4KHPC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
total genus 47
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4khpC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4khpC02
1VLAA 1ZB8A 3GKUA 2VQEC 4DUZC 3JAMD 2DYJA 2UXCC 1N33C 2UXDC 4JI0C 1QWIA 1WH9A 3T1YC 1LQLA 2VQFC 1IBMC 3CJEA 2OPLB 1MKYA 3AF6A 1USPA 2BJOA 4DV6C 4JI2C 2ASBA 2E8EA 4DV0C 2CXCA 4NXNC 4DV5C 1L2FA 4OX9C 1IBKC 3LUSA 4GKKC 4JI6C 1XNQC 4DR2C 4X65C 3IEUA 4DR1C 3J7AD 1XNRC 4B3TC 3IEVA 1KKGA 3EERA 4MH4A 4NOZA 4JI5C 1JOSA 4DV1C 1USPB 2UUAC 2PT7G 4JYAC 3R9XA 1N32C 3J81D 1UKKA 1FJGC 2D7VA 4MTNA 5IT9D 5BR8C 2UUCC 4LFCC 4YY3C 4DCTA 1XMQC 5A2QD 4DV4C 2ONFA 3AF5A 2XR1A 2YCBA 1I94C 1N2FA 4LF8C 4NXMC 2E5LC 4JI3C 4JI8C 5LMUC 3R9WA 2E8FA 1HH2P 2JMPA 4XX2A 1HNXC 2KZFA 4DCSA 4DR7C 5LMNC 4LF4C 4DV2C 4JI4C 4LF9C 4DR4C 4DR5C 1PA4A 1ML8A 3J80D 3T1HC 2HJGA 1IBLC 4GKJC 4LFBC 4YHHC 1N34C 2UUBC 1HNWC 4AQYC 2E8CA 4JI1C 4DR6C 1ZB9A 2EGTA 2UXBC 4LF5C 2ATWA 1HR0C 3OTOC 1HNZC 4K0KC 1K0RA 1NYEA 4DR3C 4X66C 4LFAC 4DV7C 4JV5C 1WF3A 2F4VC 2E7GA 4JI7C 5FLXD 4DCUA 2HHHC 1EGAA 4BSZA 2ZM6C 4KHPC 4B3RC 4DUYC 1XMOC 1J5EC 4LF6C 5IWAC 3I07A 2QL8A 4B3MC 4X62C 4X64C 2UU9C 4B3SC 2OPLA 2PN2A 2CY1A 1N36C 4DV3C 4DCVA 4LF7C
chains in the Genus database with same CATH superfamily
3LNVA 2D1TA 2P2JA 3GKUA 2VQEC 3KXWA 4JI0C 5E7QA 3T1YC 1BA3A 4G37A 1MDFA 2D1SA 2BH1X 4JI2C 4KTVA 4K0BA 4DV5C 4RLQA 1IBKC 3EQ6A 3N54B 3PBKA 3J7AD 4DR1C 2E0GA 1YJ7A 4G36A 5K85A 1FLOA 3K6RA 4RM2A 4NDNA 2MCQA 1YGTA 5BR8C 4LFCC 3VNRA 2ZZMA 1XMQC 3A26A 1I94C 1P7LA 4LF8C 4NXMC 4PUHA 4BC7A 5LMUC 2OO4A 1HNXC 2NCLA 4DCSA 4DR7C 5BSMA 4LF4C 4JI4C 4BC9A 4TPSB 4LFBC 4YHHC 4FUTA 5AE2A 4EATA 1N34C 5KYVA 2E8CA 1O90A 4GXQA 1ZB9A 3GR0A 2KZ0A 3R44A 1HR0C 3L95X 3OTOC 1PU1A 4DR3C 4DV7C 1GPMA 2D1RA 1WF3A 4JI7C 4D56A 5ADZA 4WV3A 1UWDA 3GR1A 2HHHC 3SO4A 1PG3A 2ZTBA 5KYTA 4DG9A 4LF6C 4BBYA 5IWAC 3PESA 4RVNA 4B3MC 2PG1E 2UU9C 5BSVA 2CY1A 2QW0X 1N36C 1PG4A 4LF7C 4RVOA 4IZ6A 4R1MA 1VLAA 3FCCA 2DYJA 2D28C 2M5HA 4RM3A 1IBMC 1MKYA 1USPA 3B7WA 1XHJA 1O9TA 5A1IA 4DV6C 4IR7A 4GXRA 3UX2A 3UOWA 1L2FA 4GKKC 4GS5A 1V60A 3DHVA 4DR2C 3IEUA 3LAXA 3IEVA 1KKGA 4D4GA 3EERA 2DPLA 1MXCA 3A25A 1JOSA 3CQ2A 2Y4OA 4DV1C 1USPB 5CZXA 3PROC 3TDEA 3L8CA 3R9XA 1ULTA 3IMLA 4DG8A 1FJGC 2D7VA 5IT9D 1O93A 4ISBA 2ONFA 4L2ZA 2XR1A 2P2QA 2E5LC 4JI3C 4JI8C 1VEHA 1HH2P 2JMPA 4D4IA 2Z51A 1V26A 2KZFA 2P2MA 5LMNC 5T8TA 3GPCA 2UUBC 3A4IA 4OXIA 4AQYC 4U5YD 2VSQA 1XRAA 5BSWA 3N2QA 2ZZNA 4K0KC 4WS9A 1NYEA 4ZLPA 4D57A 3DAYA 5H9UA 2JNVA 4ZJZA 1EGAA 4BSZA 5BUSA 2ZM6C 4L4QA 3UEBA 4R1LA 3LGXA 3A9UA 3CQ3A 2QL8A 2D1QA 5IFIA 2WP0C 4PZPA 4X62C 4X64C 2OPLA 2PN2A 1XDXA 2OBVA 1TH5A 1AMUA 3JAMD 3RV2A 1N33C 1V25A 4PUIA 4G1IA 1LQLA 4HPVA 3AF6A 2BJOA 4RMNA 2M5OA 2ASBA 2P2BA 2E8EA 2CXCA 4NXNC 5BURA 4JI6C 4X65C 1XNRC 3NI2A 1RG9A 2KDNA 4R0MA 1O92A 4MH4A 2AYAA 4JI5C 3LNOA 2PT7G 4JYAC 4LE5A 5LCIA 2CU6A 2QVXX 3J81D 2V7BA 1UKKA 1XRCA 4YY3C 4DCTA 5A2QD 1IB8A 3AF5A 2YCBA 1N2FA 1P4EC 3TUFA 2E8FA 4L7IA 3RG2A 3NYRA 2YWBA 2WD9A 5AE3A 4DV2C 1PA4A 1ML8A 3J80D 1IBLC 4GKJC 3E7XA 1NY8A 3E7WA 4DR6C 4JI1C 2EGTA 2ATWA 4KTTA 1HNZC 5BSTA 3I08A 5JRHA 1M6XC 3UZ0A 1T5DX 4BCAA 4ODJA 2F4VC 2Y27A 5A19A 1XS3A 5FLXD 2D27A 1MXAA 2P20A 3UX3A 4B3RC 4RLFA 2PROA 1J5EC 1MDBA 3I07A 1RY2A 3DLPX 4DV3C 1MD9A 2UXBC 5BSUA 1ZB8A 3FM7A 4DUZC 2UXDC 2DHMA 2UXCC 4PROC 1QWIA 1WH9A 1XRBA 2VQFC 3CJEA 2OPLB 3CQ1A 4JM1A 4DV0C 4OX9C 3LUSA 5K8FA 1XNQC 5BUQA 3ETOA 4B3TC 4OYCA 4NOZA 1M6XA 2MMAB 3C5EA 3AY0A 2UUAC 1WCJA 2VZEA 1FUGA 1N32C 5CZVA 3TR3A 2QVZX 4MTNA 2UUCC 2YX1A 1QM4A 4DV4C 1P4EA 5BSRA 3IPLA 4I9FA 3R9WA 4XX2A 5T8SA 3FCEA 2MM9A 2QVYX 4DR4C 4LF9C 4PUGA 2YWCA 3NYQA 4DR5C 5AE1A 3VNQA 2HJGA 3T1HC 3G7SA 1MXBA 1HNWC 3TQIA 4FTFA 5GTDA 4LF5C 3ETCA 5DV9A 3VNSA 5A1GA 2P02A 1K0RA 4X66C 4LFAC 4JV5C 2P2FA 3O2EA 2E7GA 5KEIA 3CW9A 4PHTA 4DCUA 1T5HX 1LCIA 4KHPC 4I9GA 4DUYC 1XMOC 3A9VA 3H2TA 3NPDA 2Y4NA 4B3SC 3CW8X 3S82A 4DCVA 4FUQA
chains in the Genus database with same CATH topology
3LNVA 2D1TA 2P2JA 3GKUA 2VQEC 3KXWA 4JI0C 5E7QA 3T1YC 1BA3A 4G37A 1MDFA 2D1SA 2BH1X 4JI2C 4KTVA 4K0BA 4DV5C 4RLQA 1IBKC 3EQ6A 3N54B 3PBKA 3J7AD 4DR1C 2E0GA 1YJ7A 4G36A 5K85A 4RM2A 4NDNA 5BR8C 4LFCC 3VNRA 1XMQC 1I94C 1P7LA 4LF8C 4NXMC 4BC7A 5LMUC 2OO4A 1HNXC 4DCSA 4DR7C 5BSMA 4LF4C 4JI4C 4BC9A 4TPSB 4LFBC 4YHHC 1N34C 4FUTA 4EATA 5AE2A 5KYVA 2E8CA 1O90A 4GXQA 1ZB9A 3GR0A 3R44A 1HR0C 3L95X 3OTOC 4DR3C 4DV7C 1GPMA 2D1RA 1WF3A 4JI7C 4D56A 5ADZA 4WV3A 3GR1A 2HHHC 3SO4A 1PG3A 5KYTA 4DG9A 4LF6C 4BBYA 5IWAC 3PESA 4RVNA 4B3MC 2UU9C 5BSVA 2CY1A 2QW0X 1N36C 4LF7C 1PG4A 4RVOA 4IZ6A 4R1MA 1VLAA 3FCCA 2DYJA 2D28C 4RM3A 1IBMC 1MKYA 1USPA 3B7WA 1O9TA 5A1IA 4DV6C 4IR7A 4GXRA 3UOWA 1L2FA 4GKKC 4GS5A 3DHVA 4DR2C 3IEUA 3LAXA 3IEVA 1KKGA 4D4GA 3EERA 2DPLA 1MXCA 1JOSA 4DV1C 2Y4OA 1USPB 5CZXA 3PROC 3TDEA 3L8CA 3R9XA 1ULTA 3IMLA 4DG8A 1FJGC 2D7VA 5IT9D 1O93A 4ISBA 2ONFA 4L2ZA 2XR1A 2P2QA 2E5LC 4JI3C 4JI8C 1HH2P 2JMPA 4D4IA 1V26A 2KZFA 2P2MA 5LMNC 5T8TA 3GPCA 2UUBC 3A4IA 4OXIA 4AQYC 4U5YD 2VSQA 1XRAA 5BSWA 3N2QA 4K0KC 4WS9A 1NYEA 4ZLPA 4D57A 3DAYA 5H9UA 4ZJZA 1EGAA 4BSZA 5BUSA 2ZM6C 4L4QA 4R1LA 3LGXA 3A9UA 2QL8A 2D1QA 5IFIA 2WP0C 4PZPA 4X62C 4X64C 2OPLA 2PN2A 2OBVA 1AMUA 3JAMD 3RV2A 1N33C 1V25A 4G1IA 1LQLA 4HPVA 3AF6A 2BJOA 4RMNA 2ASBA 2P2BA 2E8EA 2CXCA 4NXNC 5BURA 4JI6C 4X65C 1XNRC 3NI2A 1RG9A 4R0MA 1O92A 4MH4A 2AYAA 4JI5C 2PT7G 4JYAC 4LE5A 2QVXX 3J81D 2V7BA 1UKKA 1XRCA 4YY3C 4DCTA 5A2QD 3AF5A 2YCBA 1N2FA 3TUFA 2E8FA 4L7IA 3RG2A 3NYRA 2YWBA 2WD9A 5AE3A 4DV2C 1PA4A 1ML8A 3J80D 1IBLC 4GKJC 3E7XA 3E7WA 4DR6C 4JI1C 2EGTA 2ATWA 4KTTA 1HNZC 5BSTA 3I08A 5JRHA 3UZ0A 1T5DX 4BCAA 4ODJA 2F4VC 2Y27A 5A19A 2D27A 5FLXD 1MXAA 2P20A 4B3RC 4RLFA 2PROA 1J5EC 1MDBA 3I07A 1RY2A 3DLPX 4DV3C 1MD9A 2UXBC 5BSUA 1ZB8A 4DUZC 2UXDC 2UXCC 4PROC 1QWIA 1WH9A 1XRBA 2VQFC 3CJEA 2OPLB 4JM1A 4DV0C 4OX9C 3LUSA 5K8FA 1XNQC 5BUQA 3ETOA 4B3TC 4OYCA 4NOZA 3C5EA 2UUAC 2VZEA 1FUGA 1N32C 5CZVA 2QVZX 4MTNA 2UUCC 1QM4A 4DV4C 5BSRA 3IPLA 4I9FA 3R9WA 4XX2A 5T8SA 3FCEA 2QVYX 4DR4C 4LF9C 2YWCA 3NYQA 4DR5C 5AE1A 3VNQA 2HJGA 3T1HC 3G7SA 1MXBA 1HNWC 3TQIA 4FTFA 5GTDA 4LF5C 3ETCA 5DV9A 3VNSA 5A1GA 2P02A 1K0RA 4X66C 4LFAC 4JV5C 2P2FA 2E7GA 5KEIA 3CW9A 4PHTA 4DCUA 1T5HX 1LCIA 4KHPC 4I9GA 4DUYC 1XMOC 3A9VA 3H2TA 3NPDA 2Y4NA 4B3SC 3CW8X 3S82A 4DCVA 4FUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLA A;  1ZB8 A;  3GKU A;  2VQE C;  4DUZ C;  3JAM D;  2DYJ A;  2UXC C;  1N33 C;  2UXD C;  4JI0 C;  1QWI A;  1WH9 A;  3T1Y C;  1LQL A;  2VQF C;  1IBM C;  3CJE A;  2OPL B;  1MKY A;  3AF6 A;  1USP A;  2BJO A;  4DV6 C;  4JI2 C;  2ASB A;  2E8E A;  4DV0 C;  2CXC A;  4NXN C;  4DV5 C;  1L2F A;  4OX9 C;  1IBK C;  3LUS A;  4GKK C;  4JI6 C;  1XNQ C;  4DR2 C;  4X65 C;  3IEU A;  4DR1 C;  3J7A D;  1XNR C;  4B3T C;  3IEV A;  1KKG A;  3EER A;  4MH4 A;  4NOZ A;  4JI5 C;  1JOS A;  4DV1 C;  1USP B;  2UUA C;  2PT7 G;  4JYA C;  3R9X A;  1N32 C;  3J81 D;  1UKK A;  1FJG C;  2D7V A;  4MTN A;  5IT9 D;  5BR8 C;  2UUC C;  4LFC C;  4YY3 C;  4DCT A;  1XMQ C;  5A2Q D;  4DV4 C;  2ONF A;  3AF5 A;  2XR1 A;  2YCB A;  1I94 C;  1N2F A;  4LF8 C;  4NXM C;  2E5L C;  4JI3 C;  4JI8 C;  5LMU C;  3R9W A;  2E8F A;  1HH2 P;  2JMP A;  4XX2 A;  1HNX C;  2KZF A;  4DCS A;  4DR7 C;  5LMN C;  4LF4 C;  4DV2 C;  4JI4 C;  4LF9 C;  4DR4 C;  4DR5 C;  1PA4 A;  1ML8 A;  3J80 D;  3T1H C;  2HJG A;  1IBL C;  4GKJ C;  4LFB C;  4YHH C;  1N34 C;  2UUB C;  1HNW C;  4AQY C;  2E8C A;  4JI1 C;  4DR6 C;  1ZB9 A;  2EGT A;  2UXB C;  4LF5 C;  2ATW A;  1HR0 C;  3OTO C;  1HNZ C;  4K0K C;  1K0R A;  1NYE A;  4DR3 C;  4X66 C;  4LFA C;  4DV7 C;  4JV5 C;  1WF3 A;  2F4V C;  2E7G A;  4JI7 C;  5FLX D;  4DCU A;  2HHH C;  1EGA A;  4BSZ A;  2ZM6 C;  4KHP C;  4B3R C;  4DUY C;  1XMO C;  1J5E C;  4LF6 C;  5IWA C;  3I07 A;  2QL8 A;  4B3M C;  4X62 C;  4X64 C;  2UU9 C;  4B3S C;  2OPL A;  2PN2 A;  2CY1 A;  1N36 C;  4DV3 C;  4DCV A;  4LF7 C; 
#chains in the Genus database with same CATH topology
 3LNV A;  2D1T A;  2P2J A;  3GKU A;  2VQE C;  3KXW A;  4JI0 C;  5E7Q A;  3T1Y C;  1BA3 A;  4G37 A;  1MDF A;  2D1S A;  2BH1 X;  4JI2 C;  4KTV A;  4K0B A;  4DV5 C;  4RLQ A;  1IBK C;  3EQ6 A;  3N54 B;  3PBK A;  3J7A D;  4DR1 C;  2E0G A;  1YJ7 A;  4G36 A;  5K85 A;  1FLO A;  3K6R A;  4RM2 A;  4NDN A;  2MCQ A;  1YGT A;  5BR8 C;  4LFC C;  3VNR A;  2ZZM A;  1XMQ C;  3A26 A;  1I94 C;  1P7L A;  4LF8 C;  4NXM C;  4PUH A;  4BC7 A;  5LMU C;  2OO4 A;  1HNX C;  2NCL A;  4DCS A;  4DR7 C;  5BSM A;  4LF4 C;  4JI4 C;  4BC9 A;  4TPS B;  4LFB C;  4YHH C;  4FUT A;  5AE2 A;  4EAT A;  1N34 C;  5KYV A;  2E8C A;  1O90 A;  4GXQ A;  1ZB9 A;  3GR0 A;  2KZ0 A;  3R44 A;  1HR0 C;  3L95 X;  3OTO C;  1PU1 A;  4DR3 C;  4DV7 C;  1GPM A;  2D1R A;  1WF3 A;  4JI7 C;  4D56 A;  5ADZ A;  4WV3 A;  1UWD A;  3GR1 A;  2HHH C;  3SO4 A;  1PG3 A;  2ZTB A;  5KYT A;  4DG9 A;  4LF6 C;  4BBY A;  5IWA C;  3PES A;  4RVN A;  4B3M C;  2PG1 E;  2UU9 C;  5BSV A;  2CY1 A;  2QW0 X;  1N36 C;  1PG4 A;  4LF7 C;  4RVO A;  4IZ6 A;  4R1M A;  1VLA A;  3FCC A;  2DYJ A;  2D28 C;  2M5H A;  4RM3 A;  1IBM C;  1MKY A;  1USP A;  3B7W A;  1XHJ A;  1O9T A;  5A1I A;  4DV6 C;  4IR7 A;  4GXR A;  3UX2 A;  3UOW A;  1L2F A;  4GKK C;  4GS5 A;  1V60 A;  3DHV A;  4DR2 C;  3IEU A;  3LAX A;  3IEV A;  1KKG A;  4D4G A;  3EER A;  2DPL A;  1MXC A;  3A25 A;  1JOS A;  3CQ2 A;  2Y4O A;  4DV1 C;  1USP B;  5CZX A;  3PRO C;  3TDE A;  3L8C A;  3R9X A;  1ULT A;  3IML A;  4DG8 A;  1FJG C;  2D7V A;  5IT9 D;  1O93 A;  4ISB A;  2ONF A;  4L2Z A;  2XR1 A;  2P2Q A;  2E5L C;  4JI3 C;  4JI8 C;  1VEH A;  1HH2 P;  2JMP A;  4D4I A;  2Z51 A;  1V26 A;  2KZF A;  2P2M A;  5LMN C;  5T8T A;  3GPC A;  2UUB C;  3A4I A;  4OXI A;  4AQY C;  4U5Y D;  2VSQ A;  1XRA A;  5BSW A;  3N2Q A;  2ZZN A;  4K0K C;  4WS9 A;  1NYE A;  4ZLP A;  4D57 A;  3DAY A;  5H9U A;  2JNV A;  4ZJZ A;  1EGA A;  4BSZ A;  5BUS A;  2ZM6 C;  4L4Q A;  3UEB A;  4R1L A;  3LGX A;  3A9U A;  3CQ3 A;  2QL8 A;  2D1Q A;  5IFI A;  2WP0 C;  4PZP A;  4X62 C;  4X64 C;  2OPL A;  2PN2 A;  1XDX A;  2OBV A;  1TH5 A;  1AMU A;  3JAM D;  3RV2 A;  1N33 C;  1V25 A;  4PUI A;  4G1I A;  1LQL A;  4HPV A;  3AF6 A;  2BJO A;  4RMN A;  2M5O A;  2ASB A;  2P2B A;  2E8E A;  2CXC A;  4NXN C;  5BUR A;  4JI6 C;  4X65 C;  1XNR C;  3NI2 A;  1RG9 A;  2KDN A;  4R0M A;  1O92 A;  4MH4 A;  2AYA A;  4JI5 C;  3LNO A;  2PT7 G;  4JYA C;  4LE5 A;  5LCI A;  2CU6 A;  2QVX X;  3J81 D;  2V7B A;  1UKK A;  1XRC A;  4YY3 C;  4DCT A;  5A2Q D;  1IB8 A;  3AF5 A;  2YCB A;  1N2F A;  1P4E C;  3TUF A;  2E8F A;  4L7I A;  3RG2 A;  3NYR A;  2YWB A;  2WD9 A;  5AE3 A;  4DV2 C;  1PA4 A;  1ML8 A;  3J80 D;  1IBL C;  4GKJ C;  3E7X A;  1NY8 A;  3E7W A;  4DR6 C;  4JI1 C;  2EGT A;  2ATW A;  4KTT A;  1HNZ C;  5BST A;  3I08 A;  5JRH A;  1M6X C;  3UZ0 A;  1T5D X;  4BCA A;  4ODJ A;  2F4V C;  2Y27 A;  5A19 A;  1XS3 A;  5FLX D;  2D27 A;  1MXA A;  2P20 A;  3UX3 A;  4B3R C;  4RLF A;  2PRO A;  1J5E C;  1MDB A;  3I07 A;  1RY2 A;  3DLP X;  4DV3 C;  1MD9 A;  2UXB C;  5BSU A;  1ZB8 A;  3FM7 A;  4DUZ C;  2UXD C;  2DHM A;  2UXC C;  4PRO C;  1QWI A;  1WH9 A;  1XRB A;  2VQF C;  3CJE A;  2OPL B;  3CQ1 A;  4JM1 A;  4DV0 C;  4OX9 C;  3LUS A;  5K8F A;  1XNQ C;  5BUQ A;  3ETO A;  4B3T C;  4OYC A;  4NOZ A;  1M6X A;  2MMA B;  3C5E A;  3AY0 A;  2UUA C;  1WCJ A;  2VZE A;  1FUG A;  1N32 C;  5CZV A;  3TR3 A;  2QVZ X;  4MTN A;  2UUC C;  2YX1 A;  1QM4 A;  4DV4 C;  1P4E A;  5BSR A;  3IPL A;  4I9F A;  3R9W A;  4XX2 A;  5T8S A;  3FCE A;  2MM9 A;  2QVY X;  4DR4 C;  4LF9 C;  4PUG A;  2YWC A;  3NYQ A;  4DR5 C;  5AE1 A;  3VNQ A;  2HJG A;  3T1H C;  3G7S A;  1MXB A;  1HNW C;  3TQI A;  4FTF A;  5GTD A;  4LF5 C;  3ETC A;  5DV9 A;  3VNS A;  5A1G A;  2P02 A;  1K0R A;  4X66 C;  4LFA C;  4JV5 C;  2P2F A;  3O2E A;  2E7G A;  5KEI A;  3CW9 A;  4PHT A;  4DCU A;  1T5H X;  1LCI A;  4KHP C;  4I9G A;  4DUY C;  1XMO C;  3A9V A;  3H2T A;  3NPD A;  2Y4N A;  4B3S C;  3CW8 X;  3S82 A;  4DCV A;  4FUQ A; 
#chains in the Genus database with same CATH homology
 3LNV A;  2D1T A;  2P2J A;  3GKU A;  2VQE C;  3KXW A;  4JI0 C;  5E7Q A;  3T1Y C;  1BA3 A;  4G37 A;  1MDF A;  2D1S A;  2BH1 X;  4JI2 C;  4KTV A;  4K0B A;  4DV5 C;  4RLQ A;  1IBK C;  3EQ6 A;  3N54 B;  3PBK A;  3J7A D;  4DR1 C;  2E0G A;  1YJ7 A;  4G36 A;  5K85 A;  4RM2 A;  4NDN A;  5BR8 C;  4LFC C;  3VNR A;  1XMQ C;  1I94 C;  1P7L A;  4LF8 C;  4NXM C;  4BC7 A;  5LMU C;  2OO4 A;  1HNX C;  4DCS A;  4DR7 C;  5BSM A;  4LF4 C;  4JI4 C;  4BC9 A;  4TPS B;  4LFB C;  4YHH C;  1N34 C;  4FUT A;  4EAT A;  5AE2 A;  5KYV A;  2E8C A;  1O90 A;  4GXQ A;  1ZB9 A;  3GR0 A;  3R44 A;  1HR0 C;  3L95 X;  3OTO C;  4DR3 C;  4DV7 C;  1GPM A;  2D1R A;  1WF3 A;  4JI7 C;  4D56 A;  5ADZ A;  4WV3 A;  3GR1 A;  2HHH C;  3SO4 A;  1PG3 A;  5KYT A;  4DG9 A;  4LF6 C;  4BBY A;  5IWA C;  3PES A;  4RVN A;  4B3M C;  2UU9 C;  5BSV A;  2CY1 A;  2QW0 X;  1N36 C;  4LF7 C;  1PG4 A;  4RVO A;  4IZ6 A;  4R1M A;  1VLA A;  3FCC A;  2DYJ A;  2D28 C;  4RM3 A;  1IBM C;  1MKY A;  1USP A;  3B7W A;  1O9T A;  5A1I A;  4DV6 C;  4IR7 A;  4GXR A;  3UOW A;  1L2F A;  4GKK C;  4GS5 A;  3DHV A;  4DR2 C;  3IEU A;  3LAX A;  3IEV A;  1KKG A;  4D4G A;  3EER A;  2DPL A;  1MXC A;  1JOS A;  4DV1 C;  2Y4O A;  1USP B;  5CZX A;  3PRO C;  3TDE A;  3L8C A;  3R9X A;  1ULT A;  3IML A;  4DG8 A;  1FJG C;  2D7V A;  5IT9 D;  1O93 A;  4ISB A;  2ONF A;  4L2Z A;  2XR1 A;  2P2Q A;  2E5L C;  4JI3 C;  4JI8 C;  1HH2 P;  2JMP A;  4D4I A;  1V26 A;  2KZF A;  2P2M A;  5LMN C;  5T8T A;  3GPC A;  2UUB C;  3A4I A;  4OXI A;  4AQY C;  4U5Y D;  2VSQ A;  1XRA A;  5BSW A;  3N2Q A;  4K0K C;  4WS9 A;  1NYE A;  4ZLP A;  4D57 A;  3DAY A;  5H9U A;  4ZJZ A;  1EGA A;  4BSZ A;  5BUS A;  2ZM6 C;  4L4Q A;  4R1L A;  3LGX A;  3A9U A;  2QL8 A;  2D1Q A;  5IFI A;  2WP0 C;  4PZP A;  4X62 C;  4X64 C;  2OPL A;  2PN2 A;  2OBV A;  1AMU A;  3JAM D;  3RV2 A;  1N33 C;  1V25 A;  4G1I A;  1LQL A;  4HPV A;  3AF6 A;  2BJO A;  4RMN A;  2ASB A;  2P2B A;  2E8E A;  2CXC A;  4NXN C;  5BUR A;  4JI6 C;  4X65 C;  1XNR C;  3NI2 A;  1RG9 A;  4R0M A;  1O92 A;  4MH4 A;  2AYA A;  4JI5 C;  2PT7 G;  4JYA C;  4LE5 A;  2QVX X;  3J81 D;  2V7B A;  1UKK A;  1XRC A;  4YY3 C;  4DCT A;  5A2Q D;  3AF5 A;  2YCB A;  1N2F A;  3TUF A;  2E8F A;  4L7I A;  3RG2 A;  3NYR A;  2YWB A;  2WD9 A;  5AE3 A;  4DV2 C;  1PA4 A;  1ML8 A;  3J80 D;  1IBL C;  4GKJ C;  3E7X A;  3E7W A;  4DR6 C;  4JI1 C;  2EGT A;  2ATW A;  4KTT A;  1HNZ C;  5BST A;  3I08 A;  5JRH A;  3UZ0 A;  1T5D X;  4BCA A;  4ODJ A;  2F4V C;  2Y27 A;  5A19 A;  2D27 A;  5FLX D;  1MXA A;  2P20 A;  4B3R C;  4RLF A;  2PRO A;  1J5E C;  1MDB A;  3I07 A;  1RY2 A;  3DLP X;  4DV3 C;  1MD9 A;  2UXB C;  5BSU A;  1ZB8 A;  4DUZ C;  2UXD C;  2UXC C;  4PRO C;  1QWI A;  1WH9 A;  1XRB A;  2VQF C;  3CJE A;  2OPL B;  4JM1 A;  4DV0 C;  4OX9 C;  3LUS A;  5K8F A;  1XNQ C;  5BUQ A;  3ETO A;  4B3T C;  4OYC A;  4NOZ A;  3C5E A;  2UUA C;  2VZE A;  1FUG A;  1N32 C;  5CZV A;  2QVZ X;  4MTN A;  2UUC C;  1QM4 A;  4DV4 C;  5BSR A;  3IPL A;  4I9F A;  3R9W A;  4XX2 A;  5T8S A;  3FCE A;  2QVY X;  4DR4 C;  4LF9 C;  2YWC A;  3NYQ A;  4DR5 C;  5AE1 A;  3VNQ A;  2HJG A;  3T1H C;  3G7S A;  1MXB A;  1HNW C;  3TQI A;  4FTF A;  5GTD A;  4LF5 C;  3ETC A;  5DV9 A;  3VNS A;  5A1G A;  2P02 A;  1K0R A;  4X66 C;  4LFA C;  4JV5 C;  2P2F A;  2E7G A;  5KEI A;  3CW9 A;  4PHT A;  4DCU A;  1T5H X;  1LCI A;  4KHP C;  4I9G A;  4DUY C;  1XMO C;  3A9V A;  3H2T A;  3NPD A;  2Y4N A;  4B3S C;  3CW8 X;  3S82 A;  4DCV A;  4FUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...