4LFCC

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 52
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lfcC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lfcC02
4DCUA 1HNZC 3GKUA 4LF8C 4JI2C 2UXCC 4DV0C 4NXNC 2ASBA 4JI5C 4B3MC 4DCTA 4JI6C 4JI1C 5LMNC 4DV6C 2E8FA 2PT7G 2UUBC 4B3TC 4YHHC 1XNRC 4X65C 1J5EC 3EERA 4JI4C 1LQLA 2XR1A 2VQFC 3CJEA 4DR2C 1HNXC 4X64C 4DV2C 1VLAA 2JMPA 2VQEC 4X66C 2E7GA 1N34C 1JOSA 4B3RC 3J81D 1KKGA 1NYEA 3IEUA 1EGAA 2OPLB 4LFAC 4DR3C 3JAMD 4LFCC 1XMQC 2UXDC 4DR1C 1USPA 2BJOA 4DR4C 4KHPC 4JI3C 2E5LC 2E8CA 2PN2A 5IWAC 4JYAC 3R9WA 1FJGC 2E8EA 4B3SC 2UUCC 3AF6A 1N36C 1HR0C 1N33C 2EGTA 5FLXD 4GKJC 5A2QD 4DR5C 1XNQC 4DV7C 3LUSA 4X62C 4MTNA 4LF4C 1HNWC 4OX9C 2UU9C 4LF9C 4AQYC 1IBKC 3AF5A 4XX2A 5BR8C 2F4VC 4LF6C 2D7VA 1UKKA 4LF5C 1MKYA 4DV5C 4DUYC 2ATWA 4DV3C 1ML8A 4NOZA 3T1YC 1WF3A 1USPB 2UUAC 3J80D 4JI7C 4LF7C 4DUZC 4DCVA 3I07A 4DR7C 4JV5C 4DV4C 2CY1A 2QL8A 3OTOC 1L2FA 4GKKC 1ZB9A 4LFBC 1IBMC 3IEVA 1QWIA 4DCSA 4YY3C 4K0KC 1HH2P 2HHHC 1ZB8A 2ONFA 3T1HC 4DR6C 2CXCA 1PA4A 2HJGA 2UXBC 2YCBA 1N32C 4MH4A 2KZFA 1IBLC 5LMUC 4NXMC 1I94C 1WH9A 4JI8C 1K0RA 1N2FA 4BSZA 4DV1C 3R9XA 2ZM6C 2DYJA 1XMOC 3J7AD 2OPLA 5IT9D 4JI0C
chains in the Genus database with same CATH superfamily
5A1GA 3TUFA 4KTVA 4LF8C 2UXCC 4JM1A 4BBYA 4JI1C 5LMNC 2E8FA 1M6XA 1XNRC 3R44A 1LQLA 4OYCA 1MXAA 3CJEA 3PBKA 4R1LA 3UZ0A 1HNXC 3G7SA 3LAXA 3UX2A 3LGXA 1T5DX 2V7BA 3J81D 1NYEA 4BC7A 5A19A 5BSWA 4RM3A 1GPMA 4DG9A 4LFCC 1XMQC 3AY0A 4DR1C 3CQ2A 2PN2A 5IWAC 1FJGC 2UUCC 3AF6A 1HR0C 1N33C 4L2ZA 5CZVA 4DR5C 2P2BA 3CQ1A 1VEHA 2P2FA 4LF9C 4AQYC 3NI2A 1P4EC 5BR8C 2YWCA 2F4VC 1UKKA 4DV5C 2DHMA 4DUYC 4EATA 1PU1A 2ZZNA 1ML8A 1WF3A 3J80D 4LF7C 5CZXA 1XS3A 1P7LA 3A9VA 4HPVA 3OTOC 5LCIA 1L2FA 4GKKC 1YJ7A 4LFBC 1IBMC 4DCSA 4K0KC 4FTFA 2ONFA 2MMAB 4RVOA 4ZLPA 2OBVA 2UXBC 1N32C 3LNOA 2CU6A 4FUTA 4BSZA 4DV1C 2ZM6C 4L4QA 3J7AD 2PG1E 4JI0C 4PUGA 2NCLA 3PROC 4DCUA 4OXIA 1HNZC 2BH1X 3DHVA 4JI2C 2QVXX 2D1SA 2ASBA 4WV3A 4DCTA 4JI6C 3NYQA 1RY2A 2Y4NA 2UUBC 5BSUA 2ZZMA 4DG8A 5BSVA 2YX1A 4D4IA 4GS5A 4RLFA 5E7QA 4X64C 3FCEA 1JOSA 1XRBA 5JRHA 2OPLB 4RLQA 2QW0X 3JAMD 1LCIA 2UXDC 3IPLA 3UOWA 4JI3C 2E5LC 4PHTA 2P02A 2E8EA 5FLXD 4GKJC 5IFIA 1MXCA 4PUHA 2E0GA 3L8CA 4IZ6A 3LUSA 4LF4C 3FM7A 4G36A 4OX9C 1IBKC 4XX2A 1MDFA 4LE5A 2P2MA 1YGTA 4LF5C 1MKYA 3VNQA 4ZJZA 5K85A 5AE2A 4NOZA 1XRCA 3T1YC 2UUAC 1MXBA 4KTTA 4G1IA 2M5OA 4JV5C 3CW9A 5DV9A 1ZB9A 1V26A 4D56A 3IEVA 1QWIA 4RM2A 3E7WA 4I9GA 1UWDA 1O92A 5LMUC 1O93A 4TPSB 1PG3A 4JI8C 4R1MA 2PROA 3A4IA 1T5HX 1V25A 1V60A 1P4EA 2DYJA 3GPCA 5IT9D 3DLPX 3GKUA 3A25A 4DV0C 5T8TA 1TH5A 4NXNC 4BC9A 2WP0C 4B3TC 4GXRA 5KYTA 4PUIA 1RG9A 1J5EC 3EERA 3N2QA 4JI4C 2XR1A 4FUQA 2VQFC 1XHJA 4DV2C 2JMPA 2VQEC 2WD9A 2E7GA 3EQ6A 4WS9A 1MD9A 1O9TA 3IEUA 1EGAA 5AE1A 3KXWA 1USPA 2BJOA 4KHPC 2E8CA 3R9WA 5KYVA 3H2TA 1N36C 3B7WA 4ODJA 2VSQA 3GR1A 3UEBA 2D1RA 3GR0A 4DV7C 4X62C 4MTNA 1HNWC 5A1IA 3TQIA 4PROC 5T8SA 1ULTA 1PG4A 1QM4A 3DAYA 4L7IA 4D57A 2OO4A 1AMUA 3S82A 3A26A 2D28C 4DV3C 3ETCA 4U5YD 2DPLA 1XDXA 4JI7C 4DUZC 4DCVA 3I07A 1M6XC 2QVYX 4DR7C 4RMNA 1FUGA 4IR7A 4PZPA 2AYAA 1ZB8A 3T1HC 2CXCA 3NPDA 2D1TA 3NYRA 2YCBA 5BUQA 2KZFA 3O2EA 3L95X 4NXMC 1WH9A 4K0BA 1N2FA 1O90A 3R9XA 2Y4OA 4G37A 5BSRA 3CQ3A 2P2JA 1MDBA 5K8FA 1WCJA 3N54B 4B3MC 4JI5C 5BURA 2PT7G 4DV6C 4YHHC 4D4GA 5AE3A 4X65C 3IMLA 3I08A 3K6RA 2D1QA 1NY8A 4DR2C 4R0MA 3VNRA 1VLAA 2Y27A 2YWBA 4X66C 1N34C 4ISBA 3SO4A 4B3RC 4I9FA 1KKGA 4NDNA 4LFAC 4DR3C 5BSMA 4DR4C 4JYAC 4B3SC 2D27A 3RV2A 2EGTA 1FLOA 5A2QD 3C5EA 5GTDA 3FCCA 2Z51A 2P20A 3VNSA 1XNQC 3RG2A 2UU9C 3PESA 3AF5A 1BA3A 1IB8A 2QVZX 2KZ0A 4LF6C 2D7VA 4GXQA 5KEIA 2ATWA 2MCQA 3LNVA 1USPB 3UX3A 5H9UA 5BSTA 1XRAA 4DV4C 2CY1A 2QL8A 2JNVA 3CW8X 5ADZA 2KDNA 2MM9A 4YY3C 1HH2P 2HHHC 4BCAA 4DR6C 1PA4A 2HJGA 2M5HA 4MH4A 2VZEA 1IBLC 3ETOA 5BUSA 1I94C 1K0RA 3TR3A 3E7XA 1XMOC 2ZTBA 2OPLA 4RVNA 3TDEA 3A9UA 2P2QA
chains in the Genus database with same CATH topology
5A1GA 3TUFA 4KTVA 4LF8C 2UXCC 4JM1A 4BBYA 4JI1C 5LMNC 2E8FA 1XNRC 3R44A 1LQLA 4OYCA 1MXAA 3CJEA 3PBKA 4R1LA 3UZ0A 1HNXC 3G7SA 3LAXA 3LGXA 1T5DX 2V7BA 3J81D 1NYEA 4BC7A 5A19A 5BSWA 4RM3A 1GPMA 4DG9A 4LFCC 1XMQC 4DR1C 2PN2A 5IWAC 1FJGC 2UUCC 3AF6A 1HR0C 1N33C 4L2ZA 5CZVA 4DR5C 2P2BA 2P2FA 4LF9C 4AQYC 3NI2A 5BR8C 2YWCA 2F4VC 1UKKA 4DV5C 4DUYC 4EATA 1ML8A 1WF3A 3J80D 4LF7C 5CZXA 1P7LA 3A9VA 4HPVA 3OTOC 1L2FA 4GKKC 1YJ7A 4LFBC 1IBMC 4DCSA 4K0KC 4FTFA 2ONFA 4RVOA 4ZLPA 2OBVA 2UXBC 1N32C 4FUTA 4BSZA 4DV1C 2ZM6C 4L4QA 3J7AD 4JI0C 3PROC 4DCUA 4OXIA 1HNZC 2BH1X 3DHVA 4JI2C 2QVXX 2D1SA 2ASBA 4WV3A 4DCTA 4JI6C 3NYQA 1RY2A 2Y4NA 2UUBC 5BSUA 4DG8A 5BSVA 4D4IA 4GS5A 4RLFA 5E7QA 4X64C 3FCEA 1JOSA 1XRBA 5JRHA 2OPLB 4RLQA 2QW0X 3JAMD 1LCIA 2UXDC 3IPLA 3UOWA 4JI3C 2E5LC 4PHTA 2P02A 2E8EA 5FLXD 4GKJC 5IFIA 1MXCA 2E0GA 3L8CA 4IZ6A 3LUSA 4LF4C 4G36A 4OX9C 1IBKC 4XX2A 1MDFA 4LE5A 2P2MA 4LF5C 1MKYA 3VNQA 4ZJZA 5K85A 5AE2A 4NOZA 1XRCA 3T1YC 2UUAC 1MXBA 4KTTA 4G1IA 4JV5C 3CW9A 5DV9A 1ZB9A 1V26A 4D56A 3IEVA 1QWIA 4RM2A 3E7WA 4I9GA 1O92A 5LMUC 1O93A 4TPSB 1PG3A 4JI8C 4R1MA 2PROA 3A4IA 1T5HX 1V25A 2DYJA 3GPCA 5IT9D 3DLPX 3GKUA 4DV0C 5T8TA 4NXNC 4BC9A 2WP0C 4B3TC 4GXRA 5KYTA 1RG9A 1J5EC 3EERA 3N2QA 4JI4C 2XR1A 4FUQA 2VQFC 4DV2C 2JMPA 2VQEC 2WD9A 2E7GA 3EQ6A 4WS9A 1MD9A 1O9TA 3IEUA 1EGAA 5AE1A 3KXWA 1USPA 2BJOA 4KHPC 2E8CA 3R9WA 5KYVA 3H2TA 1N36C 3B7WA 4ODJA 2VSQA 3GR1A 2D1RA 3GR0A 4DV7C 4X62C 4MTNA 1HNWC 5A1IA 3TQIA 4PROC 5T8SA 1ULTA 1PG4A 1QM4A 3DAYA 4L7IA 4D57A 2OO4A 1AMUA 3S82A 2D28C 4DV3C 3ETCA 4U5YD 2DPLA 4JI7C 4DUZC 4DCVA 3I07A 2QVYX 4DR7C 4RMNA 1FUGA 4IR7A 4PZPA 2AYAA 1ZB8A 3T1HC 2CXCA 3NPDA 2D1TA 3NYRA 2YCBA 5BUQA 2KZFA 3L95X 4NXMC 1WH9A 4K0BA 1N2FA 1O90A 3R9XA 2Y4OA 4G37A 5BSRA 2P2JA 1MDBA 5K8FA 3N54B 4B3MC 4JI5C 5BURA 2PT7G 4DV6C 4YHHC 4D4GA 5AE3A 4X65C 3IMLA 3I08A 2D1QA 4DR2C 4R0MA 3VNRA 1VLAA 2Y27A 2YWBA 4X66C 1N34C 4ISBA 3SO4A 4B3RC 4I9FA 1KKGA 4NDNA 4LFAC 4DR3C 5BSMA 4DR4C 4JYAC 4B3SC 2D27A 3RV2A 2EGTA 5A2QD 3C5EA 5GTDA 3FCCA 2P20A 3VNSA 1XNQC 3RG2A 2UU9C 3PESA 3AF5A 1BA3A 2QVZX 4LF6C 2D7VA 4GXQA 5KEIA 2ATWA 3LNVA 1USPB 5H9UA 5BSTA 1XRAA 4DV4C 2CY1A 2QL8A 3CW8X 5ADZA 4YY3C 1HH2P 2HHHC 4BCAA 4DR6C 1PA4A 2HJGA 4MH4A 2VZEA 1IBLC 3ETOA 5BUSA 1I94C 1K0RA 3E7XA 1XMOC 2OPLA 4RVNA 3TDEA 3A9UA 2P2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DCU A;  1HNZ C;  3GKU A;  4LF8 C;  4JI2 C;  2UXC C;  4DV0 C;  4NXN C;  2ASB A;  4JI5 C;  4B3M C;  4DCT A;  4JI6 C;  4JI1 C;  5LMN C;  4DV6 C;  2E8F A;  2PT7 G;  2UUB C;  4B3T C;  4YHH C;  1XNR C;  4X65 C;  1J5E C;  3EER A;  4JI4 C;  1LQL A;  2XR1 A;  2VQF C;  3CJE A;  4DR2 C;  1HNX C;  4X64 C;  4DV2 C;  1VLA A;  2JMP A;  2VQE C;  4X66 C;  2E7G A;  1N34 C;  1JOS A;  4B3R C;  3J81 D;  1KKG A;  1NYE A;  3IEU A;  1EGA A;  2OPL B;  4LFA C;  4DR3 C;  3JAM D;  4LFC C;  1XMQ C;  2UXD C;  4DR1 C;  1USP A;  2BJO A;  4DR4 C;  4KHP C;  4JI3 C;  2E5L C;  2E8C A;  2PN2 A;  5IWA C;  4JYA C;  3R9W A;  1FJG C;  2E8E A;  4B3S C;  2UUC C;  3AF6 A;  1N36 C;  1HR0 C;  1N33 C;  2EGT A;  5FLX D;  4GKJ C;  5A2Q D;  4DR5 C;  1XNQ C;  4DV7 C;  3LUS A;  4X62 C;  4MTN A;  4LF4 C;  1HNW C;  4OX9 C;  2UU9 C;  4LF9 C;  4AQY C;  1IBK C;  3AF5 A;  4XX2 A;  5BR8 C;  2F4V C;  4LF6 C;  2D7V A;  1UKK A;  4LF5 C;  1MKY A;  4DV5 C;  4DUY C;  2ATW A;  4DV3 C;  1ML8 A;  4NOZ A;  3T1Y C;  1WF3 A;  1USP B;  2UUA C;  3J80 D;  4JI7 C;  4LF7 C;  4DUZ C;  4DCV A;  3I07 A;  4DR7 C;  4JV5 C;  4DV4 C;  2CY1 A;  2QL8 A;  3OTO C;  1L2F A;  4GKK C;  1ZB9 A;  4LFB C;  1IBM C;  3IEV A;  1QWI A;  4DCS A;  4YY3 C;  4K0K C;  1HH2 P;  2HHH C;  1ZB8 A;  2ONF A;  3T1H C;  4DR6 C;  2CXC A;  1PA4 A;  2HJG A;  2UXB C;  2YCB A;  1N32 C;  4MH4 A;  2KZF A;  1IBL C;  5LMU C;  4NXM C;  1I94 C;  1WH9 A;  4JI8 C;  1K0R A;  1N2F A;  4BSZ A;  4DV1 C;  3R9X A;  2ZM6 C;  2DYJ A;  1XMO C;  3J7A D;  2OPL A;  5IT9 D;  4JI0 C; 
#chains in the Genus database with same CATH topology
 5A1G A;  3TUF A;  4KTV A;  4LF8 C;  2UXC C;  4JM1 A;  4BBY A;  4JI1 C;  5LMN C;  2E8F A;  1M6X A;  1XNR C;  3R44 A;  1LQL A;  4OYC A;  1MXA A;  3CJE A;  3PBK A;  4R1L A;  3UZ0 A;  1HNX C;  3G7S A;  3LAX A;  3UX2 A;  3LGX A;  1T5D X;  2V7B A;  3J81 D;  1NYE A;  4BC7 A;  5A19 A;  5BSW A;  4RM3 A;  1GPM A;  4DG9 A;  4LFC C;  1XMQ C;  3AY0 A;  4DR1 C;  3CQ2 A;  2PN2 A;  5IWA C;  1FJG C;  2UUC C;  3AF6 A;  1HR0 C;  1N33 C;  4L2Z A;  5CZV A;  4DR5 C;  2P2B A;  3CQ1 A;  1VEH A;  2P2F A;  4LF9 C;  4AQY C;  3NI2 A;  1P4E C;  5BR8 C;  2YWC A;  2F4V C;  1UKK A;  4DV5 C;  2DHM A;  4DUY C;  4EAT A;  1PU1 A;  2ZZN A;  1ML8 A;  1WF3 A;  3J80 D;  4LF7 C;  5CZX A;  1XS3 A;  1P7L A;  3A9V A;  4HPV A;  3OTO C;  5LCI A;  1L2F A;  4GKK C;  1YJ7 A;  4LFB C;  1IBM C;  4DCS A;  4K0K C;  4FTF A;  2ONF A;  2MMA B;  4RVO A;  4ZLP A;  2OBV A;  2UXB C;  1N32 C;  3LNO A;  2CU6 A;  4FUT A;  4BSZ A;  4DV1 C;  2ZM6 C;  4L4Q A;  3J7A D;  2PG1 E;  4JI0 C;  4PUG A;  2NCL A;  3PRO C;  4DCU A;  4OXI A;  1HNZ C;  2BH1 X;  3DHV A;  4JI2 C;  2QVX X;  2D1S A;  2ASB A;  4WV3 A;  4DCT A;  4JI6 C;  3NYQ A;  1RY2 A;  2Y4N A;  2UUB C;  5BSU A;  2ZZM A;  4DG8 A;  5BSV A;  2YX1 A;  4D4I A;  4GS5 A;  4RLF A;  5E7Q A;  4X64 C;  3FCE A;  1JOS A;  1XRB A;  5JRH A;  2OPL B;  4RLQ A;  2QW0 X;  3JAM D;  1LCI A;  2UXD C;  3IPL A;  3UOW A;  4JI3 C;  2E5L C;  4PHT A;  2P02 A;  2E8E A;  5FLX D;  4GKJ C;  5IFI A;  1MXC A;  4PUH A;  2E0G A;  3L8C A;  4IZ6 A;  3LUS A;  4LF4 C;  3FM7 A;  4G36 A;  4OX9 C;  1IBK C;  4XX2 A;  1MDF A;  4LE5 A;  2P2M A;  1YGT A;  4LF5 C;  1MKY A;  3VNQ A;  4ZJZ A;  5K85 A;  5AE2 A;  4NOZ A;  1XRC A;  3T1Y C;  2UUA C;  1MXB A;  4KTT A;  4G1I A;  2M5O A;  4JV5 C;  3CW9 A;  5DV9 A;  1ZB9 A;  1V26 A;  4D56 A;  3IEV A;  1QWI A;  4RM2 A;  3E7W A;  4I9G A;  1UWD A;  1O92 A;  5LMU C;  1O93 A;  4TPS B;  1PG3 A;  4JI8 C;  4R1M A;  2PRO A;  3A4I A;  1T5H X;  1V25 A;  1V60 A;  1P4E A;  2DYJ A;  3GPC A;  5IT9 D;  3DLP X;  3GKU A;  3A25 A;  4DV0 C;  5T8T A;  1TH5 A;  4NXN C;  4BC9 A;  2WP0 C;  4B3T C;  4GXR A;  5KYT A;  4PUI A;  1RG9 A;  1J5E C;  3EER A;  3N2Q A;  4JI4 C;  2XR1 A;  4FUQ A;  2VQF C;  1XHJ A;  4DV2 C;  2JMP A;  2VQE C;  2WD9 A;  2E7G A;  3EQ6 A;  4WS9 A;  1MD9 A;  1O9T A;  3IEU A;  1EGA A;  5AE1 A;  3KXW A;  1USP A;  2BJO A;  4KHP C;  2E8C A;  3R9W A;  5KYV A;  3H2T A;  1N36 C;  3B7W A;  4ODJ A;  2VSQ A;  3GR1 A;  3UEB A;  2D1R A;  3GR0 A;  4DV7 C;  4X62 C;  4MTN A;  1HNW C;  5A1I A;  3TQI A;  4PRO C;  5T8S A;  1ULT A;  1PG4 A;  1QM4 A;  3DAY A;  4L7I A;  4D57 A;  2OO4 A;  1AMU A;  3S82 A;  3A26 A;  2D28 C;  4DV3 C;  3ETC A;  4U5Y D;  2DPL A;  1XDX A;  4JI7 C;  4DUZ C;  4DCV A;  3I07 A;  1M6X C;  2QVY X;  4DR7 C;  4RMN A;  1FUG A;  4IR7 A;  4PZP A;  2AYA A;  1ZB8 A;  3T1H C;  2CXC A;  3NPD A;  2D1T A;  3NYR A;  2YCB A;  5BUQ A;  2KZF A;  3O2E A;  3L95 X;  4NXM C;  1WH9 A;  4K0B A;  1N2F A;  1O90 A;  3R9X A;  2Y4O A;  4G37 A;  5BSR A;  3CQ3 A;  2P2J A;  1MDB A;  5K8F A;  1WCJ A;  3N54 B;  4B3M C;  4JI5 C;  5BUR A;  2PT7 G;  4DV6 C;  4YHH C;  4D4G A;  5AE3 A;  4X65 C;  3IML A;  3I08 A;  3K6R A;  2D1Q A;  1NY8 A;  4DR2 C;  4R0M A;  3VNR A;  1VLA A;  2Y27 A;  2YWB A;  4X66 C;  1N34 C;  4ISB A;  3SO4 A;  4B3R C;  4I9F A;  1KKG A;  4NDN A;  4LFA C;  4DR3 C;  5BSM A;  4DR4 C;  4JYA C;  4B3S C;  2D27 A;  3RV2 A;  2EGT A;  1FLO A;  5A2Q D;  3C5E A;  5GTD A;  3FCC A;  2Z51 A;  2P20 A;  3VNS A;  1XNQ C;  3RG2 A;  2UU9 C;  3PES A;  3AF5 A;  1BA3 A;  1IB8 A;  2QVZ X;  2KZ0 A;  4LF6 C;  2D7V A;  4GXQ A;  5KEI A;  2ATW A;  2MCQ A;  3LNV A;  1USP B;  3UX3 A;  5H9U A;  5BST A;  1XRA A;  4DV4 C;  2CY1 A;  2QL8 A;  2JNV A;  3CW8 X;  5ADZ A;  2KDN A;  2MM9 A;  4YY3 C;  1HH2 P;  2HHH C;  4BCA A;  4DR6 C;  1PA4 A;  2HJG A;  2M5H A;  4MH4 A;  2VZE A;  1IBL C;  3ETO A;  5BUS A;  1I94 C;  1K0R A;  3TR3 A;  3E7X A;  1XMO C;  2ZTB A;  2OPL A;  4RVN A;  3TDE A;  3A9U A;  2P2Q A; 
#chains in the Genus database with same CATH homology
 5A1G A;  3TUF A;  4KTV A;  4LF8 C;  2UXC C;  4JM1 A;  4BBY A;  4JI1 C;  5LMN C;  2E8F A;  1XNR C;  3R44 A;  1LQL A;  4OYC A;  1MXA A;  3CJE A;  3PBK A;  4R1L A;  3UZ0 A;  1HNX C;  3G7S A;  3LAX A;  3LGX A;  1T5D X;  2V7B A;  3J81 D;  1NYE A;  4BC7 A;  5A19 A;  5BSW A;  4RM3 A;  1GPM A;  4DG9 A;  4LFC C;  1XMQ C;  4DR1 C;  2PN2 A;  5IWA C;  1FJG C;  2UUC C;  3AF6 A;  1HR0 C;  1N33 C;  4L2Z A;  5CZV A;  4DR5 C;  2P2B A;  2P2F A;  4LF9 C;  4AQY C;  3NI2 A;  5BR8 C;  2YWC A;  2F4V C;  1UKK A;  4DV5 C;  4DUY C;  4EAT A;  1ML8 A;  1WF3 A;  3J80 D;  4LF7 C;  5CZX A;  1P7L A;  3A9V A;  4HPV A;  3OTO C;  1L2F A;  4GKK C;  1YJ7 A;  4LFB C;  1IBM C;  4DCS A;  4K0K C;  4FTF A;  2ONF A;  4RVO A;  4ZLP A;  2OBV A;  2UXB C;  1N32 C;  4FUT A;  4BSZ A;  4DV1 C;  2ZM6 C;  4L4Q A;  3J7A D;  4JI0 C;  3PRO C;  4DCU A;  4OXI A;  1HNZ C;  2BH1 X;  3DHV A;  4JI2 C;  2QVX X;  2D1S A;  2ASB A;  4WV3 A;  4DCT A;  4JI6 C;  3NYQ A;  1RY2 A;  2Y4N A;  2UUB C;  5BSU A;  4DG8 A;  5BSV A;  4D4I A;  4GS5 A;  4RLF A;  5E7Q A;  4X64 C;  3FCE A;  1JOS A;  1XRB A;  5JRH A;  2OPL B;  4RLQ A;  2QW0 X;  3JAM D;  1LCI A;  2UXD C;  3IPL A;  3UOW A;  4JI3 C;  2E5L C;  4PHT A;  2P02 A;  2E8E A;  5FLX D;  4GKJ C;  5IFI A;  1MXC A;  2E0G A;  3L8C A;  4IZ6 A;  3LUS A;  4LF4 C;  4G36 A;  4OX9 C;  1IBK C;  4XX2 A;  1MDF A;  4LE5 A;  2P2M A;  4LF5 C;  1MKY A;  3VNQ A;  4ZJZ A;  5K85 A;  5AE2 A;  4NOZ A;  1XRC A;  3T1Y C;  2UUA C;  1MXB A;  4KTT A;  4G1I A;  4JV5 C;  3CW9 A;  5DV9 A;  1ZB9 A;  1V26 A;  4D56 A;  3IEV A;  1QWI A;  4RM2 A;  3E7W A;  4I9G A;  1O92 A;  5LMU C;  1O93 A;  4TPS B;  1PG3 A;  4JI8 C;  4R1M A;  2PRO A;  3A4I A;  1T5H X;  1V25 A;  2DYJ A;  3GPC A;  5IT9 D;  3DLP X;  3GKU A;  4DV0 C;  5T8T A;  4NXN C;  4BC9 A;  2WP0 C;  4B3T C;  4GXR A;  5KYT A;  1RG9 A;  1J5E C;  3EER A;  3N2Q A;  4JI4 C;  2XR1 A;  4FUQ A;  2VQF C;  4DV2 C;  2JMP A;  2VQE C;  2WD9 A;  2E7G A;  3EQ6 A;  4WS9 A;  1MD9 A;  1O9T A;  3IEU A;  1EGA A;  5AE1 A;  3KXW A;  1USP A;  2BJO A;  4KHP C;  2E8C A;  3R9W A;  5KYV A;  3H2T A;  1N36 C;  3B7W A;  4ODJ A;  2VSQ A;  3GR1 A;  2D1R A;  3GR0 A;  4DV7 C;  4X62 C;  4MTN A;  1HNW C;  5A1I A;  3TQI A;  4PRO C;  5T8S A;  1ULT A;  1PG4 A;  1QM4 A;  3DAY A;  4L7I A;  4D57 A;  2OO4 A;  1AMU A;  3S82 A;  2D28 C;  4DV3 C;  3ETC A;  4U5Y D;  2DPL A;  4JI7 C;  4DUZ C;  4DCV A;  3I07 A;  2QVY X;  4DR7 C;  4RMN A;  1FUG A;  4IR7 A;  4PZP A;  2AYA A;  1ZB8 A;  3T1H C;  2CXC A;  3NPD A;  2D1T A;  3NYR A;  2YCB A;  5BUQ A;  2KZF A;  3L95 X;  4NXM C;  1WH9 A;  4K0B A;  1N2F A;  1O90 A;  3R9X A;  2Y4O A;  4G37 A;  5BSR A;  2P2J A;  1MDB A;  5K8F A;  3N54 B;  4B3M C;  4JI5 C;  5BUR A;  2PT7 G;  4DV6 C;  4YHH C;  4D4G A;  5AE3 A;  4X65 C;  3IML A;  3I08 A;  2D1Q A;  4DR2 C;  4R0M A;  3VNR A;  1VLA A;  2Y27 A;  2YWB A;  4X66 C;  1N34 C;  4ISB A;  3SO4 A;  4B3R C;  4I9F A;  1KKG A;  4NDN A;  4LFA C;  4DR3 C;  5BSM A;  4DR4 C;  4JYA C;  4B3S C;  2D27 A;  3RV2 A;  2EGT A;  5A2Q D;  3C5E A;  5GTD A;  3FCC A;  2P20 A;  3VNS A;  1XNQ C;  3RG2 A;  2UU9 C;  3PES A;  3AF5 A;  1BA3 A;  2QVZ X;  4LF6 C;  2D7V A;  4GXQ A;  5KEI A;  2ATW A;  3LNV A;  1USP B;  5H9U A;  5BST A;  1XRA A;  4DV4 C;  2CY1 A;  2QL8 A;  3CW8 X;  5ADZ A;  4YY3 C;  1HH2 P;  2HHH C;  4BCA A;  4DR6 C;  1PA4 A;  2HJG A;  4MH4 A;  2VZE A;  1IBL C;  3ETO A;  5BUS A;  1I94 C;  1K0R A;  3E7X A;  1XMO C;  2OPL A;  4RVN A;  3TDE A;  3A9U A;  2P2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...