1N34C

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 26
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1n34C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1n34C02
1HH2P 1ML8A 4X66C 1HR0C 1HNWC 3CJEA 4MTNA 4DV3C 4K0KC 2PT7G 1N36C 4OX9C 2E8EA 4DR4C 2DYJA 4DV0C 1USPA 2E8FA 1IBLC 3AF6A 1L2FA 4JI3C 4LF8C 4DV4C 1EGAA 1HNXC 4DR5C 3T1YC 1ZB9A 2XR1A 2ZM6C 4DV7C 4JI1C 1IBKC 2PN2A 1KKGA 2UUCC 2ONFA 1HNZC 2UU9C 1FJGC 1NYEA 2VQEC 4LF7C 4DV2C 4JI5C 1IBMC 4JI4C 2EGTA 2HHHC 2E8CA 4LF9C 4LFCC 4MH4A 3EERA 4DR3C 1LQLA 3J80D 4DCSA 1XMQC 5IWAC 4B3RC 1XNRC 3LUSA 4NXNC 4JI8C 4DCVA 1N34C 1J5EC 1PA4A 4KHPC 4AQYC 1WF3A 3JAMD 2D7VA 4B3TC 4X62C 4X65C 4LF5C 4NXMC 2QL8A 5IT9D 4DUZC 5LMNC 2KZFA 4GKKC 1VLAA 4LFAC 4DUYC 1N2FA 4YHHC 4LFBC 2CXCA 1XMOC 2F4VC 1XNQC 2JMPA 3R9XA 4JI2C 4NOZA 4BSZA 1K0RA 4DR6C 4JV5C 4YY3C 1QWIA 1MKYA 2VQFC 3R9WA 2E7GA 1N33C 1ZB8A 4DV1C 3IEVA 2ASBA 2UXBC 1N32C 2UXDC 2HJGA 3T1HC 4GKJC 1I94C 2ATWA 1WH9A 4DR1C 4JI6C 4DR2C 4DR7C 4DCTA 2OPLB 4LF6C 4LF4C 5LMUC 5BR8C 5A2QD 3IEUA 4JI0C 5FLXD 4XX2A 3J81D 4DV6C 2UXCC 4B3SC 1USPB 2UUAC 2YCBA 2E5LC 2BJOA 3GKUA 3I07A 4DV5C 2CY1A 3AF5A 4X64C 4B3MC 3J7AD 2UUBC 4DCUA 4JI7C 1UKKA 1JOSA 3OTOC 4JYAC 2OPLA
chains in the Genus database with same CATH superfamily
3N54B 4FUQA 3GR1A 1MXAA 4PUHA 3CJEA 3LNVA 2ZZNA 2P2FA 4DV3C 4K0KC 4OX9C 4DR4C 4RMNA 1IBLC 1M6XA 1HNXC 3KXWA 4DR5C 4GS5A 4DV7C 1YJ7A 2PN2A 1MXCA 1XS3A 3NYRA 3PESA 4RM2A 4RLQA 4LF7C 4DV2C 2EGTA 2HHHC 4LF9C 3G7SA 4TPSB 3FM7A 3J80D 2BH1X 4IR7A 1XMQC 2QVZX 4B3RC 1XNRC 1PG4A 3UOWA 4NXNC 1UWDA 3NYQA 4D4GA 3UEBA 4U5YD 2QL8A 2D1QA 4BC9A 4GKKC 4ISBA 4DUYC 1P4EA 4L7IA 1RG9A 4L4QA 4YHHC 3CW8X 3I08A 5T8TA 1XNQC 2JMPA 4NOZA 2P2MA 4BSZA 3A25A 2P2QA 1O9TA 2E7GA 4DV1C 2UXBC 3SO4A 2OO4A 1N32C 2HJGA 3T1HC 4GKJC 3FCEA 1FUGA 4JI6C 2ZZMA 3ETCA 5A2QD 4XX2A 4D56A 5IFIA 4PZPA 4BCAA 1MXBA 2UUAC 1O90A 2E5LC 3IPLA 3I07A 3B7WA 5BUSA 2CY1A 3AF5A 3J7AD 2D1SA 4DCUA 5BSVA 1JOSA 3A9UA 2Z51A 2MMAB 5AE1A 2P02A 3AY0A 4LE5A 1HR0C 1HNWC 1P4EC 4DG9A 2PG1E 4EATA 3EQ6A 4MTNA 3TUFA 4R1LA 3VNSA 5JRHA 1USPA 2E8FA 3AF6A 1L2FA 2Y4NA 4HPVA 3DLPX 4OYCA 4D57A 5H9UA 4KTTA 1XHJA 1ZB9A 2XR1A 2ZM6C 4JI1C 1IBKC 1KKGA 2ONFA 3LAXA 1NYEA 3O2EA 2E8CA 4L2ZA 3A26A 4RVOA 5CZVA 2VSQA 4R1MA 2Y4OA 5LCIA 4DCVA 2DHMA 2DPLA 1T5DX 1PA4A 4AQYC 2P2BA 3UZ0A 1XRAA 3CW9A 4B3TC 1FLOA 2QVYX 4NXMC 5IT9D 4DUZC 3LGXA 2YWCA 1N2FA 1XMOC 1BA3A 2AYAA 4JI2C 3ETOA 2PROA 1K0RA 4DR6C 3TR3A 1QWIA 1MKYA 4GXQA 2VQFC 3S82A 1ZB8A 5E7QA 1IB8A 2VZEA 4BC7A 5BSTA 2UXDC 2ATWA 4DCTA 4LF6C 4LF4C 5BURA 5AE3A 5LMUC 3C5EA 1O93A 2MM9A 2YWBA 4JI0C 3J81D 2UXCC 1USPB 2YX1A 5GTDA 3GKUA 3PBKA 4DV5C 3E7WA 2D27A 3TQIA 4LFCC 2M5OA 2KZ0A 3DAYA 2KDNA 2P20A 3RG2A 2PT7G 1N36C 4KTVA 2E8EA 2DYJA 4JI3C 4DV4C 1LCIA 3TDEA 1VEHA 3T1YC 4PROC 4DG8A 2UUCC 3DHVA 5K85A 2UU9C 1RY2A 2VQEC 4JI5C 4R0MA 1WCJA 3CQ3A 1QM4A 3A9VA 1IBMC 3H2TA 2JNVA 4OXIA 3EERA 4WV3A 4DR3C 1LQLA 4DCSA 5IWAC 3GPCA 1NY8A 3LUSA 5KEIA 2OBVA 4KHPC 1PG3A 3JAMD 2D7VA 4D4IA 3NI2A 4X62C 2M5HA 2CU6A 4X65C 3E7XA 4LF5C 5T8SA 5A1IA 4FTFA 4IZ6A 4PHTA 3NPDA 5CZXA 4RLFA 3N2QA 4LFBC 3CQ1A 1PU1A 5KYTA 3IMLA 4RVNA 3R9XA 1V25A 1V60A 4G1IA 4YY3C 3R9WA 1XDXA 5DV9A 3K6RA 4PUGA 5A19A 1XRCA 4GXRA 1WH9A 4DR1C 4DR2C 5BR8C 3VNQA 2D1RA 1TH5A 5FLXD 2D28C 2MCQA 2NCLA 4B3SC 3UX2A 4G36A 2ZTBA 4JI7C 2QVXX 5BSUA 1V26A 4PUIA 2OPLA 3RV2A 1HH2P 1ML8A 4X66C 1YGTA 4I9FA 5BSMA 2WP0C 1P7LA 5ADZA 3FCCA 4ZJZA 4DV0C 3L95X 4LF8C 1EGAA 3CQ2A 1O92A 5K8FA 4JYAC 4ZLPA 5BUQA 1HNZC 1FJGC 1MDFA 4JI4C 3R44A 3A4IA 2P2JA 4MH4A 5BSWA 1M6XC 4JI8C 1N34C 1J5EC 4JM1A 4RM3A 1WF3A 1T5HX 2D1TA 3PROC 4BBYA 5AE2A 1AMUA 4K0BA 5KYVA 2E0GA 2V7BA 5LMNC 2KZFA 2Y27A 2WD9A 1VLAA 4LFAC 5BSRA 2CXCA 1XRBA 2QW0X 3UX3A 2F4VC 5A1GA 4JV5C 4ODJA 1N33C 3IEVA 2ASBA 1MD9A 3LNOA 1ULTA 4NDNA 1I94C 1MDBA 1GPMA 4DR7C 3L8CA 2OPLB 3IEUA 4WS9A 4DV6C 4G37A 3GR0A 2YCBA 2BJOA 4X64C 4B3MC 2UUBC 1UKKA 3VNRA 3OTOC 4FUTA 4I9GA
chains in the Genus database with same CATH topology
3N54B 4FUQA 3GR1A 1MXAA 3CJEA 3LNVA 2P2FA 4DV3C 4K0KC 4OX9C 4DR4C 4RMNA 1IBLC 1HNXC 3KXWA 4DR5C 4GS5A 4DV7C 1YJ7A 2PN2A 1MXCA 3NYRA 3PESA 4RM2A 4RLQA 4LF7C 4DV2C 2EGTA 2HHHC 4LF9C 3G7SA 4TPSB 3J80D 2BH1X 4IR7A 1XMQC 2QVZX 4B3RC 1XNRC 1PG4A 3UOWA 4NXNC 3NYQA 4D4GA 4U5YD 2QL8A 2D1QA 4BC9A 4GKKC 4ISBA 4DUYC 4L7IA 1RG9A 4L4QA 4YHHC 3CW8X 3I08A 5T8TA 1XNQC 2JMPA 4NOZA 2P2MA 4BSZA 2P2QA 1O9TA 2E7GA 4DV1C 2UXBC 3SO4A 2OO4A 1N32C 2HJGA 3T1HC 4GKJC 3FCEA 1FUGA 4JI6C 3ETCA 5A2QD 4XX2A 4D56A 5IFIA 4PZPA 4BCAA 1MXBA 2UUAC 1O90A 2E5LC 3IPLA 3I07A 3B7WA 5BUSA 2CY1A 3AF5A 3J7AD 2D1SA 4DCUA 5BSVA 1JOSA 3A9UA 5AE1A 2P02A 4LE5A 1HR0C 1HNWC 4DG9A 4EATA 3EQ6A 4MTNA 3TUFA 4R1LA 3VNSA 5JRHA 1USPA 2E8FA 3AF6A 1L2FA 2Y4NA 4HPVA 3DLPX 4OYCA 4D57A 5H9UA 4KTTA 1ZB9A 2XR1A 2ZM6C 4JI1C 1IBKC 1KKGA 2ONFA 3LAXA 1NYEA 2E8CA 4L2ZA 4RVOA 5CZVA 2VSQA 4R1MA 2Y4OA 4DCVA 2DPLA 1T5DX 1PA4A 4AQYC 2P2BA 3UZ0A 1XRAA 3CW9A 4B3TC 2QVYX 4NXMC 5IT9D 4DUZC 3LGXA 2YWCA 1N2FA 1XMOC 1BA3A 2AYAA 4JI2C 3ETOA 2PROA 1K0RA 4DR6C 1QWIA 1MKYA 4GXQA 2VQFC 3S82A 1ZB8A 5E7QA 2VZEA 4BC7A 5BSTA 2UXDC 2ATWA 4DCTA 4LF6C 4LF4C 5BURA 5AE3A 5LMUC 3C5EA 1O93A 2YWBA 4JI0C 3J81D 2UXCC 1USPB 5GTDA 3GKUA 3PBKA 4DV5C 3E7WA 2D27A 3TQIA 4LFCC 3DAYA 2P20A 3RG2A 2PT7G 1N36C 4KTVA 2E8EA 2DYJA 4JI3C 4DV4C 1LCIA 3TDEA 3T1YC 4PROC 4DG8A 2UUCC 3DHVA 5K85A 2UU9C 1RY2A 2VQEC 4JI5C 4R0MA 1IBMC 1QM4A 3A9VA 3H2TA 4OXIA 3EERA 4WV3A 4DR3C 1LQLA 4DCSA 5IWAC 3GPCA 3LUSA 5KEIA 2OBVA 4KHPC 1PG3A 3JAMD 2D7VA 4D4IA 3NI2A 4X62C 4X65C 3E7XA 4LF5C 5T8SA 5A1IA 4FTFA 4IZ6A 4PHTA 3NPDA 5CZXA 4RLFA 3N2QA 4LFBC 5KYTA 3IMLA 4RVNA 3R9XA 1V25A 4G1IA 4YY3C 3R9WA 5DV9A 5A19A 1XRCA 4GXRA 1WH9A 4DR1C 4DR2C 5BR8C 3VNQA 2D1RA 5FLXD 2D28C 4B3SC 4G36A 4JI7C 2QVXX 5BSUA 1V26A 2OPLA 3RV2A 1HH2P 1ML8A 4X66C 4I9FA 5BSMA 2WP0C 1P7LA 5ADZA 3FCCA 4ZJZA 4DV0C 3L95X 4LF8C 1EGAA 1O92A 5K8FA 4JYAC 4ZLPA 5BUQA 1HNZC 1FJGC 1MDFA 4JI4C 3R44A 3A4IA 2P2JA 4MH4A 5BSWA 4JI8C 1N34C 1J5EC 4JM1A 4RM3A 1WF3A 1T5HX 2D1TA 3PROC 4BBYA 5AE2A 1AMUA 4K0BA 5KYVA 2E0GA 2V7BA 5LMNC 2KZFA 2Y27A 2WD9A 1VLAA 4LFAC 5BSRA 2CXCA 1XRBA 2QW0X 2F4VC 5A1GA 4JV5C 4ODJA 1N33C 3IEVA 2ASBA 1MD9A 1ULTA 4NDNA 1I94C 1MDBA 1GPMA 4DR7C 3L8CA 2OPLB 3IEUA 4WS9A 4DV6C 4G37A 3GR0A 2YCBA 2BJOA 4X64C 4B3MC 2UUBC 1UKKA 3VNRA 3OTOC 4FUTA 4I9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HH2 P;  1ML8 A;  4X66 C;  1HR0 C;  1HNW C;  3CJE A;  4MTN A;  4DV3 C;  4K0K C;  2PT7 G;  1N36 C;  4OX9 C;  2E8E A;  4DR4 C;  2DYJ A;  4DV0 C;  1USP A;  2E8F A;  1IBL C;  3AF6 A;  1L2F A;  4JI3 C;  4LF8 C;  4DV4 C;  1EGA A;  1HNX C;  4DR5 C;  3T1Y C;  1ZB9 A;  2XR1 A;  2ZM6 C;  4DV7 C;  4JI1 C;  1IBK C;  2PN2 A;  1KKG A;  2UUC C;  2ONF A;  1HNZ C;  2UU9 C;  1FJG C;  1NYE A;  2VQE C;  4LF7 C;  4DV2 C;  4JI5 C;  1IBM C;  4JI4 C;  2EGT A;  2HHH C;  2E8C A;  4LF9 C;  4LFC C;  4MH4 A;  3EER A;  4DR3 C;  1LQL A;  3J80 D;  4DCS A;  1XMQ C;  5IWA C;  4B3R C;  1XNR C;  3LUS A;  4NXN C;  4JI8 C;  4DCV A;  1N34 C;  1J5E C;  1PA4 A;  4KHP C;  4AQY C;  1WF3 A;  3JAM D;  2D7V A;  4B3T C;  4X62 C;  4X65 C;  4LF5 C;  4NXM C;  2QL8 A;  5IT9 D;  4DUZ C;  5LMN C;  2KZF A;  4GKK C;  1VLA A;  4LFA C;  4DUY C;  1N2F A;  4YHH C;  4LFB C;  2CXC A;  1XMO C;  2F4V C;  1XNQ C;  2JMP A;  3R9X A;  4JI2 C;  4NOZ A;  4BSZ A;  1K0R A;  4DR6 C;  4JV5 C;  4YY3 C;  1QWI A;  1MKY A;  2VQF C;  3R9W A;  2E7G A;  1N33 C;  1ZB8 A;  4DV1 C;  3IEV A;  2ASB A;  2UXB C;  1N32 C;  2UXD C;  2HJG A;  3T1H C;  4GKJ C;  1I94 C;  2ATW A;  1WH9 A;  4DR1 C;  4JI6 C;  4DR2 C;  4DR7 C;  4DCT A;  2OPL B;  4LF6 C;  4LF4 C;  5LMU C;  5BR8 C;  5A2Q D;  3IEU A;  4JI0 C;  5FLX D;  4XX2 A;  3J81 D;  4DV6 C;  2UXC C;  4B3S C;  1USP B;  2UUA C;  2YCB A;  2E5L C;  2BJO A;  3GKU A;  3I07 A;  4DV5 C;  2CY1 A;  3AF5 A;  4X64 C;  4B3M C;  3J7A D;  2UUB C;  4DCU A;  4JI7 C;  1UKK A;  1JOS A;  3OTO C;  4JYA C;  2OPL A; 
#chains in the Genus database with same CATH topology
 3N54 B;  4FUQ A;  3GR1 A;  1MXA A;  4PUH A;  3CJE A;  3LNV A;  2ZZN A;  2P2F A;  4DV3 C;  4K0K C;  4OX9 C;  4DR4 C;  4RMN A;  1IBL C;  1M6X A;  1HNX C;  3KXW A;  4DR5 C;  4GS5 A;  4DV7 C;  1YJ7 A;  2PN2 A;  1MXC A;  1XS3 A;  3NYR A;  3PES A;  4RM2 A;  4RLQ A;  4LF7 C;  4DV2 C;  2EGT A;  2HHH C;  4LF9 C;  3G7S A;  4TPS B;  3FM7 A;  3J80 D;  2BH1 X;  4IR7 A;  1XMQ C;  2QVZ X;  4B3R C;  1XNR C;  1PG4 A;  3UOW A;  4NXN C;  1UWD A;  3NYQ A;  4D4G A;  3UEB A;  4U5Y D;  2QL8 A;  2D1Q A;  4BC9 A;  4GKK C;  4ISB A;  4DUY C;  1P4E A;  4L7I A;  1RG9 A;  4L4Q A;  4YHH C;  3CW8 X;  3I08 A;  5T8T A;  1XNQ C;  2JMP A;  4NOZ A;  2P2M A;  4BSZ A;  3A25 A;  2P2Q A;  1O9T A;  2E7G A;  4DV1 C;  2UXB C;  3SO4 A;  2OO4 A;  1N32 C;  2HJG A;  3T1H C;  4GKJ C;  3FCE A;  1FUG A;  4JI6 C;  2ZZM A;  3ETC A;  5A2Q D;  4XX2 A;  4D56 A;  5IFI A;  4PZP A;  4BCA A;  1MXB A;  2UUA C;  1O90 A;  2E5L C;  3IPL A;  3I07 A;  3B7W A;  5BUS A;  2CY1 A;  3AF5 A;  3J7A D;  2D1S A;  4DCU A;  5BSV A;  1JOS A;  3A9U A;  2Z51 A;  2MMA B;  5AE1 A;  2P02 A;  3AY0 A;  4LE5 A;  1HR0 C;  1HNW C;  1P4E C;  4DG9 A;  2PG1 E;  4EAT A;  3EQ6 A;  4MTN A;  3TUF A;  4R1L A;  3VNS A;  5JRH A;  1USP A;  2E8F A;  3AF6 A;  1L2F A;  2Y4N A;  4HPV A;  3DLP X;  4OYC A;  4D57 A;  5H9U A;  4KTT A;  1XHJ A;  1ZB9 A;  2XR1 A;  2ZM6 C;  4JI1 C;  1IBK C;  1KKG A;  2ONF A;  3LAX A;  1NYE A;  3O2E A;  2E8C A;  4L2Z A;  3A26 A;  4RVO A;  5CZV A;  2VSQ A;  4R1M A;  2Y4O A;  5LCI A;  4DCV A;  2DHM A;  2DPL A;  1T5D X;  1PA4 A;  4AQY C;  2P2B A;  3UZ0 A;  1XRA A;  3CW9 A;  4B3T C;  1FLO A;  2QVY X;  4NXM C;  5IT9 D;  4DUZ C;  3LGX A;  2YWC A;  1N2F A;  1XMO C;  1BA3 A;  2AYA A;  4JI2 C;  3ETO A;  2PRO A;  1K0R A;  4DR6 C;  3TR3 A;  1QWI A;  1MKY A;  4GXQ A;  2VQF C;  3S82 A;  1ZB8 A;  5E7Q A;  1IB8 A;  2VZE A;  4BC7 A;  5BST A;  2UXD C;  2ATW A;  4DCT A;  4LF6 C;  4LF4 C;  5BUR A;  5AE3 A;  5LMU C;  3C5E A;  1O93 A;  2MM9 A;  2YWB A;  4JI0 C;  3J81 D;  2UXC C;  1USP B;  2YX1 A;  5GTD A;  3GKU A;  3PBK A;  4DV5 C;  3E7W A;  2D27 A;  3TQI A;  4LFC C;  2M5O A;  2KZ0 A;  3DAY A;  2KDN A;  2P20 A;  3RG2 A;  2PT7 G;  1N36 C;  4KTV A;  2E8E A;  2DYJ A;  4JI3 C;  4DV4 C;  1LCI A;  3TDE A;  1VEH A;  3T1Y C;  4PRO C;  4DG8 A;  2UUC C;  3DHV A;  5K85 A;  2UU9 C;  1RY2 A;  2VQE C;  4JI5 C;  4R0M A;  1WCJ A;  3CQ3 A;  1QM4 A;  3A9V A;  1IBM C;  3H2T A;  2JNV A;  4OXI A;  3EER A;  4WV3 A;  4DR3 C;  1LQL A;  4DCS A;  5IWA C;  3GPC A;  1NY8 A;  3LUS A;  5KEI A;  2OBV A;  4KHP C;  1PG3 A;  3JAM D;  2D7V A;  4D4I A;  3NI2 A;  4X62 C;  2M5H A;  2CU6 A;  4X65 C;  3E7X A;  4LF5 C;  5T8S A;  5A1I A;  4FTF A;  4IZ6 A;  4PHT A;  3NPD A;  5CZX A;  4RLF A;  3N2Q A;  4LFB C;  3CQ1 A;  1PU1 A;  5KYT A;  3IML A;  4RVN A;  3R9X A;  1V25 A;  1V60 A;  4G1I A;  4YY3 C;  3R9W A;  1XDX A;  5DV9 A;  3K6R A;  4PUG A;  5A19 A;  1XRC A;  4GXR A;  1WH9 A;  4DR1 C;  4DR2 C;  5BR8 C;  3VNQ A;  2D1R A;  1TH5 A;  5FLX D;  2D28 C;  2MCQ A;  2NCL A;  4B3S C;  3UX2 A;  4G36 A;  2ZTB A;  4JI7 C;  2QVX X;  5BSU A;  1V26 A;  4PUI A;  2OPL A;  3RV2 A;  1HH2 P;  1ML8 A;  4X66 C;  1YGT A;  4I9F A;  5BSM A;  2WP0 C;  1P7L A;  5ADZ A;  3FCC A;  4ZJZ A;  4DV0 C;  3L95 X;  4LF8 C;  1EGA A;  3CQ2 A;  1O92 A;  5K8F A;  4JYA C;  4ZLP A;  5BUQ A;  1HNZ C;  1FJG C;  1MDF A;  4JI4 C;  3R44 A;  3A4I A;  2P2J A;  4MH4 A;  5BSW A;  1M6X C;  4JI8 C;  1N34 C;  1J5E C;  4JM1 A;  4RM3 A;  1WF3 A;  1T5H X;  2D1T A;  3PRO C;  4BBY A;  5AE2 A;  1AMU A;  4K0B A;  5KYV A;  2E0G A;  2V7B A;  5LMN C;  2KZF A;  2Y27 A;  2WD9 A;  1VLA A;  4LFA C;  5BSR A;  2CXC A;  1XRB A;  2QW0 X;  3UX3 A;  2F4V C;  5A1G A;  4JV5 C;  4ODJ A;  1N33 C;  3IEV A;  2ASB A;  1MD9 A;  3LNO A;  1ULT A;  4NDN A;  1I94 C;  1MDB A;  1GPM A;  4DR7 C;  3L8C A;  2OPL B;  3IEU A;  4WS9 A;  4DV6 C;  4G37 A;  3GR0 A;  2YCB A;  2BJO A;  4X64 C;  4B3M C;  2UUB C;  1UKK A;  3VNR A;  3OTO C;  4FUT A;  4I9G A; 
#chains in the Genus database with same CATH homology
 3N54 B;  4FUQ A;  3GR1 A;  1MXA A;  3CJE A;  3LNV A;  2P2F A;  4DV3 C;  4K0K C;  4OX9 C;  4DR4 C;  4RMN A;  1IBL C;  1HNX C;  3KXW A;  4DR5 C;  4GS5 A;  4DV7 C;  1YJ7 A;  2PN2 A;  1MXC A;  3NYR A;  3PES A;  4RM2 A;  4RLQ A;  4LF7 C;  4DV2 C;  2EGT A;  2HHH C;  4LF9 C;  3G7S A;  4TPS B;  3J80 D;  2BH1 X;  4IR7 A;  1XMQ C;  2QVZ X;  4B3R C;  1XNR C;  1PG4 A;  3UOW A;  4NXN C;  3NYQ A;  4D4G A;  4U5Y D;  2QL8 A;  2D1Q A;  4BC9 A;  4GKK C;  4ISB A;  4DUY C;  4L7I A;  1RG9 A;  4L4Q A;  4YHH C;  3CW8 X;  3I08 A;  5T8T A;  1XNQ C;  2JMP A;  4NOZ A;  2P2M A;  4BSZ A;  2P2Q A;  1O9T A;  2E7G A;  4DV1 C;  2UXB C;  3SO4 A;  2OO4 A;  1N32 C;  2HJG A;  3T1H C;  4GKJ C;  3FCE A;  1FUG A;  4JI6 C;  3ETC A;  5A2Q D;  4XX2 A;  4D56 A;  5IFI A;  4PZP A;  4BCA A;  1MXB A;  2UUA C;  1O90 A;  2E5L C;  3IPL A;  3I07 A;  3B7W A;  5BUS A;  2CY1 A;  3AF5 A;  3J7A D;  2D1S A;  4DCU A;  5BSV A;  1JOS A;  3A9U A;  5AE1 A;  2P02 A;  4LE5 A;  1HR0 C;  1HNW C;  4DG9 A;  4EAT A;  3EQ6 A;  4MTN A;  3TUF A;  4R1L A;  3VNS A;  5JRH A;  1USP A;  2E8F A;  3AF6 A;  1L2F A;  2Y4N A;  4HPV A;  3DLP X;  4OYC A;  4D57 A;  5H9U A;  4KTT A;  1ZB9 A;  2XR1 A;  2ZM6 C;  4JI1 C;  1IBK C;  1KKG A;  2ONF A;  3LAX A;  1NYE A;  2E8C A;  4L2Z A;  4RVO A;  5CZV A;  2VSQ A;  4R1M A;  2Y4O A;  4DCV A;  2DPL A;  1T5D X;  1PA4 A;  4AQY C;  2P2B A;  3UZ0 A;  1XRA A;  3CW9 A;  4B3T C;  2QVY X;  4NXM C;  5IT9 D;  4DUZ C;  3LGX A;  2YWC A;  1N2F A;  1XMO C;  1BA3 A;  2AYA A;  4JI2 C;  3ETO A;  2PRO A;  1K0R A;  4DR6 C;  1QWI A;  1MKY A;  4GXQ A;  2VQF C;  3S82 A;  1ZB8 A;  5E7Q A;  2VZE A;  4BC7 A;  5BST A;  2UXD C;  2ATW A;  4DCT A;  4LF6 C;  4LF4 C;  5BUR A;  5AE3 A;  5LMU C;  3C5E A;  1O93 A;  2YWB A;  4JI0 C;  3J81 D;  2UXC C;  1USP B;  5GTD A;  3GKU A;  3PBK A;  4DV5 C;  3E7W A;  2D27 A;  3TQI A;  4LFC C;  3DAY A;  2P20 A;  3RG2 A;  2PT7 G;  1N36 C;  4KTV A;  2E8E A;  2DYJ A;  4JI3 C;  4DV4 C;  1LCI A;  3TDE A;  3T1Y C;  4PRO C;  4DG8 A;  2UUC C;  3DHV A;  5K85 A;  2UU9 C;  1RY2 A;  2VQE C;  4JI5 C;  4R0M A;  1IBM C;  1QM4 A;  3A9V A;  3H2T A;  4OXI A;  3EER A;  4WV3 A;  4DR3 C;  1LQL A;  4DCS A;  5IWA C;  3GPC A;  3LUS A;  5KEI A;  2OBV A;  4KHP C;  1PG3 A;  3JAM D;  2D7V A;  4D4I A;  3NI2 A;  4X62 C;  4X65 C;  3E7X A;  4LF5 C;  5T8S A;  5A1I A;  4FTF A;  4IZ6 A;  4PHT A;  3NPD A;  5CZX A;  4RLF A;  3N2Q A;  4LFB C;  5KYT A;  3IML A;  4RVN A;  3R9X A;  1V25 A;  4G1I A;  4YY3 C;  3R9W A;  5DV9 A;  5A19 A;  1XRC A;  4GXR A;  1WH9 A;  4DR1 C;  4DR2 C;  5BR8 C;  3VNQ A;  2D1R A;  5FLX D;  2D28 C;  4B3S C;  4G36 A;  4JI7 C;  2QVX X;  5BSU A;  1V26 A;  2OPL A;  3RV2 A;  1HH2 P;  1ML8 A;  4X66 C;  4I9F A;  5BSM A;  2WP0 C;  1P7L A;  5ADZ A;  3FCC A;  4ZJZ A;  4DV0 C;  3L95 X;  4LF8 C;  1EGA A;  1O92 A;  5K8F A;  4JYA C;  4ZLP A;  5BUQ A;  1HNZ C;  1FJG C;  1MDF A;  4JI4 C;  3R44 A;  3A4I A;  2P2J A;  4MH4 A;  5BSW A;  4JI8 C;  1N34 C;  1J5E C;  4JM1 A;  4RM3 A;  1WF3 A;  1T5H X;  2D1T A;  3PRO C;  4BBY A;  5AE2 A;  1AMU A;  4K0B A;  5KYV A;  2E0G A;  2V7B A;  5LMN C;  2KZF A;  2Y27 A;  2WD9 A;  1VLA A;  4LFA C;  5BSR A;  2CXC A;  1XRB A;  2QW0 X;  2F4V C;  5A1G A;  4JV5 C;  4ODJ A;  1N33 C;  3IEV A;  2ASB A;  1MD9 A;  1ULT A;  4NDN A;  1I94 C;  1MDB A;  1GPM A;  4DR7 C;  3L8C A;  2OPL B;  3IEU A;  4WS9 A;  4DV6 C;  4G37 A;  3GR0 A;  2YCB A;  2BJO A;  4X64 C;  4B3M C;  2UUB C;  1UKK A;  3VNR A;  3OTO C;  4FUT A;  4I9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...