4KHPC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 47
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4khpC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4khpC02
4YY3C 4YHHC 4X65C 4GKJC 3J80D 2ATWA 4JI6C 1LQLA 4DR1C 4JI4C 4JYAC 1K0RA 1N2FA 2HHHC 4JI7C 4JI3C 4DV4C 2E8EA 5IWAC 5LMNC 4BSZA 2DYJA 4DV6C 4DR2C 2VQFC 1UKKA 4NOZA 4OX9C 4DV3C 1HNZC 1ZB9A 3J81D 1PA4A 1IBKC 4MH4A 4DUYC 1FJGC 2UUCC 4DUZC 1IBMC 4LF8C 3OTOC 1HNXC 1XNQC 4DCUA 4JI1C 4DR4C 1N32C 2PT7G 4JI0C 3LUSA 4DR6C 2KZFA 2EGTA 1NYEA 1N34C 1IBLC 1XNRC 4DR7C 4JV5C 5A2QD 2ONFA 4DCSA 4JI2C 3J7AD 1VLAA 2UXBC 5BR8C 4LFBC 1WH9A 4DV0C 3AF5A 1ZB8A 1HR0C 4B3TC 1HNWC 1EGAA 4LF9C 1N36C 2D7VA 5IT9D 2E5LC 2ASBA 2OPLB 4X64C 2BJOA 2VQEC 2UUAC 2OPLA 5FLXD 1WF3A 1USPA 1XMOC 2ZM6C 2PN2A 4DR5C 4LF7C 2CY1A 1J5EC 2E8CA 1JOSA 4DCVA 4MTNA 3AF6A 3T1YC 2QL8A 4DCTA 2UXDC 1MKYA 1L2FA 4JI5C 2UXCC 4JI8C 4DV1C 3GKUA 1ML8A 2HJGA 4B3SC 3R9XA 3R9WA 4LF5C 2F4VC 4B3MC 3I07A 4NXMC 3T1HC 4X66C 3JAMD 4DV5C 4K0KC 4X62C 4DR3C 2YCBA 4GKKC 4AQYC 2JMPA 1QWIA 3IEUA 4DV2C 1USPB 2XR1A 4B3RC 4XX2A 1N33C 5LMUC 1KKGA 1I94C 4NXNC 4LFAC 4LF4C 2UUBC 4LF6C 2E8FA 1XMQC 3IEVA 2E7GA 4KHPC 2CXCA 4LFCC 3CJEA 2UU9C 4DV7C 3EERA 1HH2P
chains in the Genus database with same CATH superfamily
4PUGA 4PHTA 4GKJC 3DHVA 2QW0X 4JI6C 2CU6A 1LQLA 4DR1C 3AY0A 5LMNC 1NY8A 1HNZC 3FCEA 3B7WA 5BUQA 2KZ0A 1FJGC 1RG9A 4RVNA 5BUSA 2WP0C 1M6XA 1HNXC 4K0BA 4DR4C 5BSUA 1XHJA 5K8FA 2KZFA 2EGTA 1IBLC 1N34C 1XNRC 3FM7A 2QVYX 4GXQA 4L2ZA 3GR1A 1AMUA 3J7AD 1VLAA 5BR8C 1RY2A 1O9TA 2YWCA 3NPDA 1WH9A 5JRHA 5A19A 1M6XC 4ZJZA 1P7LA 2E5LC 2DPLA 2VQEC 4I9FA 2D28C 5H9UA 5FLXD 3A4IA 2OO4A 2PN2A 1V25A 2CY1A 1J5EC 1BA3A 4RM2A 1FLOA 2UXCC 5ADZA 3DAYA 2YX1A 1ML8A 4RM3A 4TPSB 3R9XA 2AYAA 4DR3C 5AE3A 4DG9A 4JM1A 4AQYC 3TUFA 3NI2A 3TDEA 3R44A 1USPB 1KKGA 2P2JA 2DHMA 4PROC 2E8FA 3E7XA 1XMQC 2E7GA 2ZTBA 2UU9C 2E0GA 3C5EA 4BC9A 5A1IA 4YY3C 4G1IA 4JI7C 2HHHC 2VSQA 3PBKA 4JI3C 3K6RA 4KTTA 5CZVA 5IWAC 4LE5A 2DYJA 4WV3A 4BBYA 4DR2C 1UKKA 4DV3C 5BSVA 3DLPX 1ZB9A 2Y4NA 3J81D 1PA4A 3CQ3A 4RLFA 3UZ0A 1IBKC 4DUZC 1IBMC 3OTOC 3VNQA 1N32C 2MMAB 5T8TA 2D1RA 5A2QD 5BSRA 4DCSA 2ZZNA 2UXBC 4NDNA 3TQIA 3LGXA 1EGAA 2WD9A 2BH1X 1N36C 2P2QA 1MXBA 3LNVA 2UUAC 3EQ6A 3LAXA 4PUHA 3I08A 2ZM6C 4LF7C 2E8CA 3RV2A 1JOSA 3T1YC 3AF6A 1V26A 2QL8A 2HJGA 3S82A 4LF5C 4B3MC 3I07A 4NXMC 3T1HC 3GPCA 4BCAA 4X66C 4K0KC 2ZZMA 5KYVA 3FCCA 3CQ1A 1MDFA 3IEUA 2QVXX 4LFAC 2M5OA 2UUBC 4LF6C 1MD9A 4OXIA 4KHPC 5BSTA 4U5YD 2OBVA 4D56A 4ISBA 5T8SA 1WCJA 3J80D 2ATWA 3CW8X 1P4EA 5KEIA 3A25A 4JI4C 4JYAC 1K0RA 1N2FA 4DV4C 3UX3A 3L95X 1QM4A 5A1GA 4DV6C 4NOZA 4OX9C 1XRBA 4HPVA 2D1SA 4MH4A 1PU1A 3L8CA 4LF8C 1P4EC 1MXAA 1YJ7A 4JI0C 3IPLA 3PESA 1NYEA 3VNSA 4DR7C 4RLQA 2ONFA 2KDNA 4OYCA 4JI2C 3H2TA 4LFBC 2M5HA 4RVOA 1ULTA 4R1LA 4IR7A 5BURA 1ZB8A 1HR0C 4D57A 1HNWC 1FUGA 4FUTA 5IT9D 4G37A 1PG4A 2OPLB 4X64C 2OPLA 2V7BA 5CZXA 2P20A 1V60A 5E7QA 1WF3A 5KYTA 3CW9A 3SO4A 1GPMA 4DR5C 4MTNA 2UXDC 1MKYA 1L2FA 4JI8C 4DV1C 2P2MA 3GKUA 4B3SC 2F4VC 3LNOA 2P2BA 4ZLPA 3JAMD 4DV5C 1IB8A 2Y27A 3ETCA 4L7IA 1QWIA 1UWDA 3ETOA 4DV2C 1YGTA 1N33C 5LMUC 3UOWA 4LF4C 3NYRA 2P2FA 4L4QA 4KTVA 2MCQA 3UX2A 1O90A 2D1QA 4WS9A 3A9UA 4DV7C 3EERA 4NXNC 1HH2P 5DV9A 4DG8A 4YHHC 4RMNA 4X65C 1XS3A 3VNRA 2D27A 2E8EA 4BSZA 2QVZX 2VQFC 4G36A 1T5DX 2NCLA 3GR0A 5LCIA 1PG3A 2Z51A 2P02A 5K85A 5BSWA 4DUYC 2UUCC 3UEBA 1XNQC 4DCUA 3PROC 4JI1C 2PG1E 2PT7G 3LUSA 4DR6C 4PZPA 4R0MA 3A9VA 4JV5C 1TH5A 3NYQA 2D1TA 4D4IA 5BSMA 5IFIA 4GXRA 4DV0C 4PUIA 3AF5A 3IMLA 4B3TC 3CQ2A 4BC7A 4LF9C 5GTDA 1O92A 2D7VA 1VEHA 1MXCA 1O93A 2ASBA 2BJOA 3RG2A 2MM9A 3N2QA 2JNVA 4EATA 1USPA 1XMOC 2YWBA 3TR3A 2PROA 4DCVA 4R1MA 4DCTA 1XRCA 1T5HX 4JI5C 3O2EA 3N54B 4FUQA 3E7WA 1XRAA 3R9WA 3A26A 2Y4OA 3KXWA 5AE1A 4GS5A 4X62C 1MDBA 4IZ6A 2YCBA 4GKKC 2JMPA 5AE2A 2VZEA 2XR1A 3G7SA 1XDXA 4ODJA 4B3RC 4XX2A 1I94C 4FTFA 3IEVA 2CXCA 4LFCC 4D4GA 3CJEA 1LCIA 4I9GA
chains in the Genus database with same CATH topology
4PHTA 4GKJC 3DHVA 2QW0X 4JI6C 1LQLA 4DR1C 5LMNC 1HNZC 3FCEA 3B7WA 5BUQA 1FJGC 1RG9A 4RVNA 5BUSA 2WP0C 1HNXC 4K0BA 4DR4C 5BSUA 5K8FA 2KZFA 2EGTA 1IBLC 1N34C 1XNRC 2QVYX 4GXQA 4L2ZA 3GR1A 1AMUA 3J7AD 1VLAA 5BR8C 1RY2A 1O9TA 2YWCA 3NPDA 1WH9A 5JRHA 5A19A 4ZJZA 1P7LA 2E5LC 2DPLA 2VQEC 4I9FA 2D28C 5H9UA 5FLXD 3A4IA 2OO4A 2PN2A 1V25A 2CY1A 1J5EC 1BA3A 4RM2A 2UXCC 5ADZA 3DAYA 1ML8A 4RM3A 4TPSB 3R9XA 2AYAA 4DR3C 5AE3A 4DG9A 4JM1A 4AQYC 3TUFA 3NI2A 3TDEA 3R44A 1USPB 1KKGA 2P2JA 4PROC 2E8FA 3E7XA 1XMQC 2E7GA 2UU9C 2E0GA 3C5EA 4BC9A 5A1IA 4YY3C 4G1IA 4JI7C 2HHHC 2VSQA 3PBKA 4JI3C 4KTTA 5CZVA 5IWAC 4LE5A 2DYJA 4WV3A 4BBYA 4DR2C 1UKKA 4DV3C 5BSVA 3DLPX 1ZB9A 2Y4NA 3J81D 1PA4A 4RLFA 3UZ0A 1IBKC 4DUZC 1IBMC 3OTOC 3VNQA 1N32C 5T8TA 2D1RA 5A2QD 5BSRA 4DCSA 2UXBC 4NDNA 3TQIA 3LGXA 1EGAA 2WD9A 2BH1X 1N36C 2P2QA 1MXBA 3LNVA 2UUAC 3EQ6A 3LAXA 3I08A 2ZM6C 4LF7C 2E8CA 3RV2A 1JOSA 3T1YC 3AF6A 1V26A 2QL8A 2HJGA 3S82A 4LF5C 4B3MC 3I07A 4NXMC 3T1HC 3GPCA 4BCAA 4X66C 4K0KC 5KYVA 3FCCA 1MDFA 3IEUA 2QVXX 4LFAC 2UUBC 4LF6C 1MD9A 4OXIA 4KHPC 5BSTA 4U5YD 2OBVA 4D56A 4ISBA 5T8SA 3J80D 2ATWA 3CW8X 5KEIA 4JI4C 4JYAC 1K0RA 1N2FA 4DV4C 3L95X 1QM4A 5A1GA 4DV6C 4NOZA 4OX9C 1XRBA 4HPVA 2D1SA 4MH4A 3L8CA 4LF8C 1MXAA 1YJ7A 4JI0C 3IPLA 3PESA 1NYEA 3VNSA 4DR7C 4RLQA 2ONFA 4JI2C 4OYCA 3H2TA 4LFBC 4RVOA 1ULTA 4R1LA 4IR7A 5BURA 1ZB8A 1HR0C 4D57A 1HNWC 1FUGA 4FUTA 5IT9D 4G37A 1PG4A 2OPLB 4X64C 2OPLA 2V7BA 5CZXA 2P20A 5E7QA 1WF3A 5KYTA 3CW9A 3SO4A 1GPMA 4DR5C 4MTNA 2UXDC 1MKYA 1L2FA 4JI8C 4DV1C 2P2MA 3GKUA 4B3SC 2F4VC 2P2BA 4ZLPA 3JAMD 4DV5C 2Y27A 3ETCA 4L7IA 1QWIA 3ETOA 4DV2C 1N33C 5LMUC 3UOWA 4LF4C 3NYRA 2P2FA 4L4QA 4KTVA 1O90A 2D1QA 4WS9A 4DV7C 3A9UA 3EERA 4NXNC 1HH2P 5DV9A 4DG8A 4YHHC 4RMNA 4X65C 3VNRA 2D27A 2E8EA 4BSZA 2QVZX 2VQFC 4G36A 1T5DX 3GR0A 1PG3A 2P02A 5K85A 5BSWA 4DUYC 2UUCC 1XNQC 4DCUA 3PROC 4JI1C 2PT7G 3LUSA 4DR6C 4PZPA 4R0MA 3A9VA 4JV5C 3NYQA 2D1TA 4D4IA 5BSMA 5IFIA 4GXRA 4DV0C 3AF5A 3IMLA 4B3TC 4BC7A 4LF9C 5GTDA 1O92A 2D7VA 2ASBA 1MXCA 1O93A 2BJOA 3RG2A 3N2QA 4EATA 1USPA 1XMOC 2YWBA 2PROA 4DCVA 4R1MA 4DCTA 1XRCA 1T5HX 4JI5C 3N54B 4FUQA 3E7WA 1XRAA 3R9WA 2Y4OA 3KXWA 5AE1A 4GS5A 4X62C 1MDBA 4IZ6A 2YCBA 4GKKC 2JMPA 5AE2A 2VZEA 2XR1A 3G7SA 4ODJA 4B3RC 4XX2A 1I94C 4FTFA 3IEVA 2CXCA 4LFCC 4D4GA 3CJEA 1LCIA 4I9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 C;  4YHH C;  4X65 C;  4GKJ C;  3J80 D;  2ATW A;  4JI6 C;  1LQL A;  4DR1 C;  4JI4 C;  4JYA C;  1K0R A;  1N2F A;  2HHH C;  4JI7 C;  4JI3 C;  4DV4 C;  2E8E A;  5IWA C;  5LMN C;  4BSZ A;  2DYJ A;  4DV6 C;  4DR2 C;  2VQF C;  1UKK A;  4NOZ A;  4OX9 C;  4DV3 C;  1HNZ C;  1ZB9 A;  3J81 D;  1PA4 A;  1IBK C;  4MH4 A;  4DUY C;  1FJG C;  2UUC C;  4DUZ C;  1IBM C;  4LF8 C;  3OTO C;  1HNX C;  1XNQ C;  4DCU A;  4JI1 C;  4DR4 C;  1N32 C;  2PT7 G;  4JI0 C;  3LUS A;  4DR6 C;  2KZF A;  2EGT A;  1NYE A;  1N34 C;  1IBL C;  1XNR C;  4DR7 C;  4JV5 C;  5A2Q D;  2ONF A;  4DCS A;  4JI2 C;  3J7A D;  1VLA A;  2UXB C;  5BR8 C;  4LFB C;  1WH9 A;  4DV0 C;  3AF5 A;  1ZB8 A;  1HR0 C;  4B3T C;  1HNW C;  1EGA A;  4LF9 C;  1N36 C;  2D7V A;  5IT9 D;  2E5L C;  2ASB A;  2OPL B;  4X64 C;  2BJO A;  2VQE C;  2UUA C;  2OPL A;  5FLX D;  1WF3 A;  1USP A;  1XMO C;  2ZM6 C;  2PN2 A;  4DR5 C;  4LF7 C;  2CY1 A;  1J5E C;  2E8C A;  1JOS A;  4DCV A;  4MTN A;  3AF6 A;  3T1Y C;  2QL8 A;  4DCT A;  2UXD C;  1MKY A;  1L2F A;  4JI5 C;  2UXC C;  4JI8 C;  4DV1 C;  3GKU A;  1ML8 A;  2HJG A;  4B3S C;  3R9X A;  3R9W A;  4LF5 C;  2F4V C;  4B3M C;  3I07 A;  4NXM C;  3T1H C;  4X66 C;  3JAM D;  4DV5 C;  4K0K C;  4X62 C;  4DR3 C;  2YCB A;  4GKK C;  4AQY C;  2JMP A;  1QWI A;  3IEU A;  4DV2 C;  1USP B;  2XR1 A;  4B3R C;  4XX2 A;  1N33 C;  5LMU C;  1KKG A;  1I94 C;  4NXN C;  4LFA C;  4LF4 C;  2UUB C;  4LF6 C;  2E8F A;  1XMQ C;  3IEV A;  2E7G A;  4KHP C;  2CXC A;  4LFC C;  3CJE A;  2UU9 C;  4DV7 C;  3EER A;  1HH2 P; 
#chains in the Genus database with same CATH topology
 4PUG A;  4PHT A;  4GKJ C;  3DHV A;  2QW0 X;  4JI6 C;  2CU6 A;  1LQL A;  4DR1 C;  3AY0 A;  5LMN C;  1NY8 A;  1HNZ C;  3FCE A;  3B7W A;  5BUQ A;  2KZ0 A;  1FJG C;  1RG9 A;  4RVN A;  5BUS A;  2WP0 C;  1M6X A;  1HNX C;  4K0B A;  4DR4 C;  5BSU A;  1XHJ A;  5K8F A;  2KZF A;  2EGT A;  1IBL C;  1N34 C;  1XNR C;  3FM7 A;  2QVY X;  4GXQ A;  4L2Z A;  3GR1 A;  1AMU A;  3J7A D;  1VLA A;  5BR8 C;  1RY2 A;  1O9T A;  2YWC A;  3NPD A;  1WH9 A;  5JRH A;  5A19 A;  1M6X C;  4ZJZ A;  1P7L A;  2E5L C;  2DPL A;  2VQE C;  4I9F A;  2D28 C;  5H9U A;  5FLX D;  3A4I A;  2OO4 A;  2PN2 A;  1V25 A;  2CY1 A;  1J5E C;  1BA3 A;  4RM2 A;  1FLO A;  2UXC C;  5ADZ A;  3DAY A;  2YX1 A;  1ML8 A;  4RM3 A;  4TPS B;  3R9X A;  2AYA A;  4DR3 C;  5AE3 A;  4DG9 A;  4JM1 A;  4AQY C;  3TUF A;  3NI2 A;  3TDE A;  3R44 A;  1USP B;  1KKG A;  2P2J A;  2DHM A;  4PRO C;  2E8F A;  3E7X A;  1XMQ C;  2E7G A;  2ZTB A;  2UU9 C;  2E0G A;  3C5E A;  4BC9 A;  5A1I A;  4YY3 C;  4G1I A;  4JI7 C;  2HHH C;  2VSQ A;  3PBK A;  4JI3 C;  3K6R A;  4KTT A;  5CZV A;  5IWA C;  4LE5 A;  2DYJ A;  4WV3 A;  4BBY A;  4DR2 C;  1UKK A;  4DV3 C;  5BSV A;  3DLP X;  1ZB9 A;  2Y4N A;  3J81 D;  1PA4 A;  3CQ3 A;  4RLF A;  3UZ0 A;  1IBK C;  4DUZ C;  1IBM C;  3OTO C;  3VNQ A;  1N32 C;  2MMA B;  5T8T A;  2D1R A;  5A2Q D;  5BSR A;  4DCS A;  2ZZN A;  2UXB C;  4NDN A;  3TQI A;  3LGX A;  1EGA A;  2WD9 A;  2BH1 X;  1N36 C;  2P2Q A;  1MXB A;  3LNV A;  2UUA C;  3EQ6 A;  3LAX A;  4PUH A;  3I08 A;  2ZM6 C;  4LF7 C;  2E8C A;  3RV2 A;  1JOS A;  3T1Y C;  3AF6 A;  1V26 A;  2QL8 A;  2HJG A;  3S82 A;  4LF5 C;  4B3M C;  3I07 A;  4NXM C;  3T1H C;  3GPC A;  4BCA A;  4X66 C;  4K0K C;  2ZZM A;  5KYV A;  3FCC A;  3CQ1 A;  1MDF A;  3IEU A;  2QVX X;  4LFA C;  2M5O A;  2UUB C;  4LF6 C;  1MD9 A;  4OXI A;  4KHP C;  5BST A;  4U5Y D;  2OBV A;  4D56 A;  4ISB A;  5T8S A;  1WCJ A;  3J80 D;  2ATW A;  3CW8 X;  1P4E A;  5KEI A;  3A25 A;  4JI4 C;  4JYA C;  1K0R A;  1N2F A;  4DV4 C;  3UX3 A;  3L95 X;  1QM4 A;  5A1G A;  4DV6 C;  4NOZ A;  4OX9 C;  1XRB A;  4HPV A;  2D1S A;  4MH4 A;  1PU1 A;  3L8C A;  4LF8 C;  1P4E C;  1MXA A;  1YJ7 A;  4JI0 C;  3IPL A;  3PES A;  1NYE A;  3VNS A;  4DR7 C;  4RLQ A;  2ONF A;  2KDN A;  4OYC A;  4JI2 C;  3H2T A;  4LFB C;  2M5H A;  4RVO A;  1ULT A;  4R1L A;  4IR7 A;  5BUR A;  1ZB8 A;  1HR0 C;  4D57 A;  1HNW C;  1FUG A;  4FUT A;  5IT9 D;  4G37 A;  1PG4 A;  2OPL B;  4X64 C;  2OPL A;  2V7B A;  5CZX A;  2P20 A;  1V60 A;  5E7Q A;  1WF3 A;  5KYT A;  3CW9 A;  3SO4 A;  1GPM A;  4DR5 C;  4MTN A;  2UXD C;  1MKY A;  1L2F A;  4JI8 C;  4DV1 C;  2P2M A;  3GKU A;  4B3S C;  2F4V C;  3LNO A;  2P2B A;  4ZLP A;  3JAM D;  4DV5 C;  1IB8 A;  2Y27 A;  3ETC A;  4L7I A;  1QWI A;  1UWD A;  3ETO A;  4DV2 C;  1YGT A;  1N33 C;  5LMU C;  3UOW A;  4LF4 C;  3NYR A;  2P2F A;  4L4Q A;  4KTV A;  2MCQ A;  3UX2 A;  1O90 A;  2D1Q A;  4WS9 A;  3A9U A;  4DV7 C;  3EER A;  4NXN C;  1HH2 P;  5DV9 A;  4DG8 A;  4YHH C;  4RMN A;  4X65 C;  1XS3 A;  3VNR A;  2D27 A;  2E8E A;  4BSZ A;  2QVZ X;  2VQF C;  4G36 A;  1T5D X;  2NCL A;  3GR0 A;  5LCI A;  1PG3 A;  2Z51 A;  2P02 A;  5K85 A;  5BSW A;  4DUY C;  2UUC C;  3UEB A;  1XNQ C;  4DCU A;  3PRO C;  4JI1 C;  2PG1 E;  2PT7 G;  3LUS A;  4DR6 C;  4PZP A;  4R0M A;  3A9V A;  4JV5 C;  1TH5 A;  3NYQ A;  2D1T A;  4D4I A;  5BSM A;  5IFI A;  4GXR A;  4DV0 C;  4PUI A;  3AF5 A;  3IML A;  4B3T C;  3CQ2 A;  4BC7 A;  4LF9 C;  5GTD A;  1O92 A;  2D7V A;  1VEH A;  1MXC A;  1O93 A;  2ASB A;  2BJO A;  3RG2 A;  2MM9 A;  3N2Q A;  2JNV A;  4EAT A;  1USP A;  1XMO C;  2YWB A;  3TR3 A;  2PRO A;  4DCV A;  4R1M A;  4DCT A;  1XRC A;  1T5H X;  4JI5 C;  3O2E A;  3N54 B;  4FUQ A;  3E7W A;  1XRA A;  3R9W A;  3A26 A;  2Y4O A;  3KXW A;  5AE1 A;  4GS5 A;  4X62 C;  1MDB A;  4IZ6 A;  2YCB A;  4GKK C;  2JMP A;  5AE2 A;  2VZE A;  2XR1 A;  3G7S A;  1XDX A;  4ODJ A;  4B3R C;  4XX2 A;  1I94 C;  4FTF A;  3IEV A;  2CXC A;  4LFC C;  4D4G A;  3CJE A;  1LCI A;  4I9G A; 
#chains in the Genus database with same CATH homology
 4PHT A;  4GKJ C;  3DHV A;  2QW0 X;  4JI6 C;  1LQL A;  4DR1 C;  5LMN C;  1HNZ C;  3FCE A;  3B7W A;  5BUQ A;  1FJG C;  1RG9 A;  4RVN A;  5BUS A;  2WP0 C;  1HNX C;  4K0B A;  4DR4 C;  5BSU A;  5K8F A;  2KZF A;  2EGT A;  1IBL C;  1N34 C;  1XNR C;  2QVY X;  4GXQ A;  4L2Z A;  3GR1 A;  1AMU A;  3J7A D;  1VLA A;  5BR8 C;  1RY2 A;  1O9T A;  2YWC A;  3NPD A;  1WH9 A;  5JRH A;  5A19 A;  4ZJZ A;  1P7L A;  2E5L C;  2DPL A;  2VQE C;  4I9F A;  2D28 C;  5H9U A;  5FLX D;  3A4I A;  2OO4 A;  2PN2 A;  1V25 A;  2CY1 A;  1J5E C;  1BA3 A;  4RM2 A;  2UXC C;  5ADZ A;  3DAY A;  1ML8 A;  4RM3 A;  4TPS B;  3R9X A;  2AYA A;  4DR3 C;  5AE3 A;  4DG9 A;  4JM1 A;  4AQY C;  3TUF A;  3NI2 A;  3TDE A;  3R44 A;  1USP B;  1KKG A;  2P2J A;  4PRO C;  2E8F A;  3E7X A;  1XMQ C;  2E7G A;  2UU9 C;  2E0G A;  3C5E A;  4BC9 A;  5A1I A;  4YY3 C;  4G1I A;  4JI7 C;  2HHH C;  2VSQ A;  3PBK A;  4JI3 C;  4KTT A;  5CZV A;  5IWA C;  4LE5 A;  2DYJ A;  4WV3 A;  4BBY A;  4DR2 C;  1UKK A;  4DV3 C;  5BSV A;  3DLP X;  1ZB9 A;  2Y4N A;  3J81 D;  1PA4 A;  4RLF A;  3UZ0 A;  1IBK C;  4DUZ C;  1IBM C;  3OTO C;  3VNQ A;  1N32 C;  5T8T A;  2D1R A;  5A2Q D;  5BSR A;  4DCS A;  2UXB C;  4NDN A;  3TQI A;  3LGX A;  1EGA A;  2WD9 A;  2BH1 X;  1N36 C;  2P2Q A;  1MXB A;  3LNV A;  2UUA C;  3EQ6 A;  3LAX A;  3I08 A;  2ZM6 C;  4LF7 C;  2E8C A;  3RV2 A;  1JOS A;  3T1Y C;  3AF6 A;  1V26 A;  2QL8 A;  2HJG A;  3S82 A;  4LF5 C;  4B3M C;  3I07 A;  4NXM C;  3T1H C;  3GPC A;  4BCA A;  4X66 C;  4K0K C;  5KYV A;  3FCC A;  1MDF A;  3IEU A;  2QVX X;  4LFA C;  2UUB C;  4LF6 C;  1MD9 A;  4OXI A;  4KHP C;  5BST A;  4U5Y D;  2OBV A;  4D56 A;  4ISB A;  5T8S A;  3J80 D;  2ATW A;  3CW8 X;  5KEI A;  4JI4 C;  4JYA C;  1K0R A;  1N2F A;  4DV4 C;  3L95 X;  1QM4 A;  5A1G A;  4DV6 C;  4NOZ A;  4OX9 C;  1XRB A;  4HPV A;  2D1S A;  4MH4 A;  3L8C A;  4LF8 C;  1MXA A;  1YJ7 A;  4JI0 C;  3IPL A;  3PES A;  1NYE A;  3VNS A;  4DR7 C;  4RLQ A;  2ONF A;  4JI2 C;  4OYC A;  3H2T A;  4LFB C;  4RVO A;  1ULT A;  4R1L A;  4IR7 A;  5BUR A;  1ZB8 A;  1HR0 C;  4D57 A;  1HNW C;  1FUG A;  4FUT A;  5IT9 D;  4G37 A;  1PG4 A;  2OPL B;  4X64 C;  2OPL A;  2V7B A;  5CZX A;  2P20 A;  5E7Q A;  1WF3 A;  5KYT A;  3CW9 A;  3SO4 A;  1GPM A;  4DR5 C;  4MTN A;  2UXD C;  1MKY A;  1L2F A;  4JI8 C;  4DV1 C;  2P2M A;  3GKU A;  4B3S C;  2F4V C;  2P2B A;  4ZLP A;  3JAM D;  4DV5 C;  2Y27 A;  3ETC A;  4L7I A;  1QWI A;  3ETO A;  4DV2 C;  1N33 C;  5LMU C;  3UOW A;  4LF4 C;  3NYR A;  2P2F A;  4L4Q A;  4KTV A;  1O90 A;  2D1Q A;  4WS9 A;  4DV7 C;  3A9U A;  3EER A;  4NXN C;  1HH2 P;  5DV9 A;  4DG8 A;  4YHH C;  4RMN A;  4X65 C;  3VNR A;  2D27 A;  2E8E A;  4BSZ A;  2QVZ X;  2VQF C;  4G36 A;  1T5D X;  3GR0 A;  1PG3 A;  2P02 A;  5K85 A;  5BSW A;  4DUY C;  2UUC C;  1XNQ C;  4DCU A;  3PRO C;  4JI1 C;  2PT7 G;  3LUS A;  4DR6 C;  4PZP A;  4R0M A;  3A9V A;  4JV5 C;  3NYQ A;  2D1T A;  4D4I A;  5BSM A;  5IFI A;  4GXR A;  4DV0 C;  3AF5 A;  3IML A;  4B3T C;  4BC7 A;  4LF9 C;  5GTD A;  1O92 A;  2D7V A;  2ASB A;  1MXC A;  1O93 A;  2BJO A;  3RG2 A;  3N2Q A;  4EAT A;  1USP A;  1XMO C;  2YWB A;  2PRO A;  4DCV A;  4R1M A;  4DCT A;  1XRC A;  1T5H X;  4JI5 C;  3N54 B;  4FUQ A;  3E7W A;  1XRA A;  3R9W A;  2Y4O A;  3KXW A;  5AE1 A;  4GS5 A;  4X62 C;  1MDB A;  4IZ6 A;  2YCB A;  4GKK C;  2JMP A;  5AE2 A;  2VZE A;  2XR1 A;  3G7S A;  4ODJ A;  4B3R C;  4XX2 A;  1I94 C;  4FTF A;  3IEV A;  2CXC A;  4LFC C;  4D4G A;  3CJE A;  1LCI A;  4I9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...