4LFCC

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 52
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lfcC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lfcC02
1ML8A 1IBKC 2QL8A 4DUZC 3IEVA 1HR0C 4JYAC 1LQLA 2E7GA 1USPB 4LF9C 4MTNA 3I07A 3GKUA 4LF8C 4DV1C 1NYEA 2E8FA 4JI4C 2CXCA 4BSZA 1USPA 1ZB8A 1MKYA 4DCSA 5IT9D 1XMQC 1N36C 1HNWC 1XNQC 4X66C 4DR1C 2VQFC 4B3RC 4AQYC 4YY3C 4JI2C 4K0KC 2OPLB 3JAMD 4NOZA 5LMUC 5FLXD 4JI1C 2E8CA 4LFAC 4DR6C 4LFBC 2OPLA 4LF5C 3J7AD 4LF6C 1WF3A 1N34C 4DR3C 2DYJA 3OTOC 2HHHC 2E8EA 4DV0C 2HJGA 2BJOA 4XX2A 2XR1A 1N32C 1QWIA 1EGAA 1N2FA 2UUCC 2YCBA 3R9WA 4MH4A 3T1HC 2ONFA 4GKKC 3AF5A 4DV6C 1K0RA 4JI6C 4JI3C 2D7VA 5LMNC 1N33C 4DR2C 4DUYC 4DR7C 2CY1A 1FJGC 4LF7C 2UXDC 4X65C 4NXNC 4JV5C 4NXMC 4X62C 4X64C 4JI8C 3R9XA 1UKKA 4DCUA 4OX9C 2E5LC 1XMOC 1KKGA 3T1YC 4LF4C 3EERA 1HNXC 4YHHC 4JI7C 1J5EC 1HNZC 1I94C 4B3SC 2UUBC 4KHPC 4JI5C 2UXCC 1VLAA 4LFCC 4DR4C 1ZB9A 4DV5C 4B3TC 3AF6A 2PT7G 5IWAC 2PN2A 4DV3C 4DV2C 2UXBC 4B3MC 1HH2P 2JMPA 2UU9C 2ATWA 4DR5C 2F4VC 5BR8C 2ZM6C 1XNRC 1PA4A 4DCTA 4DV7C 2KZFA 4DV4C 4GKJC 3J81D 3J80D 1IBLC 1IBMC 2UUAC 3CJEA 1WH9A 4DCVA 2ASBA 3LUSA 1L2FA 5A2QD 3IEUA 4JI0C 2VQEC 1JOSA 2EGTA
chains in the Genus database with same CATH superfamily
1P4EA 4U5YD 3NPDA 5BSMA 1O93A 1XHJA 2CU6A 1HR0C 4JYAC 4JM1A 3I08A 1XRBA 1P4EC 4FUTA 3CW9A 4LF8C 1NYEA 4JI4C 4PHTA 4BSZA 3GR0A 4RMNA 2JNVA 5KYTA 3LNVA 4ISBA 4FUQA 3L95X 3UOWA 3DLPX 2OO4A 4DR6C 5BUQA 4LF5C 3J7AD 3K6RA 4LF6C 1N34C 2E8EA 3NYRA 4DV0C 4XX2A 3L8CA 2XR1A 1N32C 1EGAA 2YCBA 3R9WA 2Y27A 3UX3A 5IFIA 3TQIA 3FCCA 2M5HA 3AF5A 4RM3A 5LMNC 1LCIA 3R44A 4DR2C 2UXDC 3CQ1A 5BSRA 4NXMC 4EATA 3A9UA 4X64C 5H9UA 4JI8C 3FM7A 4DCUA 2E5LC 4WV3A 2YX1A 4LF4C 5AE1A 3TUFA 3H2TA 2UUBC 2QVZX 1VLAA 4DV5C 4B3TC 3AF6A 2PT7G 4K0BA 2PN2A 4KTVA 4B3MC 2Z51A 2KZ0A 3VNSA 5KEIA 4RVNA 4GKJC 4RVOA 2QVXX 1IBLC 2PG1E 1WH9A 1PG4A 1FUGA 1IB8A 3LUSA 3IEUA 2BH1X 2V7BA 1NY8A 1PU1A 3E7WA 1ML8A 1IBKC 1XDXA 4R0MA 1MXCA 2E7GA 4LF9C 1XRCA 4D4GA 1ULTA 1V26A 4MTNA 3GKUA 4BBYA 1USPA 4DCSA 4R1LA 3N54B 3NI2A 4X66C 4K0KC 5BSUA 4NOZA 5LMUC 5FLXD 4LFBC 2OPLA 2P20A 5JRHA 2ZZNA 1T5HX 2YWBA 4RLFA 2P2BA 4BCAA 2D1RA 3AY0A 4MH4A 4PROC 2ONFA 2Y4NA 2VSQA 4GKKC 3IMLA 4DV6C 2D7VA 1T5DX 4PUGA 5A19A 2CY1A 4PZPA 5BSTA 4L2ZA 4X62C 2PROA 4ZLPA 4DG8A 5K8FA 3A9VA 3C5EA 3EERA 2DHMA 1XRAA 4PUIA 1YJ7A 4D4IA 5DV9A 1I94C 4B3SC 5BSVA 4JI5C 1M6XA 1MXAA 2D27A 4DR4C 2ZTBA 4DV3C 4DV2C 1HH2P 2JMPA 2MCQA 3ETOA 1M6XC 5BR8C 1XNRC 4DV7C 5ADZA 2KZFA 2WD9A 4FTFA 3J81D 4I9GA 4TPSB 2MMAB 4DCVA 1MDFA 5A2QD 1TH5A 4I9FA 4G37A 1JOSA 3G7SA 4DUZC 4WS9A 3LGXA 3B7WA 1USPB 4IZ6A 3RG2A 4ZJZA 1N36C 1MKYA 1UWDA 5T8SA 1HNWC 3S82A 1GPMA 2VQFC 4AQYC 1O92A 1YGTA 2OPLB 2QVYX 2E8CA 3CQ3A 1FLOA 2M5OA 3PBKA 2DYJA 4G36A 2HHHC 5AE2A 1QM4A 2ZZMA 5K85A 3EQ6A 3CQ2A 3T1HC 1PG3A 1K0RA 3GPCA 4LE5A 1N33C 4DUYC 3KXWA 3CW8X 4D56A 3UX2A 1FJGC 4NXNC 3GR1A 3A4IA 3R9XA 1UKKA 3T1YC 1HNXC 5GTDA 3FCEA 1J5EC 4R1MA 3LNOA 2UXCC 1ZB9A 2UXBC 3UZ0A 1MDBA 3DHVA 2P2QA 2UU9C 4DG9A 4DR5C 2ATWA 5BUSA 2WP0C 1V25A 4BC9A 5T8TA 3NYQA 4G1IA 1IBMC 4RM2A 4NDNA 3CJEA 2P2JA 2KDNA 1L2FA 3ETCA 2D1TA 2QW0X 5AE3A 2EGTA 2D1QA 2D1SA 5A1IA 3O2EA 2QL8A 4GXRA 3IEVA 2DPLA 4D57A 5BSWA 1LQLA 3I07A 1WCJA 4DV1C 2E8FA 4OXIA 2CXCA 2E0GA 5A1GA 5IT9D 1ZB8A 1XMQC 1XNQC 1MXBA 4DR1C 2P02A 4B3RC 4YY3C 1VEHA 2AYAA 4PUHA 4JI2C 3JAMD 4BC7A 1O9TA 5CZXA 3TR3A 4JI1C 4LFAC 1RG9A 1WF3A 2Y4OA 4DR3C 3OTOC 3N2QA 4IR7A 1AMUA 1MD9A 2HJGA 2BJOA 4L7IA 1QWIA 2P2FA 1N2FA 3TDEA 2UUCC 4GXQA 2D28C 3PROC 1BA3A 3IPLA 4JI6C 4JI3C 5KYVA 1RY2A 4DR7C 5BURA 4GS5A 4LF7C 4X65C 4JV5C 4OX9C 2OBVA 2P2MA 3RV2A 1XMOC 1KKGA 2VZEA 3VNQA 4YHHC 4JI7C 1HNZC 4KHPC 4LFCC 2NCLA 4ODJA 4L4QA 5IWAC 1P7LA 3VNRA 5CZVA 2F4VC 2ZM6C 4KTTA 5E7QA 1PA4A 4DCTA 4HPVA 2YWCA 4DV4C 1XS3A 3SO4A 3PESA 3J80D 3A25A 2UUAC 3A26A 4RLQA 2MM9A 2ASBA 3UEBA 3LAXA 5LCIA 4JI0C 2VQEC 4OYCA 3DAYA 1V60A 3E7XA 1O90A
chains in the Genus database with same CATH topology
4U5YD 3NPDA 5BSMA 1O93A 1HR0C 4JYAC 4JM1A 3I08A 1XRBA 4FUTA 3CW9A 4LF8C 1NYEA 4JI4C 4PHTA 4BSZA 3GR0A 4RMNA 5KYTA 3LNVA 4ISBA 4FUQA 3L95X 3UOWA 3DLPX 2OO4A 4DR6C 5BUQA 4LF5C 3J7AD 4LF6C 1N34C 2E8EA 3NYRA 4DV0C 4XX2A 3L8CA 2XR1A 1N32C 1EGAA 2YCBA 3R9WA 2Y27A 5IFIA 3TQIA 3FCCA 3AF5A 4RM3A 5LMNC 1LCIA 3R44A 4DR2C 2UXDC 5BSRA 4NXMC 4X64C 4EATA 3A9UA 5H9UA 4JI8C 4DCUA 2E5LC 4WV3A 4LF4C 5AE1A 3TUFA 3H2TA 2UUBC 2QVZX 1VLAA 4DV5C 4B3TC 3AF6A 2PT7G 4K0BA 2PN2A 4KTVA 4B3MC 3VNSA 5KEIA 4RVNA 4GKJC 4RVOA 2QVXX 1IBLC 1WH9A 1PG4A 1FUGA 3LUSA 3IEUA 2BH1X 2V7BA 3E7WA 1ML8A 1IBKC 4R0MA 1MXCA 2E7GA 4LF9C 1XRCA 4D4GA 1ULTA 1V26A 4MTNA 3GKUA 4BBYA 1USPA 4DCSA 4R1LA 3N54B 3NI2A 4X66C 4K0KC 5BSUA 4NOZA 5LMUC 5FLXD 4LFBC 2OPLA 2P20A 5JRHA 1T5HX 2YWBA 4RLFA 2P2BA 4BCAA 2D1RA 4MH4A 4PROC 2ONFA 2Y4NA 2VSQA 4GKKC 3IMLA 4DV6C 2D7VA 1T5DX 5A19A 2CY1A 4PZPA 5BSTA 4L2ZA 4X62C 2PROA 4ZLPA 4DG8A 5K8FA 3A9VA 3C5EA 3EERA 1XRAA 4D4IA 1YJ7A 5DV9A 1I94C 4B3SC 5BSVA 4JI5C 1MXAA 2D27A 4DR4C 4DV3C 4DV2C 1HH2P 2JMPA 3ETOA 5BR8C 1XNRC 4DV7C 5ADZA 2KZFA 2WD9A 4FTFA 3J81D 4I9GA 4TPSB 4DCVA 1MDFA 5A2QD 4I9FA 4G37A 1JOSA 3G7SA 4DUZC 4WS9A 3LGXA 3B7WA 1USPB 4IZ6A 3RG2A 4ZJZA 1N36C 1MKYA 5T8SA 1HNWC 3S82A 1GPMA 2VQFC 4AQYC 1O92A 2OPLB 2QVYX 2E8CA 3PBKA 2DYJA 4G36A 2HHHC 5AE2A 1QM4A 5K85A 3EQ6A 3T1HC 1PG3A 1K0RA 3GPCA 4LE5A 1N33C 4DUYC 3KXWA 3CW8X 4D56A 1FJGC 4NXNC 3GR1A 3A4IA 3R9XA 1UKKA 3T1YC 1HNXC 5GTDA 3FCEA 1J5EC 4R1MA 2UXCC 1ZB9A 2UXBC 3UZ0A 1MDBA 3DHVA 2P2QA 2UU9C 4DG9A 4DR5C 2ATWA 5BUSA 2WP0C 1V25A 4BC9A 5T8TA 3NYQA 4G1IA 1IBMC 4RM2A 4NDNA 3CJEA 2P2JA 1L2FA 3ETCA 2D1TA 2QW0X 5AE3A 2EGTA 2D1QA 2D1SA 5A1IA 2QL8A 4GXRA 3IEVA 2DPLA 4D57A 5BSWA 1LQLA 3I07A 4DV1C 2E8FA 4OXIA 2CXCA 2E0GA 5A1GA 5IT9D 1ZB8A 1XMQC 1XNQC 1MXBA 4DR1C 2P02A 4B3RC 4YY3C 2AYAA 4JI2C 3JAMD 4BC7A 1O9TA 5CZXA 4JI1C 4LFAC 1RG9A 1WF3A 2Y4OA 4DR3C 3OTOC 3N2QA 4IR7A 1AMUA 1MD9A 2HJGA 2BJOA 4L7IA 1QWIA 2P2FA 1N2FA 3TDEA 2UUCC 4GXQA 2D28C 3PROC 1BA3A 3IPLA 4JI6C 4JI3C 5KYVA 1RY2A 4DR7C 5BURA 4GS5A 4LF7C 4X65C 4JV5C 4OX9C 2OBVA 2P2MA 3RV2A 1XMOC 1KKGA 2VZEA 3VNQA 4YHHC 4JI7C 1HNZC 4KHPC 4LFCC 4ODJA 4L4QA 5IWAC 1P7LA 3VNRA 5CZVA 2F4VC 2ZM6C 4KTTA 5E7QA 1PA4A 4DCTA 4HPVA 2YWCA 4DV4C 3SO4A 3PESA 3J80D 2UUAC 4RLQA 2ASBA 3LAXA 4JI0C 2VQEC 4OYCA 3DAYA 3E7XA 1O90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML8 A;  1IBK C;  2QL8 A;  4DUZ C;  3IEV A;  1HR0 C;  4JYA C;  1LQL A;  2E7G A;  1USP B;  4LF9 C;  4MTN A;  3I07 A;  3GKU A;  4LF8 C;  4DV1 C;  1NYE A;  2E8F A;  4JI4 C;  2CXC A;  4BSZ A;  1USP A;  1ZB8 A;  1MKY A;  4DCS A;  5IT9 D;  1XMQ C;  1N36 C;  1HNW C;  1XNQ C;  4X66 C;  4DR1 C;  2VQF C;  4B3R C;  4AQY C;  4YY3 C;  4JI2 C;  4K0K C;  2OPL B;  3JAM D;  4NOZ A;  5LMU C;  5FLX D;  4JI1 C;  2E8C A;  4LFA C;  4DR6 C;  4LFB C;  2OPL A;  4LF5 C;  3J7A D;  4LF6 C;  1WF3 A;  1N34 C;  4DR3 C;  2DYJ A;  3OTO C;  2HHH C;  2E8E A;  4DV0 C;  2HJG A;  2BJO A;  4XX2 A;  2XR1 A;  1N32 C;  1QWI A;  1EGA A;  1N2F A;  2UUC C;  2YCB A;  3R9W A;  4MH4 A;  3T1H C;  2ONF A;  4GKK C;  3AF5 A;  4DV6 C;  1K0R A;  4JI6 C;  4JI3 C;  2D7V A;  5LMN C;  1N33 C;  4DR2 C;  4DUY C;  4DR7 C;  2CY1 A;  1FJG C;  4LF7 C;  2UXD C;  4X65 C;  4NXN C;  4JV5 C;  4NXM C;  4X62 C;  4X64 C;  4JI8 C;  3R9X A;  1UKK A;  4DCU A;  4OX9 C;  2E5L C;  1XMO C;  1KKG A;  3T1Y C;  4LF4 C;  3EER A;  1HNX C;  4YHH C;  4JI7 C;  1J5E C;  1HNZ C;  1I94 C;  4B3S C;  2UUB C;  4KHP C;  4JI5 C;  2UXC C;  1VLA A;  4LFC C;  4DR4 C;  1ZB9 A;  4DV5 C;  4B3T C;  3AF6 A;  2PT7 G;  5IWA C;  2PN2 A;  4DV3 C;  4DV2 C;  2UXB C;  4B3M C;  1HH2 P;  2JMP A;  2UU9 C;  2ATW A;  4DR5 C;  2F4V C;  5BR8 C;  2ZM6 C;  1XNR C;  1PA4 A;  4DCT A;  4DV7 C;  2KZF A;  4DV4 C;  4GKJ C;  3J81 D;  3J80 D;  1IBL C;  1IBM C;  2UUA C;  3CJE A;  1WH9 A;  4DCV A;  2ASB A;  3LUS A;  1L2F A;  5A2Q D;  3IEU A;  4JI0 C;  2VQE C;  1JOS A;  2EGT A; 
#chains in the Genus database with same CATH topology
 1P4E A;  4U5Y D;  3NPD A;  5BSM A;  1O93 A;  1XHJ A;  2CU6 A;  1HR0 C;  4JYA C;  4JM1 A;  3I08 A;  1XRB A;  1P4E C;  4FUT A;  3CW9 A;  4LF8 C;  1NYE A;  4JI4 C;  4PHT A;  4BSZ A;  3GR0 A;  4RMN A;  2JNV A;  5KYT A;  3LNV A;  4ISB A;  4FUQ A;  3L95 X;  3UOW A;  3DLP X;  2OO4 A;  4DR6 C;  5BUQ A;  4LF5 C;  3J7A D;  3K6R A;  4LF6 C;  1N34 C;  2E8E A;  3NYR A;  4DV0 C;  4XX2 A;  3L8C A;  2XR1 A;  1N32 C;  1EGA A;  2YCB A;  3R9W A;  2Y27 A;  3UX3 A;  5IFI A;  3TQI A;  3FCC A;  2M5H A;  3AF5 A;  4RM3 A;  5LMN C;  1LCI A;  3R44 A;  4DR2 C;  2UXD C;  3CQ1 A;  5BSR A;  4NXM C;  4EAT A;  3A9U A;  4X64 C;  5H9U A;  4JI8 C;  3FM7 A;  4DCU A;  2E5L C;  4WV3 A;  2YX1 A;  4LF4 C;  5AE1 A;  3TUF A;  3H2T A;  2UUB C;  2QVZ X;  1VLA A;  4DV5 C;  4B3T C;  3AF6 A;  2PT7 G;  4K0B A;  2PN2 A;  4KTV A;  4B3M C;  2Z51 A;  2KZ0 A;  3VNS A;  5KEI A;  4RVN A;  4GKJ C;  4RVO A;  2QVX X;  1IBL C;  2PG1 E;  1WH9 A;  1PG4 A;  1FUG A;  1IB8 A;  3LUS A;  3IEU A;  2BH1 X;  2V7B A;  1NY8 A;  1PU1 A;  3E7W A;  1ML8 A;  1IBK C;  1XDX A;  4R0M A;  1MXC A;  2E7G A;  4LF9 C;  1XRC A;  4D4G A;  1ULT A;  1V26 A;  4MTN A;  3GKU A;  4BBY A;  1USP A;  4DCS A;  4R1L A;  3N54 B;  3NI2 A;  4X66 C;  4K0K C;  5BSU A;  4NOZ A;  5LMU C;  5FLX D;  4LFB C;  2OPL A;  2P20 A;  5JRH A;  2ZZN A;  1T5H X;  2YWB A;  4RLF A;  2P2B A;  4BCA A;  2D1R A;  3AY0 A;  4MH4 A;  4PRO C;  2ONF A;  2Y4N A;  2VSQ A;  4GKK C;  3IML A;  4DV6 C;  2D7V A;  1T5D X;  4PUG A;  5A19 A;  2CY1 A;  4PZP A;  5BST A;  4L2Z A;  4X62 C;  2PRO A;  4ZLP A;  4DG8 A;  5K8F A;  3A9V A;  3C5E A;  3EER A;  2DHM A;  1XRA A;  4PUI A;  1YJ7 A;  4D4I A;  5DV9 A;  1I94 C;  4B3S C;  5BSV A;  4JI5 C;  1M6X A;  1MXA A;  2D27 A;  4DR4 C;  2ZTB A;  4DV3 C;  4DV2 C;  1HH2 P;  2JMP A;  2MCQ A;  3ETO A;  1M6X C;  5BR8 C;  1XNR C;  4DV7 C;  5ADZ A;  2KZF A;  2WD9 A;  4FTF A;  3J81 D;  4I9G A;  4TPS B;  2MMA B;  4DCV A;  1MDF A;  5A2Q D;  1TH5 A;  4I9F A;  4G37 A;  1JOS A;  3G7S A;  4DUZ C;  4WS9 A;  3LGX A;  3B7W A;  1USP B;  4IZ6 A;  3RG2 A;  4ZJZ A;  1N36 C;  1MKY A;  1UWD A;  5T8S A;  1HNW C;  3S82 A;  1GPM A;  2VQF C;  4AQY C;  1O92 A;  1YGT A;  2OPL B;  2QVY X;  2E8C A;  3CQ3 A;  1FLO A;  2M5O A;  3PBK A;  2DYJ A;  4G36 A;  2HHH C;  5AE2 A;  1QM4 A;  2ZZM A;  5K85 A;  3EQ6 A;  3CQ2 A;  3T1H C;  1PG3 A;  1K0R A;  3GPC A;  4LE5 A;  1N33 C;  4DUY C;  3KXW A;  3CW8 X;  4D56 A;  3UX2 A;  1FJG C;  4NXN C;  3GR1 A;  3A4I A;  3R9X A;  1UKK A;  3T1Y C;  1HNX C;  5GTD A;  3FCE A;  1J5E C;  4R1M A;  3LNO A;  2UXC C;  1ZB9 A;  2UXB C;  3UZ0 A;  1MDB A;  3DHV A;  2P2Q A;  2UU9 C;  4DG9 A;  4DR5 C;  2ATW A;  5BUS A;  2WP0 C;  1V25 A;  4BC9 A;  5T8T A;  3NYQ A;  4G1I A;  1IBM C;  4RM2 A;  4NDN A;  3CJE A;  2P2J A;  2KDN A;  1L2F A;  3ETC A;  2D1T A;  2QW0 X;  5AE3 A;  2EGT A;  2D1Q A;  2D1S A;  5A1I A;  3O2E A;  2QL8 A;  4GXR A;  3IEV A;  2DPL A;  4D57 A;  5BSW A;  1LQL A;  3I07 A;  1WCJ A;  4DV1 C;  2E8F A;  4OXI A;  2CXC A;  2E0G A;  5A1G A;  5IT9 D;  1ZB8 A;  1XMQ C;  1XNQ C;  1MXB A;  4DR1 C;  2P02 A;  4B3R C;  4YY3 C;  1VEH A;  2AYA A;  4PUH A;  4JI2 C;  3JAM D;  4BC7 A;  1O9T A;  5CZX A;  3TR3 A;  4JI1 C;  4LFA C;  1RG9 A;  1WF3 A;  2Y4O A;  4DR3 C;  3OTO C;  3N2Q A;  4IR7 A;  1AMU A;  1MD9 A;  2HJG A;  2BJO A;  4L7I A;  1QWI A;  2P2F A;  1N2F A;  3TDE A;  2UUC C;  4GXQ A;  2D28 C;  3PRO C;  1BA3 A;  3IPL A;  4JI6 C;  4JI3 C;  5KYV A;  1RY2 A;  4DR7 C;  5BUR A;  4GS5 A;  4LF7 C;  4X65 C;  4JV5 C;  4OX9 C;  2OBV A;  2P2M A;  3RV2 A;  1XMO C;  1KKG A;  2VZE A;  3VNQ A;  4YHH C;  4JI7 C;  1HNZ C;  4KHP C;  4LFC C;  2NCL A;  4ODJ A;  4L4Q A;  5IWA C;  1P7L A;  3VNR A;  5CZV A;  2F4V C;  2ZM6 C;  4KTT A;  5E7Q A;  1PA4 A;  4DCT A;  4HPV A;  2YWC A;  4DV4 C;  1XS3 A;  3SO4 A;  3PES A;  3J80 D;  3A25 A;  2UUA C;  3A26 A;  4RLQ A;  2MM9 A;  2ASB A;  3UEB A;  3LAX A;  5LCI A;  4JI0 C;  2VQE C;  4OYC A;  3DAY A;  1V60 A;  3E7X A;  1O90 A; 
#chains in the Genus database with same CATH homology
 4U5Y D;  3NPD A;  5BSM A;  1O93 A;  1HR0 C;  4JYA C;  4JM1 A;  3I08 A;  1XRB A;  4FUT A;  3CW9 A;  4LF8 C;  1NYE A;  4JI4 C;  4PHT A;  4BSZ A;  3GR0 A;  4RMN A;  5KYT A;  3LNV A;  4ISB A;  4FUQ A;  3L95 X;  3UOW A;  3DLP X;  2OO4 A;  4DR6 C;  5BUQ A;  4LF5 C;  3J7A D;  4LF6 C;  1N34 C;  2E8E A;  3NYR A;  4DV0 C;  4XX2 A;  3L8C A;  2XR1 A;  1N32 C;  1EGA A;  2YCB A;  3R9W A;  2Y27 A;  5IFI A;  3TQI A;  3FCC A;  3AF5 A;  4RM3 A;  5LMN C;  1LCI A;  3R44 A;  4DR2 C;  2UXD C;  5BSR A;  4NXM C;  4X64 C;  4EAT A;  3A9U A;  5H9U A;  4JI8 C;  4DCU A;  2E5L C;  4WV3 A;  4LF4 C;  5AE1 A;  3TUF A;  3H2T A;  2UUB C;  2QVZ X;  1VLA A;  4DV5 C;  4B3T C;  3AF6 A;  2PT7 G;  4K0B A;  2PN2 A;  4KTV A;  4B3M C;  3VNS A;  5KEI A;  4RVN A;  4GKJ C;  4RVO A;  2QVX X;  1IBL C;  1WH9 A;  1PG4 A;  1FUG A;  3LUS A;  3IEU A;  2BH1 X;  2V7B A;  3E7W A;  1ML8 A;  1IBK C;  4R0M A;  1MXC A;  2E7G A;  4LF9 C;  1XRC A;  4D4G A;  1ULT A;  1V26 A;  4MTN A;  3GKU A;  4BBY A;  1USP A;  4DCS A;  4R1L A;  3N54 B;  3NI2 A;  4X66 C;  4K0K C;  5BSU A;  4NOZ A;  5LMU C;  5FLX D;  4LFB C;  2OPL A;  2P20 A;  5JRH A;  1T5H X;  2YWB A;  4RLF A;  2P2B A;  4BCA A;  2D1R A;  4MH4 A;  4PRO C;  2ONF A;  2Y4N A;  2VSQ A;  4GKK C;  3IML A;  4DV6 C;  2D7V A;  1T5D X;  5A19 A;  2CY1 A;  4PZP A;  5BST A;  4L2Z A;  4X62 C;  2PRO A;  4ZLP A;  4DG8 A;  5K8F A;  3A9V A;  3C5E A;  3EER A;  1XRA A;  4D4I A;  1YJ7 A;  5DV9 A;  1I94 C;  4B3S C;  5BSV A;  4JI5 C;  1MXA A;  2D27 A;  4DR4 C;  4DV3 C;  4DV2 C;  1HH2 P;  2JMP A;  3ETO A;  5BR8 C;  1XNR C;  4DV7 C;  5ADZ A;  2KZF A;  2WD9 A;  4FTF A;  3J81 D;  4I9G A;  4TPS B;  4DCV A;  1MDF A;  5A2Q D;  4I9F A;  4G37 A;  1JOS A;  3G7S A;  4DUZ C;  4WS9 A;  3LGX A;  3B7W A;  1USP B;  4IZ6 A;  3RG2 A;  4ZJZ A;  1N36 C;  1MKY A;  5T8S A;  1HNW C;  3S82 A;  1GPM A;  2VQF C;  4AQY C;  1O92 A;  2OPL B;  2QVY X;  2E8C A;  3PBK A;  2DYJ A;  4G36 A;  2HHH C;  5AE2 A;  1QM4 A;  5K85 A;  3EQ6 A;  3T1H C;  1PG3 A;  1K0R A;  3GPC A;  4LE5 A;  1N33 C;  4DUY C;  3KXW A;  3CW8 X;  4D56 A;  1FJG C;  4NXN C;  3GR1 A;  3A4I A;  3R9X A;  1UKK A;  3T1Y C;  1HNX C;  5GTD A;  3FCE A;  1J5E C;  4R1M A;  2UXC C;  1ZB9 A;  2UXB C;  3UZ0 A;  1MDB A;  3DHV A;  2P2Q A;  2UU9 C;  4DG9 A;  4DR5 C;  2ATW A;  5BUS A;  2WP0 C;  1V25 A;  4BC9 A;  5T8T A;  3NYQ A;  4G1I A;  1IBM C;  4RM2 A;  4NDN A;  3CJE A;  2P2J A;  1L2F A;  3ETC A;  2D1T A;  2QW0 X;  5AE3 A;  2EGT A;  2D1Q A;  2D1S A;  5A1I A;  2QL8 A;  4GXR A;  3IEV A;  2DPL A;  4D57 A;  5BSW A;  1LQL A;  3I07 A;  4DV1 C;  2E8F A;  4OXI A;  2CXC A;  2E0G A;  5A1G A;  5IT9 D;  1ZB8 A;  1XMQ C;  1XNQ C;  1MXB A;  4DR1 C;  2P02 A;  4B3R C;  4YY3 C;  2AYA A;  4JI2 C;  3JAM D;  4BC7 A;  1O9T A;  5CZX A;  4JI1 C;  4LFA C;  1RG9 A;  1WF3 A;  2Y4O A;  4DR3 C;  3OTO C;  3N2Q A;  4IR7 A;  1AMU A;  1MD9 A;  2HJG A;  2BJO A;  4L7I A;  1QWI A;  2P2F A;  1N2F A;  3TDE A;  2UUC C;  4GXQ A;  2D28 C;  3PRO C;  1BA3 A;  3IPL A;  4JI6 C;  4JI3 C;  5KYV A;  1RY2 A;  4DR7 C;  5BUR A;  4GS5 A;  4LF7 C;  4X65 C;  4JV5 C;  4OX9 C;  2OBV A;  2P2M A;  3RV2 A;  1XMO C;  1KKG A;  2VZE A;  3VNQ A;  4YHH C;  4JI7 C;  1HNZ C;  4KHP C;  4LFC C;  4ODJ A;  4L4Q A;  5IWA C;  1P7L A;  3VNR A;  5CZV A;  2F4V C;  2ZM6 C;  4KTT A;  5E7Q A;  1PA4 A;  4DCT A;  4HPV A;  2YWC A;  4DV4 C;  3SO4 A;  3PES A;  3J80 D;  2UUA C;  4RLQ A;  2ASB A;  3LAX A;  4JI0 C;  2VQE C;  4OYC A;  3DAY A;  3E7X A;  1O90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...