1N34C

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1n34C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1n34C02
4DR3C 4K0KC 4AQYC 2F4VC 1ZB9A 2KZFA 1N36C 2QL8A 4JI6C 1KKGA 2HJGA 4DR7C 4JYAC 3IEUA 1N2FA 3EERA 3J81D 4JI7C 2CY1A 1FJGC 2UUBC 4DV2C 4KHPC 4LF5C 4DV3C 2DYJA 4GKJC 1L2FA 3AF5A 4X64C 2ATWA 5LMNC 1JOSA 4BSZA 5FLXD 4JI4C 4YY3C 2E7GA 4X66C 4LF9C 1VLAA 1EGAA 4LFCC 2EGTA 1LQLA 4DV4C 1MKYA 4DV1C 4DV5C 1I94C 4LF8C 4DR5C 4DV7C 3IEVA 1XNQC 4GKKC 2UU9C 4B3RC 3AF6A 1IBMC 1N34C 1WF3A 4DCSA 4DR6C 2D7VA 4DR2C 4DCTA 2UUCC 4MH4A 2OPLB 3R9WA 1N32C 3I07A 4DR1C 2YCBA 1PA4A 2UXBC 3CJEA 4B3TC 2JMPA 2PT7G 2UXDC 1USPB 4DUZC 3T1HC 4JI8C 4XX2A 1J5EC 2ZM6C 1XMQC 1IBKC 4JI1C 4LF4C 2BJOA 4DV6C 3J7AD 3LUSA 1HNWC 4DUYC 2PN2A 4B3SC 1HNZC 4NOZA 4JV5C 4JI2C 1USPA 2E5LC 4LFAC 4JI3C 1XNRC 3R9XA 1UKKA 4DV0C 3T1YC 3OTOC 1ML8A 5IT9D 1WH9A 3GKUA 4X62C 1N33C 1XMOC 4NXNC 4DCVA 2UUAC 2CXCA 5A2QD 1K0RA 2VQEC 4NXMC 4LF7C 5LMUC 4JI0C 1HR0C 1HH2P 4OX9C 2E8CA 4LFBC 2OPLA 3J80D 4MTNA 2VQFC 1QWIA 1NYEA 2XR1A 4DCUA 1IBLC 4B3MC 4JI5C 1ZB8A 3JAMD 2E8EA 4LF6C 2E8FA 1HNXC 2ONFA 5BR8C 4X65C 2UXCC 2ASBA 2HHHC 4DR4C 5IWAC 4YHHC
chains in the Genus database with same CATH superfamily
4K0KC 4G1IA 3A9VA 3E7XA 2QL8A 1FLOA 4DR7C 2JNVA 3CQ3A 2P02A 3H2TA 4DV3C 3O2EA 2ATWA 5LMNC 1P4EC 3LNOA 1V25A 4X66C 2AYAA 3E7WA 3CQ1A 3RG2A 2QW0X 2P2QA 2DPLA 4DV5C 4RVNA 4LF8C 4DR5C 1PG4A 4DV7C 1P4EA 3IEVA 3VNSA 1XNQC 5A19A 5AE1A 1XS3A 3S82A 2QVXX 4DR2C 1ULTA 5DV9A 3IMLA 3UX2A 5T8TA 4BC7A 2MM9A 3T1HC 1J5EC 3PESA 2P20A 3J7AD 4FTFA 1XRAA 2YWBA 3PBKA 3NPDA 2QVZX 1HNZC 4D4GA 3ETCA 2E5LC 4LFAC 3GR0A 1MXBA 3T1YC 5IT9D 1WH9A 3GKUA 3L95X 2E0GA 4ZLPA 1P7LA 4NDNA 2Z51A 4NXMC 3A9UA 3EQ6A 4LF7C 2V7BA 4RLFA 3J80D 2Y27A 4D4IA 4MTNA 2ZZMA 1NYEA 3A26A 4DCUA 4IZ6A 4PUGA 4L4QA 3JAMD 2PROA 3VNQA 2NCLA 4X65C 2UXCC 4GXRA 2YX1A 4YHHC 5E7QA 3SO4A 4R1MA 3NYQA 4R1LA 1ZB9A 4JI6C 5KYVA 3PROC 2HJGA 5A1GA 3TUFA 1N2FA 2MMAB 1LCIA 3RV2A 4PUHA 4JI7C 3IPLA 2CY1A 1NY8A 1FJGC 2UUBC 2VZEA 1RY2A 1T5DX 2DYJA 4L2ZA 2D1SA 3DHVA 4PHTA 2Y4OA 4LF9C 1EGAA 2YWCA 3CW9A 4D56A 2EGTA 4L7IA 2P2FA 4JM1A 4GKKC 3UX3A 4B3RC 2P2MA 1PU1A 3ETOA 3FCCA 3DLPX 3GPCA 4I9GA 4LE5A 1MXCA 2D1QA 2VSQA 3I07A 4PUIA 3TR3A 1PA4A 4B3TC 2UXDC 2PT7G 3DAYA 4DUZC 4BBYA 4XX2A 1XMQC 1IBKC 4DG8A 1RG9A 5AE2A 4DUYC 3N2QA 2CU6A 4B3SC 1XRBA 4HPVA 5BSVA 4JI2C 1XNRC 1O93A 1UKKA 2QVYX 4BC9A 2OBVA 3LNVA 1XMOC 4NXNC 4RM2A 2CXCA 1AMUA 5A2QD 4KTVA 4LFBC 2OPLA 1XHJA 4B3MC 1O92A 4I9FA 4ZJZA 4BCAA 4K0BA 1ZB8A 3NYRA 2E8EA 2E8FA 5BR8C 5GTDA 2D7VA 4D57A 4AQYC 3GR1A 1N36C 4FUTA 1MXAA 2D27A 4GS5A 4WS9A 2OO4A 2KDNA 3IEUA 4OYCA 3J81D 1M6XA 5BSWA 4DV2C 4KHPC 4LF5C 3KXWA 4GKJC 1L2FA 3AF5A 5K85A 1MDFA 5A1IA 3NI2A 2P2BA 4JI4C 2E7GA 5KYTA 4EATA 4DV4C 4DV1C 2UU9C 3AF6A 1IBMC 1N34C 3B7WA 3R44A 4DCTA 1N32C 2DHMA 2YCBA 4RMNA 5BUSA 5BSMA 3LGXA 1USPB 4JI8C 2BH1X 1QM4A 4JI1C 4LF4C 2BJOA 3TDEA 4OXIA 3LUSA 3L8CA 1HNWC 2PN2A 4ODJA 4JV5C 3R9XA 4JI3C 2ZTBA 3OTOC 2PG1E 1T5HX 5BSTA 5ADZA 5BSRA 4X62C 1N33C 1V60A 1XRCA 4DCVA 1K0RA 2VQEC 3UOWA 1HR0C 1HH2P 3A25A 4KTTA 4RVOA 5JRHA 4RM3A 1BA3A 2D28C 1VEHA 4JI5C 4LF6C 1HNXC 1IB8A 2ONFA 3UZ0A 3N54B 2HHHC 3TQIA 4DR4C 5IWAC 1UWDA 4DR3C 4IR7A 4ISBA 2F4VC 2KZFA 1KKGA 1XDXA 2WD9A 2Y4NA 5BSUA 4JYAC 3EERA 2D1RA 5CZXA 2MCQA 5AE3A 5BUQA 5H9UA 3G7SA 3C5EA 4FUQA 4X64C 2KZ0A 5IFIA 1JOSA 4BSZA 4DG9A 5FLXD 4YY3C 1VLAA 4LFCC 3A4IA 1M6XC 1LQLA 5BURA 1I94C 1MKYA 2WP0C 1GPMA 3FM7A 3AY0A 4WV3A 1MD9A 1WCJA 1WF3A 4DCSA 4DR6C 1O9TA 3VNRA 4GXQA 2UUCC 4MH4A 2OPLB 4U5YD 3R9WA 5KEIA 3LAXA 5CZVA 4DR1C 2P2JA 3UEBA 5T8SA 2UXBC 3CJEA 2JMPA 1YGTA 3CW8X 3I08A 4PROC 2ZM6C 5K8FA 4DV6C 4PZPA 4NOZA 1V26A 1USPA 2D1TA 4G37A 4DV0C 3FCEA 4RLQA 1ML8A 3K6RA 2M5OA 2UUAC 1PG3A 5LMUC 1YJ7A 4JI0C 4G36A 4OX9C 2E8CA 4TPSB 2VQFC 1O90A 1QWIA 3CQ2A 2XR1A 1IBLC 2ZZNA 4R0MA 1TH5A 2M5HA 5LCIA 1FUGA 1MDBA 2ASBA
chains in the Genus database with same CATH topology
4K0KC 4G1IA 3A9VA 3E7XA 2QL8A 4DR7C 2P02A 3H2TA 4DV3C 2ATWA 5LMNC 1V25A 4X66C 2AYAA 3E7WA 3RG2A 2QW0X 2P2QA 2DPLA 4DV5C 4RVNA 4LF8C 4DR5C 1PG4A 4DV7C 3IEVA 3VNSA 1XNQC 5A19A 5AE1A 3S82A 2QVXX 4DR2C 1ULTA 5DV9A 3IMLA 5T8TA 4BC7A 3T1HC 1J5EC 3PESA 2P20A 3J7AD 4FTFA 1XRAA 2YWBA 3PBKA 3NPDA 2QVZX 1HNZC 4D4GA 3ETCA 2E5LC 4LFAC 3GR0A 1MXBA 3T1YC 5IT9D 1WH9A 3GKUA 3L95X 2E0GA 4ZLPA 1P7LA 4NDNA 4NXMC 3A9UA 3EQ6A 4LF7C 2V7BA 4RLFA 3J80D 2Y27A 4D4IA 4MTNA 1NYEA 4DCUA 4IZ6A 3JAMD 4L4QA 2PROA 3VNQA 4X65C 2UXCC 4GXRA 4YHHC 5E7QA 3SO4A 4R1MA 3NYQA 4R1LA 1ZB9A 4JI6C 5KYVA 3PROC 2HJGA 5A1GA 3TUFA 1N2FA 3RV2A 1LCIA 4JI7C 3IPLA 2CY1A 1FJGC 2UUBC 2VZEA 1RY2A 1T5DX 2DYJA 4L2ZA 2D1SA 3DHVA 4PHTA 2Y4OA 4LF9C 1EGAA 2YWCA 3CW9A 4D56A 2EGTA 4L7IA 2P2FA 4JM1A 4GKKC 4B3RC 2P2MA 3ETOA 3FCCA 3DLPX 3GPCA 4I9GA 4LE5A 1MXCA 2D1QA 2VSQA 3I07A 1PA4A 4B3TC 2UXDC 2PT7G 3DAYA 4DUZC 4BBYA 4XX2A 1XMQC 1IBKC 4DG8A 1RG9A 5AE2A 4DUYC 3N2QA 4B3SC 1XRBA 4HPVA 5BSVA 4JI2C 1XNRC 1O93A 1UKKA 2QVYX 4BC9A 2OBVA 3LNVA 1XMOC 4NXNC 4RM2A 2CXCA 1AMUA 5A2QD 4KTVA 4LFBC 2OPLA 4B3MC 1O92A 4I9FA 4ZJZA 4BCAA 4K0BA 1ZB8A 3NYRA 2E8EA 2E8FA 5BR8C 5GTDA 2D7VA 4D57A 4AQYC 3GR1A 1N36C 4FUTA 1MXAA 2D27A 4GS5A 4WS9A 2OO4A 3IEUA 4OYCA 3J81D 5BSWA 4DV2C 4KHPC 4LF5C 3KXWA 4GKJC 1L2FA 3AF5A 5K85A 1MDFA 5A1IA 3NI2A 2P2BA 4JI4C 2E7GA 5KYTA 4EATA 4DV4C 4DV1C 2UU9C 3AF6A 1IBMC 1N34C 3B7WA 3R44A 4DCTA 1N32C 2YCBA 4RMNA 5BUSA 5BSMA 3LGXA 1USPB 4JI8C 2BH1X 1QM4A 4JI1C 4LF4C 2BJOA 3TDEA 4OXIA 3LUSA 3L8CA 1HNWC 2PN2A 4ODJA 4JV5C 3R9XA 4JI3C 3OTOC 1T5HX 5BSTA 5ADZA 5BSRA 4X62C 1N33C 1XRCA 4DCVA 1K0RA 2VQEC 3UOWA 1HR0C 1HH2P 4KTTA 4RVOA 1BA3A 4RM3A 5JRHA 2D28C 4JI5C 4LF6C 1HNXC 2ONFA 3UZ0A 3N54B 2HHHC 3TQIA 4DR4C 5IWAC 4DR3C 4IR7A 4ISBA 2F4VC 2KZFA 1KKGA 2WD9A 2Y4NA 5BSUA 4JYAC 3EERA 2D1RA 5CZXA 5AE3A 5BUQA 5H9UA 3G7SA 3C5EA 4FUQA 4X64C 5IFIA 1JOSA 4BSZA 4DG9A 5FLXD 4YY3C 1VLAA 4LFCC 3A4IA 1LQLA 5BURA 1I94C 1MKYA 2WP0C 1GPMA 4WV3A 1MD9A 1WF3A 4DCSA 4DR6C 1O9TA 3VNRA 4GXQA 2UUCC 4MH4A 2OPLB 4U5YD 3R9WA 5KEIA 3LAXA 5CZVA 4DR1C 2P2JA 5T8SA 2UXBC 3CJEA 2JMPA 3CW8X 3I08A 4PROC 2ZM6C 5K8FA 4DV6C 4PZPA 4NOZA 1V26A 1USPA 2D1TA 4G37A 4DV0C 3FCEA 4RLQA 1ML8A 2UUAC 1PG3A 5LMUC 1YJ7A 4JI0C 4G36A 4OX9C 2E8CA 4TPSB 2VQFC 1O90A 1QWIA 2XR1A 1IBLC 4R0MA 1FUGA 1MDBA 2ASBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 C;  4K0K C;  4AQY C;  2F4V C;  1ZB9 A;  2KZF A;  1N36 C;  2QL8 A;  4JI6 C;  1KKG A;  2HJG A;  4DR7 C;  4JYA C;  3IEU A;  1N2F A;  3EER A;  3J81 D;  4JI7 C;  2CY1 A;  1FJG C;  2UUB C;  4DV2 C;  4KHP C;  4LF5 C;  4DV3 C;  2DYJ A;  4GKJ C;  1L2F A;  3AF5 A;  4X64 C;  2ATW A;  5LMN C;  1JOS A;  4BSZ A;  5FLX D;  4JI4 C;  4YY3 C;  2E7G A;  4X66 C;  4LF9 C;  1VLA A;  1EGA A;  4LFC C;  2EGT A;  1LQL A;  4DV4 C;  1MKY A;  4DV1 C;  4DV5 C;  1I94 C;  4LF8 C;  4DR5 C;  4DV7 C;  3IEV A;  1XNQ C;  4GKK C;  2UU9 C;  4B3R C;  3AF6 A;  1IBM C;  1N34 C;  1WF3 A;  4DCS A;  4DR6 C;  2D7V A;  4DR2 C;  4DCT A;  2UUC C;  4MH4 A;  2OPL B;  3R9W A;  1N32 C;  3I07 A;  4DR1 C;  2YCB A;  1PA4 A;  2UXB C;  3CJE A;  4B3T C;  2JMP A;  2PT7 G;  2UXD C;  1USP B;  4DUZ C;  3T1H C;  4JI8 C;  4XX2 A;  1J5E C;  2ZM6 C;  1XMQ C;  1IBK C;  4JI1 C;  4LF4 C;  2BJO A;  4DV6 C;  3J7A D;  3LUS A;  1HNW C;  4DUY C;  2PN2 A;  4B3S C;  1HNZ C;  4NOZ A;  4JV5 C;  4JI2 C;  1USP A;  2E5L C;  4LFA C;  4JI3 C;  1XNR C;  3R9X A;  1UKK A;  4DV0 C;  3T1Y C;  3OTO C;  1ML8 A;  5IT9 D;  1WH9 A;  3GKU A;  4X62 C;  1N33 C;  1XMO C;  4NXN C;  4DCV A;  2UUA C;  2CXC A;  5A2Q D;  1K0R A;  2VQE C;  4NXM C;  4LF7 C;  5LMU C;  4JI0 C;  1HR0 C;  1HH2 P;  4OX9 C;  2E8C A;  4LFB C;  2OPL A;  3J80 D;  4MTN A;  2VQF C;  1QWI A;  1NYE A;  2XR1 A;  4DCU A;  1IBL C;  4B3M C;  4JI5 C;  1ZB8 A;  3JAM D;  2E8E A;  4LF6 C;  2E8F A;  1HNX C;  2ONF A;  5BR8 C;  4X65 C;  2UXC C;  2ASB A;  2HHH C;  4DR4 C;  5IWA C;  4YHH C; 
#chains in the Genus database with same CATH topology
 4K0K C;  4G1I A;  3A9V A;  3E7X A;  2QL8 A;  1FLO A;  4DR7 C;  2JNV A;  3CQ3 A;  2P02 A;  3H2T A;  4DV3 C;  3O2E A;  2ATW A;  5LMN C;  1P4E C;  3LNO A;  1V25 A;  4X66 C;  2AYA A;  3E7W A;  3CQ1 A;  3RG2 A;  2QW0 X;  2P2Q A;  2DPL A;  4DV5 C;  4RVN A;  4LF8 C;  4DR5 C;  1PG4 A;  4DV7 C;  1P4E A;  3IEV A;  3VNS A;  1XNQ C;  5A19 A;  5AE1 A;  1XS3 A;  3S82 A;  2QVX X;  4DR2 C;  1ULT A;  5DV9 A;  3IML A;  3UX2 A;  5T8T A;  4BC7 A;  2MM9 A;  3T1H C;  1J5E C;  3PES A;  2P20 A;  3J7A D;  4FTF A;  1XRA A;  2YWB A;  3PBK A;  3NPD A;  2QVZ X;  1HNZ C;  4D4G A;  3ETC A;  2E5L C;  4LFA C;  3GR0 A;  1MXB A;  3T1Y C;  5IT9 D;  1WH9 A;  3GKU A;  3L95 X;  2E0G A;  4ZLP A;  1P7L A;  4NDN A;  2Z51 A;  4NXM C;  3A9U A;  3EQ6 A;  4LF7 C;  2V7B A;  4RLF A;  3J80 D;  2Y27 A;  4D4I A;  4MTN A;  2ZZM A;  1NYE A;  3A26 A;  4DCU A;  4IZ6 A;  4PUG A;  4L4Q A;  3JAM D;  2PRO A;  3VNQ A;  2NCL A;  4X65 C;  2UXC C;  4GXR A;  2YX1 A;  4YHH C;  5E7Q A;  3SO4 A;  4R1M A;  3NYQ A;  4R1L A;  1ZB9 A;  4JI6 C;  5KYV A;  3PRO C;  2HJG A;  5A1G A;  3TUF A;  1N2F A;  2MMA B;  1LCI A;  3RV2 A;  4PUH A;  4JI7 C;  3IPL A;  2CY1 A;  1NY8 A;  1FJG C;  2UUB C;  2VZE A;  1RY2 A;  1T5D X;  2DYJ A;  4L2Z A;  2D1S A;  3DHV A;  4PHT A;  2Y4O A;  4LF9 C;  1EGA A;  2YWC A;  3CW9 A;  4D56 A;  2EGT A;  4L7I A;  2P2F A;  4JM1 A;  4GKK C;  3UX3 A;  4B3R C;  2P2M A;  1PU1 A;  3ETO A;  3FCC A;  3DLP X;  3GPC A;  4I9G A;  4LE5 A;  1MXC A;  2D1Q A;  2VSQ A;  3I07 A;  4PUI A;  3TR3 A;  1PA4 A;  4B3T C;  2UXD C;  2PT7 G;  3DAY A;  4DUZ C;  4BBY A;  4XX2 A;  1XMQ C;  1IBK C;  4DG8 A;  1RG9 A;  5AE2 A;  4DUY C;  3N2Q A;  2CU6 A;  4B3S C;  1XRB A;  4HPV A;  5BSV A;  4JI2 C;  1XNR C;  1O93 A;  1UKK A;  2QVY X;  4BC9 A;  2OBV A;  3LNV A;  1XMO C;  4NXN C;  4RM2 A;  2CXC A;  1AMU A;  5A2Q D;  4KTV A;  4LFB C;  2OPL A;  1XHJ A;  4B3M C;  1O92 A;  4I9F A;  4ZJZ A;  4BCA A;  4K0B A;  1ZB8 A;  3NYR A;  2E8E A;  2E8F A;  5BR8 C;  5GTD A;  2D7V A;  4D57 A;  4AQY C;  3GR1 A;  1N36 C;  4FUT A;  1MXA A;  2D27 A;  4GS5 A;  4WS9 A;  2OO4 A;  2KDN A;  3IEU A;  4OYC A;  3J81 D;  1M6X A;  5BSW A;  4DV2 C;  4KHP C;  4LF5 C;  3KXW A;  4GKJ C;  1L2F A;  3AF5 A;  5K85 A;  1MDF A;  5A1I A;  3NI2 A;  2P2B A;  4JI4 C;  2E7G A;  5KYT A;  4EAT A;  4DV4 C;  4DV1 C;  2UU9 C;  3AF6 A;  1IBM C;  1N34 C;  3B7W A;  3R44 A;  4DCT A;  1N32 C;  2DHM A;  2YCB A;  4RMN A;  5BUS A;  5BSM A;  3LGX A;  1USP B;  4JI8 C;  2BH1 X;  1QM4 A;  4JI1 C;  4LF4 C;  2BJO A;  3TDE A;  4OXI A;  3LUS A;  3L8C A;  1HNW C;  2PN2 A;  4ODJ A;  4JV5 C;  3R9X A;  4JI3 C;  2ZTB A;  3OTO C;  2PG1 E;  1T5H X;  5BST A;  5ADZ A;  5BSR A;  4X62 C;  1N33 C;  1V60 A;  1XRC A;  4DCV A;  1K0R A;  2VQE C;  3UOW A;  1HR0 C;  1HH2 P;  3A25 A;  4KTT A;  4RVO A;  5JRH A;  4RM3 A;  1BA3 A;  2D28 C;  1VEH A;  4JI5 C;  4LF6 C;  1HNX C;  1IB8 A;  2ONF A;  3UZ0 A;  3N54 B;  2HHH C;  3TQI A;  4DR4 C;  5IWA C;  1UWD A;  4DR3 C;  4IR7 A;  4ISB A;  2F4V C;  2KZF A;  1KKG A;  1XDX A;  2WD9 A;  2Y4N A;  5BSU A;  4JYA C;  3EER A;  2D1R A;  5CZX A;  2MCQ A;  5AE3 A;  5BUQ A;  5H9U A;  3G7S A;  3C5E A;  4FUQ A;  4X64 C;  2KZ0 A;  5IFI A;  1JOS A;  4BSZ A;  4DG9 A;  5FLX D;  4YY3 C;  1VLA A;  4LFC C;  3A4I A;  1M6X C;  1LQL A;  5BUR A;  1I94 C;  1MKY A;  2WP0 C;  1GPM A;  3FM7 A;  3AY0 A;  4WV3 A;  1MD9 A;  1WCJ A;  1WF3 A;  4DCS A;  4DR6 C;  1O9T A;  3VNR A;  4GXQ A;  2UUC C;  4MH4 A;  2OPL B;  4U5Y D;  3R9W A;  5KEI A;  3LAX A;  5CZV A;  4DR1 C;  2P2J A;  3UEB A;  5T8S A;  2UXB C;  3CJE A;  2JMP A;  1YGT A;  3CW8 X;  3I08 A;  4PRO C;  2ZM6 C;  5K8F A;  4DV6 C;  4PZP A;  4NOZ A;  1V26 A;  1USP A;  2D1T A;  4G37 A;  4DV0 C;  3FCE A;  4RLQ A;  1ML8 A;  3K6R A;  2M5O A;  2UUA C;  1PG3 A;  5LMU C;  1YJ7 A;  4JI0 C;  4G36 A;  4OX9 C;  2E8C A;  4TPS B;  2VQF C;  1O90 A;  1QWI A;  3CQ2 A;  2XR1 A;  1IBL C;  2ZZN A;  4R0M A;  1TH5 A;  2M5H A;  5LCI A;  1FUG A;  1MDB A;  2ASB A; 
#chains in the Genus database with same CATH homology
 4K0K C;  4G1I A;  3A9V A;  3E7X A;  2QL8 A;  4DR7 C;  2P02 A;  3H2T A;  4DV3 C;  2ATW A;  5LMN C;  1V25 A;  4X66 C;  2AYA A;  3E7W A;  3RG2 A;  2QW0 X;  2P2Q A;  2DPL A;  4DV5 C;  4RVN A;  4LF8 C;  4DR5 C;  1PG4 A;  4DV7 C;  3IEV A;  3VNS A;  1XNQ C;  5A19 A;  5AE1 A;  3S82 A;  2QVX X;  4DR2 C;  1ULT A;  5DV9 A;  3IML A;  5T8T A;  4BC7 A;  3T1H C;  1J5E C;  3PES A;  2P20 A;  3J7A D;  4FTF A;  1XRA A;  2YWB A;  3PBK A;  3NPD A;  2QVZ X;  1HNZ C;  4D4G A;  3ETC A;  2E5L C;  4LFA C;  3GR0 A;  1MXB A;  3T1Y C;  5IT9 D;  1WH9 A;  3GKU A;  3L95 X;  2E0G A;  4ZLP A;  1P7L A;  4NDN A;  4NXM C;  3A9U A;  3EQ6 A;  4LF7 C;  2V7B A;  4RLF A;  3J80 D;  2Y27 A;  4D4I A;  4MTN A;  1NYE A;  4DCU A;  4IZ6 A;  3JAM D;  4L4Q A;  2PRO A;  3VNQ A;  4X65 C;  2UXC C;  4GXR A;  4YHH C;  5E7Q A;  3SO4 A;  4R1M A;  3NYQ A;  4R1L A;  1ZB9 A;  4JI6 C;  5KYV A;  3PRO C;  2HJG A;  5A1G A;  3TUF A;  1N2F A;  3RV2 A;  1LCI A;  4JI7 C;  3IPL A;  2CY1 A;  1FJG C;  2UUB C;  2VZE A;  1RY2 A;  1T5D X;  2DYJ A;  4L2Z A;  2D1S A;  3DHV A;  4PHT A;  2Y4O A;  4LF9 C;  1EGA A;  2YWC A;  3CW9 A;  4D56 A;  2EGT A;  4L7I A;  2P2F A;  4JM1 A;  4GKK C;  4B3R C;  2P2M A;  3ETO A;  3FCC A;  3DLP X;  3GPC A;  4I9G A;  4LE5 A;  1MXC A;  2D1Q A;  2VSQ A;  3I07 A;  1PA4 A;  4B3T C;  2UXD C;  2PT7 G;  3DAY A;  4DUZ C;  4BBY A;  4XX2 A;  1XMQ C;  1IBK C;  4DG8 A;  1RG9 A;  5AE2 A;  4DUY C;  3N2Q A;  4B3S C;  1XRB A;  4HPV A;  5BSV A;  4JI2 C;  1XNR C;  1O93 A;  1UKK A;  2QVY X;  4BC9 A;  2OBV A;  3LNV A;  1XMO C;  4NXN C;  4RM2 A;  2CXC A;  1AMU A;  5A2Q D;  4KTV A;  4LFB C;  2OPL A;  4B3M C;  1O92 A;  4I9F A;  4ZJZ A;  4BCA A;  4K0B A;  1ZB8 A;  3NYR A;  2E8E A;  2E8F A;  5BR8 C;  5GTD A;  2D7V A;  4D57 A;  4AQY C;  3GR1 A;  1N36 C;  4FUT A;  1MXA A;  2D27 A;  4GS5 A;  4WS9 A;  2OO4 A;  3IEU A;  4OYC A;  3J81 D;  5BSW A;  4DV2 C;  4KHP C;  4LF5 C;  3KXW A;  4GKJ C;  1L2F A;  3AF5 A;  5K85 A;  1MDF A;  5A1I A;  3NI2 A;  2P2B A;  4JI4 C;  2E7G A;  5KYT A;  4EAT A;  4DV4 C;  4DV1 C;  2UU9 C;  3AF6 A;  1IBM C;  1N34 C;  3B7W A;  3R44 A;  4DCT A;  1N32 C;  2YCB A;  4RMN A;  5BUS A;  5BSM A;  3LGX A;  1USP B;  4JI8 C;  2BH1 X;  1QM4 A;  4JI1 C;  4LF4 C;  2BJO A;  3TDE A;  4OXI A;  3LUS A;  3L8C A;  1HNW C;  2PN2 A;  4ODJ A;  4JV5 C;  3R9X A;  4JI3 C;  3OTO C;  1T5H X;  5BST A;  5ADZ A;  5BSR A;  4X62 C;  1N33 C;  1XRC A;  4DCV A;  1K0R A;  2VQE C;  3UOW A;  1HR0 C;  1HH2 P;  4KTT A;  4RVO A;  1BA3 A;  4RM3 A;  5JRH A;  2D28 C;  4JI5 C;  4LF6 C;  1HNX C;  2ONF A;  3UZ0 A;  3N54 B;  2HHH C;  3TQI A;  4DR4 C;  5IWA C;  4DR3 C;  4IR7 A;  4ISB A;  2F4V C;  2KZF A;  1KKG A;  2WD9 A;  2Y4N A;  5BSU A;  4JYA C;  3EER A;  2D1R A;  5CZX A;  5AE3 A;  5BUQ A;  5H9U A;  3G7S A;  3C5E A;  4FUQ A;  4X64 C;  5IFI A;  1JOS A;  4BSZ A;  4DG9 A;  5FLX D;  4YY3 C;  1VLA A;  4LFC C;  3A4I A;  1LQL A;  5BUR A;  1I94 C;  1MKY A;  2WP0 C;  1GPM A;  4WV3 A;  1MD9 A;  1WF3 A;  4DCS A;  4DR6 C;  1O9T A;  3VNR A;  4GXQ A;  2UUC C;  4MH4 A;  2OPL B;  4U5Y D;  3R9W A;  5KEI A;  3LAX A;  5CZV A;  4DR1 C;  2P2J A;  5T8S A;  2UXB C;  3CJE A;  2JMP A;  3CW8 X;  3I08 A;  4PRO C;  2ZM6 C;  5K8F A;  4DV6 C;  4PZP A;  4NOZ A;  1V26 A;  1USP A;  2D1T A;  4G37 A;  4DV0 C;  3FCE A;  4RLQ A;  1ML8 A;  2UUA C;  1PG3 A;  5LMU C;  1YJ7 A;  4JI0 C;  4G36 A;  4OX9 C;  2E8C A;  4TPS B;  2VQF C;  1O90 A;  1QWI A;  2XR1 A;  1IBL C;  4R0M A;  1FUG A;  1MDB A;  2ASB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...