4KHPC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
total genus 47
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4khpC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4khpC02
1USPB 1HNZC 2E8CA 1IBKC 4DV4C 1XNQC 3T1HC 4B3RC 1EGAA 4DCUA 4LFBC 4MH4A 3CJEA 4DV1C 3IEUA 4X66C 4DR5C 4DV7C 4JI6C 4LF7C 5LMNC 4LF6C 5A2QD 4X64C 4JI8C 4DV3C 5LMUC 3GKUA 3LUSA 4DV2C 1IBMC 4JI0C 1USPA 1ML8A 1I94C 4DCSA 1HH2P 3J80D 2UUBC 4X65C 5BR8C 1J5EC 4DCTA 4JI1C 5FLXD 4DV5C 1XMQC 2VQEC 3IEVA 4NXNC 2E8FA 3R9WA 3I07A 2E8EA 1N2FA 4GKKC 4JI7C 2QL8A 1HNXC 4JI3C 4DUYC 4BSZA 2ZM6C 2PN2A 2ATWA 4DCVA 4KHPC 1PA4A 1ZB9A 2E7GA 2ASBA 1XNRC 4JI2C 2KZFA 1UKKA 2UXCC 3AF6A 1ZB8A 2VQFC 2YCBA 4OX9C 2CXCA 3T1YC 1JOSA 2CY1A 2JMPA 1XMOC 4LFCC 2F4VC 4NXMC 4GKJC 1HNWC 3JAMD 4DV6C 2EGTA 4LFAC 2OPLA 4JV5C 2DYJA 1QWIA 4NOZA 1FJGC 1LQLA 4B3SC 2HJGA 4YHHC 4AQYC 2XR1A 1WH9A 3AF5A 4LF8C 4K0KC 2HHHC 4MTNA 1WF3A 1NYEA 2ONFA 2BJOA 4LF5C 4LF9C 4DR7C 2UXDC 4YY3C 1L2FA 4B3TC 3J7AD 4DV0C 4JI4C 2E5LC 4DR2C 4DR1C 1N33C 2D7VA 4LF4C 1KKGA 2UU9C 3R9XA 4X62C 1VLAA 2UUAC 1N36C 5IT9D 1IBLC 4B3MC 4JI5C 4DR6C 3J81D 1HR0C 1N32C 3EERA 1MKYA 5IWAC 2PT7G 1K0RA 2UXBC 4JYAC 3OTOC 1N34C 4XX2A 2UUCC 4DR4C 4DR3C 4DUZC 2OPLB
chains in the Genus database with same CATH superfamily
1USPB 2E8CA 4BC9A 3T1HC 4B3RC 2MMAB 4LFBC 2Y4OA 3CJEA 4ISBA 4G1IA 5A19A 5A2QD 4K0BA 1PU1A 4D56A 5LMUC 5LCIA 1O90A 3LGXA 1HH2P 4D4GA 3IMLA 4DCTA 1P7LA 1XMQC 1RG9A 3IEVA 1O9TA 1ULTA 2E8EA 1AMUA 5IFIA 3EQ6A 2D1SA 1QM4A 1P4EA 3DHVA 4DCVA 4KHPC 1FUGA 2ASBA 4JI2C 2KZFA 2UXCC 1V26A 3AF6A 1MXBA 2F4VC 2CY1A 2V7BA 1YGTA 4DV6C 4LFAC 4FTFA 4BBYA 2OPLA 4JV5C 4L4QA 3CQ3A 1LCIA 1LQLA 4B3SC 1XRBA 2P20A 2ZZNA 2XR1A 1BA3A 3NI2A 1WH9A 5BSUA 2YWBA 2HHHC 1NYEA 3TUFA 4DR7C 2UXDC 4G37A 4YY3C 4D57A 2P2JA 4DR2C 2E5LC 2Z51A 3L95X 1MDFA 3N54B 1MKYA 4FUTA 4ODJA 3TR3A 5IWAC 1T5DX 4JYAC 5KYTA 3A9UA 2PROA 4WS9A 4DR4C 3CQ1A 4R0MA 2BJOA 4KTTA 5CZXA 4DV4C 1PG3A 3LNVA 3FM7A 3FCEA 2MM9A 5BURA 5BSVA 3G7SA 3N2QA 4DR5C 4DV7C 3NYRA 4LF6C 3LAXA 3H2TA 4U5YD 4DV3C 3LUSA 4PHTA 1ML8A 3J80D 4X65C 1J5EC 3KXWA 3TDEA 4JI1C 1GPMA 5AE3A 5KYVA 4DV5C 2CU6A 2VQEC 5GTDA 4NXNC 1TH5A 4ZJZA 3VNSA 1N2FA 2YX1A 4GKKC 4JI7C 2QL8A 3RG2A 4JI3C 5E7QA 4DUYC 4BSZA 2ZM6C 2PN2A 2ATWA 1ZB9A 2DHMA 1UKKA 2ZTBA 3VNQA 3T1YC 5CZVA 1JOSA 2JMPA 4L2ZA 1XRCA 4R1MA 1HNWC 3E7XA 3GR1A 4IR7A 4ZLPA 1V25A 2DYJA 5BSTA 4BC7A 3R44A 4TPSB 4JM1A 4YHHC 2KDNA 5BUSA 3AF5A 4RM3A 4NDNA 4K0KC 1WF3A 2ONFA 2MCQA 3CW9A 4LF5C 4RLFA 2WD9A 1P4EC 4L7IA 5K85A 2E0GA 1YJ7A 4LF4C 1UWDA 3IPLA 4X62C 2UUAC 4RVOA 5IT9D 4B3MC 3PROC 3DLPX 1HR0C 3A25A 3A4IA 3EERA 2P2FA 4D4IA 2PT7G 3S82A 4I9GA 4PUIA 3OTOC 1M6XC 4XX2A 3NPDA 4OXIA 3E7WA 5A1GA 4KTVA 3UOWA 2P2QA 2VSQA 3LNOA 1IBKC 1XNQC 2D1QA 1EGAA 3UX2A 4DCUA 3IEUA 4JI6C 4LF7C 5JRHA 4X64C 4JI8C 3RV2A 1FLOA 4DV2C 4HPVA 4JI0C 1USPA 2DPLA 4DCSA 5BSRA 5FLXD 4RVNA 3I07A 5H9UA 3C5EA 5AE2A 4BCAA 2QVZX 1IB8A 1XHJA 2E7GA 3SO4A 2OO4A 4RM2A 2YWCA 4GXRA 2BH1X 4PUGA 2Y27A 3NYQA 1ZB8A 2PG1E 2VQFC 1MDBA 2CXCA 4GS5A 5KEIA 5BSWA 4RMNA 3PBKA 1T5HX 1MXAA 3B7WA 2QVYX 1FJGC 2HJGA 2D1RA 4AQYC 1PG4A 3A26A 4OYCA 3L8CA 4LF9C 3K6RA 2NCLA 4B3TC 4DV0C 4DR1C 1N33C 1KKGA 3R9XA 3I08A 3ETOA 4PUHA 1VLAA 4JI5C 1N32C 3J81D 3AY0A 2P02A 4I9FA 2JNVA 3CQ2A 3GR0A 3A9VA 5T8SA 2ZZMA 4WV3A 4DUZC 3CW8X 2QW0X 2OPLB 1O93A 1HNZC 4DG8A 2KZ0A 2Y4NA 2P2MA 4MH4A 4DV1C 4X66C 5LMNC 2OBVA 3GKUA 1IBMC 4GXQA 1I94C 2D1TA 2UUBC 5BR8C 1NY8A 4PZPA 3R9WA 2E8FA 4FUQA 5DV9A 3UEBA 2QVXX 1HNXC 5K8FA 2M5OA 4LE5A 5A1IA 2AYAA 2VZEA 1PA4A 5T8TA 3VNRA 1XNRC 4EATA 2YCBA 4OX9C 4DG9A 3GPCA 1XMOC 4LFCC 2P2BA 4NXMC 1XRAA 2WP0C 3UX3A 5ADZA 4GKJC 1V60A 3TQIA 3JAMD 3DAYA 2EGTA 5BSMA 2D28C 1QWIA 4NOZA 1RY2A 1VEHA 2D27A 3O2EA 3UZ0A 1O92A 4LF8C 3ETCA 4MTNA 4G36A 1XDXA 4PROC 3FCCA 5AE1A 1L2FA 3PESA 4IZ6A 3J7AD 1M6XA 4JI4C 5BUQA 2M5HA 4RLQA 1MXCA 2D7VA 2UU9C 1N36C 1IBLC 4R1LA 4DR6C 1WCJA 1K0RA 2UXBC 1N34C 1MD9A 2UUCC 1XS3A 4DR3C
chains in the Genus database with same CATH topology
1USPB 2E8CA 4BC9A 3T1HC 4B3RC 4LFBC 2Y4OA 3CJEA 4ISBA 4G1IA 5A19A 5A2QD 4K0BA 4D56A 5LMUC 1O90A 3LGXA 1HH2P 4D4GA 3IMLA 4DCTA 1P7LA 1XMQC 1RG9A 3IEVA 1O9TA 1ULTA 2E8EA 1AMUA 5IFIA 3EQ6A 2D1SA 1QM4A 3DHVA 4DCVA 4KHPC 1FUGA 2ASBA 4JI2C 2KZFA 2UXCC 1V26A 3AF6A 1MXBA 2F4VC 2CY1A 2V7BA 4DV6C 4LFAC 4FTFA 4BBYA 2OPLA 4JV5C 4L4QA 1LCIA 1LQLA 4B3SC 1XRBA 2P20A 2XR1A 1BA3A 3NI2A 1WH9A 5BSUA 2YWBA 2HHHC 1NYEA 3TUFA 4DR7C 2UXDC 4G37A 4YY3C 4D57A 2P2JA 4DR2C 2E5LC 3L95X 1MDFA 3N54B 1MKYA 4FUTA 4ODJA 5IWAC 1T5DX 4JYAC 5KYTA 3A9UA 2PROA 4WS9A 4DR4C 4R0MA 2BJOA 4KTTA 5CZXA 4DV4C 1PG3A 3LNVA 3FCEA 5BURA 5BSVA 3G7SA 3N2QA 4DR5C 4DV7C 3NYRA 4LF6C 3LAXA 3H2TA 4U5YD 4DV3C 3LUSA 4PHTA 1ML8A 3J80D 4X65C 1J5EC 3KXWA 3TDEA 4JI1C 1GPMA 5AE3A 5KYVA 4DV5C 2VQEC 5GTDA 4NXNC 4ZJZA 3VNSA 1N2FA 4GKKC 4JI7C 2QL8A 3RG2A 4JI3C 5E7QA 4DUYC 4BSZA 2ZM6C 2PN2A 2ATWA 1ZB9A 1UKKA 3VNQA 3T1YC 5CZVA 1JOSA 2JMPA 4L2ZA 1XRCA 4R1MA 1HNWC 3E7XA 3GR1A 4IR7A 4ZLPA 1V25A 2DYJA 5BSTA 4BC7A 3R44A 4TPSB 4JM1A 4YHHC 5BUSA 3AF5A 4RM3A 4NDNA 4K0KC 1WF3A 2ONFA 3CW9A 4LF5C 4RLFA 2WD9A 4L7IA 5K85A 2E0GA 1YJ7A 4LF4C 3IPLA 4X62C 2UUAC 4RVOA 5IT9D 4B3MC 3PROC 3DLPX 1HR0C 3A4IA 3EERA 2P2FA 4D4IA 2PT7G 3S82A 4I9GA 3OTOC 4XX2A 3NPDA 4OXIA 3E7WA 5A1GA 4KTVA 3UOWA 2P2QA 2VSQA 1IBKC 1XNQC 2D1QA 1EGAA 4DCUA 3IEUA 4JI6C 4LF7C 5JRHA 4X64C 4JI8C 3RV2A 4DV2C 4HPVA 4JI0C 1USPA 2DPLA 4DCSA 5BSRA 5FLXD 4RVNA 3I07A 5H9UA 3C5EA 5AE2A 4BCAA 2QVZX 2E7GA 3SO4A 2OO4A 4RM2A 2YWCA 4GXRA 2BH1X 2Y27A 3NYQA 1ZB8A 2VQFC 1MDBA 2CXCA 4GS5A 5KEIA 5BSWA 4RMNA 3PBKA 1T5HX 1MXAA 3B7WA 2QVYX 1FJGC 2HJGA 2D1RA 4AQYC 1PG4A 4OYCA 3L8CA 4LF9C 4B3TC 4DV0C 4DR1C 1N33C 1KKGA 3R9XA 3I08A 3ETOA 1VLAA 4JI5C 1N32C 3J81D 2P02A 4I9FA 3GR0A 3A9VA 5T8SA 4WV3A 4DUZC 3CW8X 2QW0X 2OPLB 1O93A 1HNZC 4DG8A 2Y4NA 2P2MA 4MH4A 4DV1C 4X66C 5LMNC 2OBVA 3GKUA 1IBMC 4GXQA 1I94C 2D1TA 2UUBC 5BR8C 4PZPA 3R9WA 2E8FA 4FUQA 5DV9A 2QVXX 1HNXC 5K8FA 4LE5A 5A1IA 2AYAA 2VZEA 1PA4A 5T8TA 3VNRA 1XNRC 4EATA 2YCBA 4OX9C 4DG9A 3GPCA 1XMOC 4LFCC 2P2BA 4NXMC 1XRAA 2WP0C 5ADZA 4GKJC 3TQIA 3JAMD 3DAYA 2EGTA 5BSMA 2D28C 1QWIA 4NOZA 1RY2A 2D27A 3UZ0A 1O92A 4LF8C 3ETCA 4MTNA 4G36A 4PROC 3FCCA 5AE1A 1L2FA 3PESA 4IZ6A 3J7AD 4JI4C 5BUQA 4RLQA 1MXCA 2D7VA 2UU9C 1N36C 1IBLC 4R1LA 4DR6C 1K0RA 2UXBC 1N34C 1MD9A 2UUCC 4DR3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP B;  1HNZ C;  2E8C A;  1IBK C;  4DV4 C;  1XNQ C;  3T1H C;  4B3R C;  1EGA A;  4DCU A;  4LFB C;  4MH4 A;  3CJE A;  4DV1 C;  3IEU A;  4X66 C;  4DR5 C;  4DV7 C;  4JI6 C;  4LF7 C;  5LMN C;  4LF6 C;  5A2Q D;  4X64 C;  4JI8 C;  4DV3 C;  5LMU C;  3GKU A;  3LUS A;  4DV2 C;  1IBM C;  4JI0 C;  1USP A;  1ML8 A;  1I94 C;  4DCS A;  1HH2 P;  3J80 D;  2UUB C;  4X65 C;  5BR8 C;  1J5E C;  4DCT A;  4JI1 C;  5FLX D;  4DV5 C;  1XMQ C;  2VQE C;  3IEV A;  4NXN C;  2E8F A;  3R9W A;  3I07 A;  2E8E A;  1N2F A;  4GKK C;  4JI7 C;  2QL8 A;  1HNX C;  4JI3 C;  4DUY C;  4BSZ A;  2ZM6 C;  2PN2 A;  2ATW A;  4DCV A;  4KHP C;  1PA4 A;  1ZB9 A;  2E7G A;  2ASB A;  1XNR C;  4JI2 C;  2KZF A;  1UKK A;  2UXC C;  3AF6 A;  1ZB8 A;  2VQF C;  2YCB A;  4OX9 C;  2CXC A;  3T1Y C;  1JOS A;  2CY1 A;  2JMP A;  1XMO C;  4LFC C;  2F4V C;  4NXM C;  4GKJ C;  1HNW C;  3JAM D;  4DV6 C;  2EGT A;  4LFA C;  2OPL A;  4JV5 C;  2DYJ A;  1QWI A;  4NOZ A;  1FJG C;  1LQL A;  4B3S C;  2HJG A;  4YHH C;  4AQY C;  2XR1 A;  1WH9 A;  3AF5 A;  4LF8 C;  4K0K C;  2HHH C;  4MTN A;  1WF3 A;  1NYE A;  2ONF A;  2BJO A;  4LF5 C;  4LF9 C;  4DR7 C;  2UXD C;  4YY3 C;  1L2F A;  4B3T C;  3J7A D;  4DV0 C;  4JI4 C;  2E5L C;  4DR2 C;  4DR1 C;  1N33 C;  2D7V A;  4LF4 C;  1KKG A;  2UU9 C;  3R9X A;  4X62 C;  1VLA A;  2UUA C;  1N36 C;  5IT9 D;  1IBL C;  4B3M C;  4JI5 C;  4DR6 C;  3J81 D;  1HR0 C;  1N32 C;  3EER A;  1MKY A;  5IWA C;  2PT7 G;  1K0R A;  2UXB C;  4JYA C;  3OTO C;  1N34 C;  4XX2 A;  2UUC C;  4DR4 C;  4DR3 C;  4DUZ C;  2OPL B; 
#chains in the Genus database with same CATH topology
 1USP B;  2E8C A;  4BC9 A;  3T1H C;  4B3R C;  2MMA B;  4LFB C;  2Y4O A;  3CJE A;  4ISB A;  4G1I A;  5A19 A;  5A2Q D;  4K0B A;  1PU1 A;  4D56 A;  5LMU C;  5LCI A;  1O90 A;  3LGX A;  1HH2 P;  4D4G A;  3IML A;  4DCT A;  1P7L A;  1XMQ C;  1RG9 A;  3IEV A;  1O9T A;  1ULT A;  2E8E A;  1AMU A;  5IFI A;  3EQ6 A;  2D1S A;  1QM4 A;  1P4E A;  3DHV A;  4DCV A;  4KHP C;  1FUG A;  2ASB A;  4JI2 C;  2KZF A;  2UXC C;  1V26 A;  3AF6 A;  1MXB A;  2F4V C;  2CY1 A;  2V7B A;  1YGT A;  4DV6 C;  4LFA C;  4FTF A;  4BBY A;  2OPL A;  4JV5 C;  4L4Q A;  3CQ3 A;  1LCI A;  1LQL A;  4B3S C;  1XRB A;  2P20 A;  2ZZN A;  2XR1 A;  1BA3 A;  3NI2 A;  1WH9 A;  5BSU A;  2YWB A;  2HHH C;  1NYE A;  3TUF A;  4DR7 C;  2UXD C;  4G37 A;  4YY3 C;  4D57 A;  2P2J A;  4DR2 C;  2E5L C;  2Z51 A;  3L95 X;  1MDF A;  3N54 B;  1MKY A;  4FUT A;  4ODJ A;  3TR3 A;  5IWA C;  1T5D X;  4JYA C;  5KYT A;  3A9U A;  2PRO A;  4WS9 A;  4DR4 C;  3CQ1 A;  4R0M A;  2BJO A;  4KTT A;  5CZX A;  4DV4 C;  1PG3 A;  3LNV A;  3FM7 A;  3FCE A;  2MM9 A;  5BUR A;  5BSV A;  3G7S A;  3N2Q A;  4DR5 C;  4DV7 C;  3NYR A;  4LF6 C;  3LAX A;  3H2T A;  4U5Y D;  4DV3 C;  3LUS A;  4PHT A;  1ML8 A;  3J80 D;  4X65 C;  1J5E C;  3KXW A;  3TDE A;  4JI1 C;  1GPM A;  5AE3 A;  5KYV A;  4DV5 C;  2CU6 A;  2VQE C;  5GTD A;  4NXN C;  1TH5 A;  4ZJZ A;  3VNS A;  1N2F A;  2YX1 A;  4GKK C;  4JI7 C;  2QL8 A;  3RG2 A;  4JI3 C;  5E7Q A;  4DUY C;  4BSZ A;  2ZM6 C;  2PN2 A;  2ATW A;  1ZB9 A;  2DHM A;  1UKK A;  2ZTB A;  3VNQ A;  3T1Y C;  5CZV A;  1JOS A;  2JMP A;  4L2Z A;  1XRC A;  4R1M A;  1HNW C;  3E7X A;  3GR1 A;  4IR7 A;  4ZLP A;  1V25 A;  2DYJ A;  5BST A;  4BC7 A;  3R44 A;  4TPS B;  4JM1 A;  4YHH C;  2KDN A;  5BUS A;  3AF5 A;  4RM3 A;  4NDN A;  4K0K C;  1WF3 A;  2ONF A;  2MCQ A;  3CW9 A;  4LF5 C;  4RLF A;  2WD9 A;  1P4E C;  4L7I A;  5K85 A;  2E0G A;  1YJ7 A;  4LF4 C;  1UWD A;  3IPL A;  4X62 C;  2UUA C;  4RVO A;  5IT9 D;  4B3M C;  3PRO C;  3DLP X;  1HR0 C;  3A25 A;  3A4I A;  3EER A;  2P2F A;  4D4I A;  2PT7 G;  3S82 A;  4I9G A;  4PUI A;  3OTO C;  1M6X C;  4XX2 A;  3NPD A;  4OXI A;  3E7W A;  5A1G A;  4KTV A;  3UOW A;  2P2Q A;  2VSQ A;  3LNO A;  1IBK C;  1XNQ C;  2D1Q A;  1EGA A;  3UX2 A;  4DCU A;  3IEU A;  4JI6 C;  4LF7 C;  5JRH A;  4X64 C;  4JI8 C;  3RV2 A;  1FLO A;  4DV2 C;  4HPV A;  4JI0 C;  1USP A;  2DPL A;  4DCS A;  5BSR A;  5FLX D;  4RVN A;  3I07 A;  5H9U A;  3C5E A;  5AE2 A;  4BCA A;  2QVZ X;  1IB8 A;  1XHJ A;  2E7G A;  3SO4 A;  2OO4 A;  4RM2 A;  2YWC A;  4GXR A;  2BH1 X;  4PUG A;  2Y27 A;  3NYQ A;  1ZB8 A;  2PG1 E;  2VQF C;  1MDB A;  2CXC A;  4GS5 A;  5KEI A;  5BSW A;  4RMN A;  3PBK A;  1T5H X;  1MXA A;  3B7W A;  2QVY X;  1FJG C;  2HJG A;  2D1R A;  4AQY C;  1PG4 A;  3A26 A;  4OYC A;  3L8C A;  4LF9 C;  3K6R A;  2NCL A;  4B3T C;  4DV0 C;  4DR1 C;  1N33 C;  1KKG A;  3R9X A;  3I08 A;  3ETO A;  4PUH A;  1VLA A;  4JI5 C;  1N32 C;  3J81 D;  3AY0 A;  2P02 A;  4I9F A;  2JNV A;  3CQ2 A;  3GR0 A;  3A9V A;  5T8S A;  2ZZM A;  4WV3 A;  4DUZ C;  3CW8 X;  2QW0 X;  2OPL B;  1O93 A;  1HNZ C;  4DG8 A;  2KZ0 A;  2Y4N A;  2P2M A;  4MH4 A;  4DV1 C;  4X66 C;  5LMN C;  2OBV A;  3GKU A;  1IBM C;  4GXQ A;  1I94 C;  2D1T A;  2UUB C;  5BR8 C;  1NY8 A;  4PZP A;  3R9W A;  2E8F A;  4FUQ A;  5DV9 A;  3UEB A;  2QVX X;  1HNX C;  5K8F A;  2M5O A;  4LE5 A;  5A1I A;  2AYA A;  2VZE A;  1PA4 A;  5T8T A;  3VNR A;  1XNR C;  4EAT A;  2YCB A;  4OX9 C;  4DG9 A;  3GPC A;  1XMO C;  4LFC C;  2P2B A;  4NXM C;  1XRA A;  2WP0 C;  3UX3 A;  5ADZ A;  4GKJ C;  1V60 A;  3TQI A;  3JAM D;  3DAY A;  2EGT A;  5BSM A;  2D28 C;  1QWI A;  4NOZ A;  1RY2 A;  1VEH A;  2D27 A;  3O2E A;  3UZ0 A;  1O92 A;  4LF8 C;  3ETC A;  4MTN A;  4G36 A;  1XDX A;  4PRO C;  3FCC A;  5AE1 A;  1L2F A;  3PES A;  4IZ6 A;  3J7A D;  1M6X A;  4JI4 C;  5BUQ A;  2M5H A;  4RLQ A;  1MXC A;  2D7V A;  2UU9 C;  1N36 C;  1IBL C;  4R1L A;  4DR6 C;  1WCJ A;  1K0R A;  2UXB C;  1N34 C;  1MD9 A;  2UUC C;  1XS3 A;  4DR3 C; 
#chains in the Genus database with same CATH homology
 1USP B;  2E8C A;  4BC9 A;  3T1H C;  4B3R C;  4LFB C;  2Y4O A;  3CJE A;  4ISB A;  4G1I A;  5A19 A;  5A2Q D;  4K0B A;  4D56 A;  5LMU C;  1O90 A;  3LGX A;  1HH2 P;  4D4G A;  3IML A;  4DCT A;  1P7L A;  1XMQ C;  1RG9 A;  3IEV A;  1O9T A;  1ULT A;  2E8E A;  1AMU A;  5IFI A;  3EQ6 A;  2D1S A;  1QM4 A;  3DHV A;  4DCV A;  4KHP C;  1FUG A;  2ASB A;  4JI2 C;  2KZF A;  2UXC C;  1V26 A;  3AF6 A;  1MXB A;  2F4V C;  2CY1 A;  2V7B A;  4DV6 C;  4LFA C;  4FTF A;  4BBY A;  2OPL A;  4JV5 C;  4L4Q A;  1LCI A;  1LQL A;  4B3S C;  1XRB A;  2P20 A;  2XR1 A;  1BA3 A;  3NI2 A;  1WH9 A;  5BSU A;  2YWB A;  2HHH C;  1NYE A;  3TUF A;  4DR7 C;  2UXD C;  4G37 A;  4YY3 C;  4D57 A;  2P2J A;  4DR2 C;  2E5L C;  3L95 X;  1MDF A;  3N54 B;  1MKY A;  4FUT A;  4ODJ A;  5IWA C;  1T5D X;  4JYA C;  5KYT A;  3A9U A;  2PRO A;  4WS9 A;  4DR4 C;  4R0M A;  2BJO A;  4KTT A;  5CZX A;  4DV4 C;  1PG3 A;  3LNV A;  3FCE A;  5BUR A;  5BSV A;  3G7S A;  3N2Q A;  4DR5 C;  4DV7 C;  3NYR A;  4LF6 C;  3LAX A;  3H2T A;  4U5Y D;  4DV3 C;  3LUS A;  4PHT A;  1ML8 A;  3J80 D;  4X65 C;  1J5E C;  3KXW A;  3TDE A;  4JI1 C;  1GPM A;  5AE3 A;  5KYV A;  4DV5 C;  2VQE C;  5GTD A;  4NXN C;  4ZJZ A;  3VNS A;  1N2F A;  4GKK C;  4JI7 C;  2QL8 A;  3RG2 A;  4JI3 C;  5E7Q A;  4DUY C;  4BSZ A;  2ZM6 C;  2PN2 A;  2ATW A;  1ZB9 A;  1UKK A;  3VNQ A;  3T1Y C;  5CZV A;  1JOS A;  2JMP A;  4L2Z A;  1XRC A;  4R1M A;  1HNW C;  3E7X A;  3GR1 A;  4IR7 A;  4ZLP A;  1V25 A;  2DYJ A;  5BST A;  4BC7 A;  3R44 A;  4TPS B;  4JM1 A;  4YHH C;  5BUS A;  3AF5 A;  4RM3 A;  4NDN A;  4K0K C;  1WF3 A;  2ONF A;  3CW9 A;  4LF5 C;  4RLF A;  2WD9 A;  4L7I A;  5K85 A;  2E0G A;  1YJ7 A;  4LF4 C;  3IPL A;  4X62 C;  2UUA C;  4RVO A;  5IT9 D;  4B3M C;  3PRO C;  3DLP X;  1HR0 C;  3A4I A;  3EER A;  2P2F A;  4D4I A;  2PT7 G;  3S82 A;  4I9G A;  3OTO C;  4XX2 A;  3NPD A;  4OXI A;  3E7W A;  5A1G A;  4KTV A;  3UOW A;  2P2Q A;  2VSQ A;  1IBK C;  1XNQ C;  2D1Q A;  1EGA A;  4DCU A;  3IEU A;  4JI6 C;  4LF7 C;  5JRH A;  4X64 C;  4JI8 C;  3RV2 A;  4DV2 C;  4HPV A;  4JI0 C;  1USP A;  2DPL A;  4DCS A;  5BSR A;  5FLX D;  4RVN A;  3I07 A;  5H9U A;  3C5E A;  5AE2 A;  4BCA A;  2QVZ X;  2E7G A;  3SO4 A;  2OO4 A;  4RM2 A;  2YWC A;  4GXR A;  2BH1 X;  2Y27 A;  3NYQ A;  1ZB8 A;  2VQF C;  1MDB A;  2CXC A;  4GS5 A;  5KEI A;  5BSW A;  4RMN A;  3PBK A;  1T5H X;  1MXA A;  3B7W A;  2QVY X;  1FJG C;  2HJG A;  2D1R A;  4AQY C;  1PG4 A;  4OYC A;  3L8C A;  4LF9 C;  4B3T C;  4DV0 C;  4DR1 C;  1N33 C;  1KKG A;  3R9X A;  3I08 A;  3ETO A;  1VLA A;  4JI5 C;  1N32 C;  3J81 D;  2P02 A;  4I9F A;  3GR0 A;  3A9V A;  5T8S A;  4WV3 A;  4DUZ C;  3CW8 X;  2QW0 X;  2OPL B;  1O93 A;  1HNZ C;  4DG8 A;  2Y4N A;  2P2M A;  4MH4 A;  4DV1 C;  4X66 C;  5LMN C;  2OBV A;  3GKU A;  1IBM C;  4GXQ A;  1I94 C;  2D1T A;  2UUB C;  5BR8 C;  4PZP A;  3R9W A;  2E8F A;  4FUQ A;  5DV9 A;  2QVX X;  1HNX C;  5K8F A;  4LE5 A;  5A1I A;  2AYA A;  2VZE A;  1PA4 A;  5T8T A;  3VNR A;  1XNR C;  4EAT A;  2YCB A;  4OX9 C;  4DG9 A;  3GPC A;  1XMO C;  4LFC C;  2P2B A;  4NXM C;  1XRA A;  2WP0 C;  5ADZ A;  4GKJ C;  3TQI A;  3JAM D;  3DAY A;  2EGT A;  5BSM A;  2D28 C;  1QWI A;  4NOZ A;  1RY2 A;  2D27 A;  3UZ0 A;  1O92 A;  4LF8 C;  3ETC A;  4MTN A;  4G36 A;  4PRO C;  3FCC A;  5AE1 A;  1L2F A;  3PES A;  4IZ6 A;  3J7A D;  4JI4 C;  5BUQ A;  4RLQ A;  1MXC A;  2D7V A;  2UU9 C;  1N36 C;  1IBL C;  4R1L A;  4DR6 C;  1K0R A;  2UXB C;  1N34 C;  1MD9 A;  2UUC C;  4DR3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...