV5 C;  2UUA C;  4LF9 C;  2UXC C;  3AF6 A;  2ZM6 C;  2PT7 G;  4LF4 C;  1HNW C;  4DV2 C;  2BJO A;  1I94 C;  3R9W A;  4XX2 A;  1FJG C;  4NXN C;  4DR3 C;  4DV3 C;  4DV4 C;  4DR5 C;  1LQL A;  2VQE C;  3J7A D;  4B3T C;  2UUC C;  1N32 C;  2E8F A;  3LUS A;  2ASB A;  4AQY C;  3J80 D;  4X64 C;  2VQF C;  1NYE A;  2PN2 A;  4GKK C;  4DR4 C;  2CXC A;  4DV1 C;  1HNX C;  4BSZ A;  3IEV A;  4B3R C;  1ZB8 A;  4X66 C;  1HNZ C;  2E7G A;  2ONF A;  4YHH C;  4LFA C;  4MTN A;  1PA4 A;  4NOZ A;  1WH9 A;  4X62 C;  1XMQ C;  2OPL A;  3CJE A;  2UXB C;  2F4V C;  4JYA C;  1K0R A;  1USP A;  1N36 C;  1XNR C;  1WF3 A;  1J5E C;  4B3M C;  1IBL C;  2JMP A;  4LFB C;  1IBM C;  1HH2 P;  4DR6 C;  1ZB9 A;  2YCB A;  4DV5 C;  2UU9 C;  4DCS A;  2KZF A;  5FLX D;  3AF5 A;  4LF5 C;  4LFC C;  4NXM C;  1N33 C;  1UKK A;  4DUZ C;  4YY3 C;  4KHP C;  5BR8 C;  1KKG A;  2OPL B;  2E8C A;  4DR2 C;  3JAM D;  2E8E A;  1VLA A;  4OX9 C;  1QWI A;  3J81 D;  4JI3 C;  4LF7 C;  4K0K C;  1L2F A;  2DYJ A;  3I07 A;  4DUY C;  4LF6 C;  2HHH C;  4JI1 C;  2D7V A;  3OTO C;  2EGT A;  4DV6 C;  4JI6 C;  1N2F A;  5LMN C;  2ATW A;  2E5L C;  4DR1 C;  4JI8 C;  4DV7 C;  4LF8 C;  2HJG A;  3T1H C;  4MH4 A;  4DCT A;  4DV0 C;  3IEU A;  5LMU C;  4X65 C;  2XR1 A;  4JI2 C;  2QL8 A;  2UUB C;  4GKJ C;  1ML8 A;  1XNQ C;  3R9X A; 
#chains in the Genus database with same CATH topology
 1N34 C;  1ULT A;  4DCV A;  5AE1 A;  5A2Q D;  1FUG A;  3RV2 A;  4I9G A;  1MKY A;  1O93 A;  1HR0 C;  4B3S C;  2ZTB A;  2QVX X;  1IBK C;  3EER A;  4I9F A;  4DR7 C;  3NPD A;  3A25 A;  1AMU A;  3A4I A;  4DV2 C;  2BJO A;  3EQ6 A;  1GPM A;  3ETO A;  4R1M A;  4G36 A;  3TQI A;  5BSV A;  1NY8 A;  3R44 A;  1P4E C;  4X64 C;  3A9V A;  2VQF C;  3IEV A;  5BUS A;  2ZZM A;  2DPL A;  4X66 C;  5KYT A;  3NI2 A;  4G1I A;  3IPL A;  4MTN A;  4ZJZ A;  1PA4 A;  1WH9 A;  4K0B A;  1XMQ C;  3N54 B;  5BUQ A;  1USP A;  1WF3 A;  3FCE A;  3TDE A;  2JMP A;  2Y4N A;  3K6R A;  4DV5 C;  4PRO C;  4LFC C;  5A1G A;  4OYC A;  5AE2 A;  4DG8 A;  3GR0 A;  1M6X A;  2E8C A;  3JAM D;  2E8E A;  1O92 A;  4L4Q A;  1V25 A;  3VNS A;  4LF7 C;  2EGT A;  3E7X A;  2DHM A;  1N2F A;  5LMN C;  4DR1 C;  3AY0 A;  2BH1 X;  2HJG A;  4OXI A;  4DCT A;  4DV0 C;  4G37 A;  3CQ1 A;  2QL8 A;  2Z51 A;  1XMO C;  1TH5 A;  3GKU A;  2P2B A;  3LNO A;  1XHJ A;  2WD9 A;  4JI5 C;  4RLQ A;  1JOS A;  2CU6 A;  4PHT A;  2P2Q A;  4DCU A;  4JI7 C;  4LF9 C;  4L7I A;  2UXC C;  2Y27 A;  1V26 A;  1HNW C;  4RLF A;  3R9W A;  2P02 A;  4XX2 A;  4NXN C;  1LCI A;  4KTV A;  4BC7 A;  4DR3 C;  4DV3 C;  5ADZ A;  2MM9 A;  1N32 C;  2E8F A;  3LUS A;  4AQY C;  3J80 D;  2PN2 A;  3GPC A;  5BSM A;  3KXW A;  4LE5 A;  4GXR A;  1MDB A;  4RM3 A;  1ZB8 A;  2E0G A;  1YGT A;  4BCA A;  4YHH C;  3UX3 A;  3FCC A;  4IR7 A;  3N2Q A;  5K8F A;  2QW0 X;  2VZE A;  2V7B A;  2F4V C;  2D1Q A;  1XNR C;  4RVO A;  1IBM C;  1HH2 P;  2Y4O A;  4U5Y D;  1ZB9 A;  2UU9 C;  2KZF A;  3NYR A;  3FM7 A;  1N33 C;  2PRO A;  4DR2 C;  1QWI A;  1PU1 A;  4RMN A;  3L8C A;  4K0K C;  1L2F A;  2DYJ A;  3I07 A;  3NYQ A;  4D56 A;  2HHH C;  4JI1 C;  3C5E A;  3O2E A;  1XS3 A;  3A26 A;  4ZLP A;  2ATW A;  2VSQ A;  1YJ7 A;  4LF8 C;  3DAY A;  4MH4 A;  3IEU A;  2QVZ X;  1P7L A;  2XR1 A;  4ISB A;  3CW9 A;  4KTT A;  3E7W A;  2UUB C;  2D27 A;  1ML8 A;  3B7W A;  1USP B;  5BSU A;  5IT9 D;  1WCJ A;  2UXD C;  4JI4 C;  2NCL A;  3UEB A;  5GTD A;  2PT7 G;  4PUI A;  2ZZN A;  1XRA A;  5T8T A;  4LF4 C;  1T5D X;  3CW8 X;  3CQ3 A;  3VNQ A;  4R1L A;  4ODJ A;  4DR5 C;  1FLO A;  2VQE C;  3J7A D;  4B3T C;  2UUC C;  2ASB A;  4HPV A;  3L95 X;  2JNV A;  1NYE A;  3S82 A;  1RY2 A;  2CXC A;  4DV1 C;  1HNX C;  2AYA A;  4BSZ A;  4L2Z A;  3GR1 A;  5BUR A;  2KDN A;  5A19 A;  5KYV A;  4D4G A;  4X62 C;  4GS5 A;  2OPL A;  1P4E A;  3CJE A;  1M6X C;  2D1R A;  2QVY X;  4FUT A;  3LNV A;  1J5E C;  1IBL C;  4LFB C;  2P20 A;  5BSW A;  5H9U A;  2YCB A;  2WP0 C;  4DCS A;  5FLX D;  3AF5 A;  4LF5 C;  4NXM C;  1UKK A;  4KHP C;  5BR8 C;  3H2T A;  2D1S A;  2YWC A;  2OPL B;  5LCI A;  5JRH A;  1MD9 A;  1VLA A;  5CZX A;  3J81 D;  3UZ0 A;  3I08 A;  4GXQ A;  4JI3 C;  4DUY C;  3OTO C;  4FUQ A;  1MXC A;  4JI8 C;  3T1H C;  2M5O A;  3UX2 A;  4X65 C;  4JI2 C;  2M5H A;  5IFI A;  2D1T A;  2MCQ A;  2KZ0 A;  1IB8 A;  3PES A;  1XNQ C;  5IWA C;  1EGA A;  4JM1 A;  5BSR A;  3T1Y C;  4PZP A;  3RG2 A;  1PG3 A;  2YX1 A;  2CY1 A;  4JI0 C;  2OO4 A;  1MXA A;  3LGX A;  1XRC A;  4JV5 C;  2UUA C;  1MXB A;  3VNR A;  3AF6 A;  2ZM6 C;  1O90 A;  4FTF A;  2D28 C;  3TR3 A;  1I94 C;  4PUH A;  5DV9 A;  4NDN A;  5K85 A;  1PG4 A;  1FJG C;  5BST A;  4DV4 C;  5CZV A;  1XDX A;  1LQL A;  1O9T A;  2P2F A;  2OBV A;  4DG9 A;  1RG9 A;  2P2J A;  3DHV A;  5E7Q A;  4GKK C;  1VEH A;  2PG1 E;  4DR4 C;  4EAT A;  1MDF A;  4B3R C;  4TPS B;  1HNZ C;  2E7G A;  2ONF A;  4D57 A;  4LFA C;  3TUF A;  3G7S A;  4NOZ A;  3CQ2 A;  3IML A;  1QM4 A;  3PRO C;  4RVN A;  4R0M A;  3DLP X;  2UXB C;  4PUG A;  4JYA C;  1K0R A;  1N36 C;  4BC9 A;  4B3M C;  4D4I A;  4DR6 C;  3LAX A;  4BBY A;  4DUZ C;  4YY3 C;  1KKG A;  5AE3 A;  3PBK A;  4IZ6 A;  4OX9 C;  1T5H X;  2P2M A;  3ETC A;  3SO4 A;  4WV3 A;  5KEI A;  4LF6 C;  4WS9 A;  2D7V A;  1XRB A;  4JI6 C;  4DV6 C;  1V60 A;  3A9U A;  4RM2 A;  2E5L C;  1BA3 A;  4DV7 C;  5T8S A;  5LMU C;  1UWD A;  2YWB A;  2MMA B;  4GKJ C;  5A1I A;  3R9X A;  3UOW A; 
#chains in the Genus database with same CATH homology
 1N34 C;  1ULT A;  4DCV A;  5AE1 A;  5A2Q D;  1FUG A;  3RV2 A;  4I9G A;  1MKY A;  1O93 A;  1HR0 C;  4B3S C;  2QVX X;  1IBK C;  3EER A;  4I9F A;  4DR7 C;  3NPD A;  1AMU A;  3A4I A;  4DV2 C;  2BJO A;  3EQ6 A;  1GPM A;  3ETO A;  4R1M A;  4G36 A;  3TQI A;  5BSV A;  3R44 A;  4X64 C;  3A9V A;  2VQF C;  3IEV A;  5BUS A;  2DPL A;  4X66 C;  5KYT A;  3NI2 A;  4G1I A;  3IPL A;  4MTN A;  4ZJZ A;  1PA4 A;  1WH9 A;  4K0B A;  1XMQ C;  3N54 B;  5BUQ A;  1USP A;  1WF3 A;  3FCE A;  3TDE A;  2JMP A;  2Y4N A;  4DV5 C;  4PRO C;  4LFC C;  5A1G A;  4OYC A;  5AE2 A;  4DG8 A;  3GR0 A;  2E8C A;  3JAM D;  2E8E A;  1O92 A;  4L4Q A;  1V25 A;  3VNS A;  4LF7 C;  2EGT A;  3E7X A;  1N2F A;  5LMN C;  4DR1 C;  2BH1 X;  2HJG A;  4OXI A;  4DCT A;  4DV0 C;  4G37 A;  2QL8 A;  1XMO C;  3GKU A;  2P2B A;  2WD9 A;  4JI5 C;  4RLQ A;  1JOS A;  4PHT A;  2P2Q A;  4DCU A;  4JI7 C;  4LF9 C;  4L7I A;  2UXC C;  2Y27 A;  1V26 A;  1HNW C;  4RLF A;  3R9W A;  2P02 A;  4XX2 A;  4NXN C;  1LCI A;  4KTV A;  4BC7 A;  4DR3 C;  4DV3 C;  5ADZ A;  1N32 C;  2E8F A;  3LUS A;  4AQY C;  3J80 D;  2PN2 A;  3GPC A;  5BSM A;  3KXW A;  4LE5 A;  4GXR A;  1MDB A;  4RM3 A;  1ZB8 A;  2E0G A;  4BCA A;  4YHH C;  3FCC A;  4IR7 A;  3N2Q A;  5K8F A;  2QW0 X;  2VZE A;  2V7B A;  2F4V C;  2D1Q A;  1XNR C;  4RVO A;  1IBM C;  1HH2 P;  2Y4O A;  4U5Y D;  1ZB9 A;  2UU9 C;  2KZF A;  3NYR A;  1N33 C;  2PRO A;  4DR2 C;  1QWI A;  4RMN A;  3L8C A;  4K0K C;  1L2F A;  2DYJ A;  3I07 A;  3NYQ A;  4D56 A;  2HHH C;  4JI1 C;  3C5E A;  4ZLP A;  2ATW A;  2VSQ A;  1YJ7 A;  4LF8 C;  3DAY A;  4MH4 A;  3IEU A;  2QVZ X;  1P7L A;  2XR1 A;  4ISB A;  3CW9 A;  4KTT A;  3E7W A;  2UUB C;  2D27 A;  1ML8 A;  3B7W A;  1USP B;  5BSU A;  5IT9 D;  2UXD C;  4JI4 C;  5GTD A;  2PT7 G;  1XRA A;  5T8T A;  4LF4 C;  1T5D X;  3CW8 X;  3VNQ A;  4R1L A;  4ODJ A;  4DR5 C;  2VQE C;  3J7A D;  4B3T C;  2UUC C;  2ASB A;  4HPV A;  3L95 X;  1NYE A;  3S82 A;  1RY2 A;  2CXC A;  4DV1 C;  1HNX C;  2AYA A;  4BSZ A;  4L2Z A;  3GR1 A;  5BUR A;  5A19 A;  5KYV A;  4D4G A;  4X62 C;  4GS5 A;  2OPL A;  3CJE A;  2D1R A;  2QVY X;  4FUT A;  3LNV A;  1J5E C;  1IBL C;  4LFB C;  2P20 A;  5BSW A;  5H9U A;  2YCB A;  2WP0 C;  5FLX D;  4DCS A;  3AF5 A;  4LF5 C;  4NXM C;  1UKK A;  4KHP C;  5BR8 C;  3H2T A;  2D1S A;  2YWC A;  2OPL B;  5JRH A;  1MD9 A;  1VLA A;  5CZX A;  3J81 D;  3UZ0 A;  3I08 A;  4GXQ A;  4JI3 C;  4DUY C;  3OTO C;  4FUQ A;  1MXC A;  4JI8 C;  3T1H C;  4X65 C;  4JI2 C;  5IFI A;  2D1T A;  3PES A;  1XNQ C;  5IWA C;  1EGA A;  4JM1 A;  5BSR A;  3T1Y C;  4PZP A;  3RG2 A;  1PG3 A;  2CY1 A;  4JI0 C;  2OO4 A;  1MXA A;  3LGX A;  1XRC A;  4JV5 C;  2UUA C;  1MXB A;  3VNR A;  3AF6 A;  2ZM6 C;  1O90 A;  4FTF A;  2D28 C;  1I94 C;  5DV9 A;  4NDN A;  5K85 A;  1PG4 A;  1FJG C;  5BST A;  4DV4 C;  5CZV A;  1LQL A;  1O9T A;  2P2F A;  2OBV A;  4DG9 A;  1RG9 A;  2P2J A;  3DHV A;  5E7Q A;  4GKK C;  4DR4 C;  4EAT A;  1MDF A;  4B3R C;  4TPS B;  1HNZ C;  2E7G A;  2ONF A;  4D57 A;  4LFA C;  3TUF A;  3G7S A;  4NOZ A;  3IML A;  1QM4 A;  3PRO C;  4RVN A;  4R0M A;  3DLP X;  2UXB C;  4JYA C;  1K0R A;  1N36 C;  4BC9 A;  4B3M C;  4D4I A;  4DR6 C;  3LAX A;  4BBY A;  4DUZ C;  4YY3 C;  1KKG A;  5AE3 A;  3PBK A;  4IZ6 A;  4OX9 C;  1T5H X;  2P2M A;  3ETC A;  3SO4 A;  4WV3 A;  5KEI A;  4LF6 C;  4WS9 A;  2D7V A;  1XRB A;  4JI6 C;  4DV6 C;  3A9U A;  4RM2 A;  2E5L C;  1BA3 A;  4DV7 C;  5T8S A;  5LMU C;  2YWB A;  4GKJ C;  5A1I A;  3R9X A;  3UOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...