4LFCC

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 52
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lfcC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lfcC02
1IBMC 2OPLA 4DV4C 1PA4A 2BJOA 3AF6A 4DR3C 4NXMC 1XNRC 1HR0C 1XMQC 2ASBA 5BR8C 2JMPA 3IEUA 4B3SC 4JI8C 4B3RC 2UUAC 3R9WA 4KHPC 2UXDC 4LFBC 2VQEC 1N2FA 1USPB 1NYEA 2PT7G 4JI3C 4JI5C 5IT9D 1USPA 2XR1A 2VQFC 4X66C 4LF5C 4DCUA 1QWIA 2UXCC 4JI0C 2YCBA 5A2QD 1LQLA 3T1YC 2UXBC 4DV2C 1FJGC 2OPLB 4K0KC 4JI1C 4JI7C 4LF7C 3J7AD 5IWAC 2D7VA 4LFAC 4LF4C 4LF9C 2ATWA 4DV7C 2DYJA 4DR2C 2EGTA 1ZB8A 4LFCC 3CJEA 2QL8A 4X62C 4YHHC 1HNXC 3JAMD 4DV6C 2PN2A 4X64C 1I94C 3GKUA 4NOZA 4DV3C 1IBKC 2UU9C 1N34C 1VLAA 1XNQC 1K0RA 4YY3C 4DUYC 4OX9C 1EGAA 2E8EA 4GKJC 5LMUC 4DR7C 3LUSA 3EERA 2F4VC 1L2FA 4X65C 1ZB9A 4DCTA 1MKYA 1N32C 2CY1A 1J5EC 4JV5C 3R9XA 2HJGA 4JI2C 4DR1C 3IEVA 3J81D 4GKKC 3OTOC 2ZM6C 5LMNC 4DR6C 4LF8C 4B3TC 4JI6C 2KZFA 5FLXD 2UUBC 1IBLC 4DV5C 3J80D 4LF6C 4DV1C 4DR4C 2E7GA 1N36C 4DCSA 3AF5A 1WH9A 1XMOC 4DR5C 4MH4A 4DUZC 2E8CA 2UUCC 4JI4C 1N33C 1KKGA 4AQYC 3T1HC 4BSZA 1WF3A 2HHHC 2E8FA 1HNWC 4B3MC 1UKKA 2CXCA 1HNZC 4DCVA 3I07A 4XX2A 4JYAC 1HH2P 2ONFA 1ML8A 4MTNA 1JOSA 2E5LC 4NXNC 4DV0C
chains in the Genus database with same CATH superfamily
3AF6A 5LCIA 3UX2A 2ASBA 5BR8C 4R1MA 4PUHA 5BSRA 3R9WA 2UXDC 2Y4NA 3A9VA 1XRAA 3L8CA 4BCAA 2VQEC 1YJ7A 4JI3C 4ZLPA 5IT9D 2P2QA 3TQIA 5BSTA 4D56A 5K8FA 2YCBA 3PBKA 4GXQA 2UXBC 1FJGC 3GPCA 1NY8A 4JI1C 4RM2A 4LF7C 1T5DX 4GS5A 3E7WA 4D57A 3IMLA 5A1GA 3JAMD 4DV6C 2PN2A 1I94C 1V60A 3PROC 1O93A 1K0RA 4NDNA 1EGAA 2V7BA 2E8EA 5BUSA 3B7WA 2F4VC 1L2FA 4X65C 1N32C 5E7QA 3TUFA 3PESA 4DR1C 3IEVA 4GKKC 3OTOC 1V26A 3FCCA 4JM1A 3A26A 2D1SA 3FCEA 1IBLC 4L2ZA 1LCIA 1MDFA 3UEBA 4DV1C 5BSUA 4DCSA 3A9UA 3NYRA 4I9FA 4DUZC 2D1QA 2E8CA 3E7XA 2QW0X 2VSQA 2D27A 3A4IA 4BSZA 3NYQA 1GPMA 5BURA 1HNWC 4B3MC 2YWCA 1JOSA 4DV0C 1MXAA 5AE3A 2OPLA 4DV4C 2JNVA 2BJOA 4PUGA 1HR0C 1FUGA 3IEUA 4B3RC 2DPLA 4KHPC 4ISBA 4LFBC 1USPB 1NYEA 2PT7G 4DG9A 5BSWA 1BA3A 1USPA 1XDXA 2UXCC 5A2QD 3T1YC 2CU6A 4U5YD 2P2FA 4K0KC 4JI7C 5IWAC 2D7VA 4FUQA 2YWBA 5JRHA 4HPVA 3EQ6A 2D28C 5CZVA 2EGTA 4RVOA 4YHHC 2Z51A 3CW8X 1HNXC 3CQ1A 1VLAA 1N34C 2MCQA 3IPLA 4BBYA 1XNQC 5H9UA 3FM7A 3R44A 4OX9C 5LMUC 1MDBA 4DR7C 2OBVA 4PUIA 4DCTA 3R9XA 4JI2C 3J81D 1V25A 4DR6C 1RG9A 4R0MA 3GR0A 4B3TC 2KZFA 5FLXD 2UUBC 3SO4A 3J80D 4LF6C 5DV9A 1ULTA 3A25A 5A1IA 4OXIA 1WH9A 3C5EA 4DR5C 4K0BA 5BSVA 4ZJZA 4LE5A 5AE2A 2WD9A 1QM4A 4AQYC 1M6XC 1WF3A 2QVYX 1T5HX 2KZ0A 2MMAB 1UKKA 2Y27A 1HNZC 3I07A 4XX2A 4JYAC 1HH2P 2DHMA 1ML8A 2ONFA 1M6XA 1IBMC 1PA4A 4R1LA 4DR3C 4NXMC 4G36A 2JMPA 4JI8C 4B3SC 3VNQA 3DHVA 2QVXX 2UUAC 1AMUA 2KDNA 4JI5C 3CQ2A 2XR1A 2YX1A 3L95X 2VQFC 3N54B 4GXRA 1RY2A 5K85A 4KTTA 4OYCA 1QWIA 2M5HA 4D4GA 1LQLA 1FLOA 1MXBA 1VEHA 5KYVA 4LFAC 4LF4C 4LF9C 2Y4OA 3DLPX 4DR2C 3RG2A 2QL8A 4X62C 3NPDA 1XHJA 3GKUA 3O2EA 4NOZA 1PG4A 2UU9C 2NCLA 3UZ0A 4YY3C 4TPSB 3N2QA 1P7LA 4KTVA 2P2MA 4WV3A 1ZB9A 4FUTA 2D1TA 1XS3A 2CY1A 1XRCA 2E0GA 3LNOA 3TR3A 2ZM6C 2P02A 4LF8C 4BC9A 3DAYA 4JI6C 5IFIA 4DV5C 1PG3A 4DR4C 1MD9A 3I08A 3G7SA 2P2BA 4MH4A 4PROC 3KXWA 4JI4C 3CW9A 1N33C 3GR1A 5KEIA 2E8FA 3LNVA 4I9GA 5T8TA 2ZZNA 5KYTA 2CXCA 4DCVA 1O90A 4NXNC 1XNRC 3ETCA 2P2JA 3RV2A 1MXCA 4RLQA 1XMQC 2ZTBA 4PZPA 2BH1X 5CZXA 2QVZX 1O92A 1N2FA 2OO4A 4BC7A 5A19A 4PHTA 5AE1A 4X66C 4LF5C 4DCUA 2VZEA 4RVNA 4JI0C 4DG8A 4IZ6A 4DV2C 2OPLB 5T8SA 3S82A 3J7AD 2PG1E 1IB8A 4EATA 2AYAA 1PU1A 2ATWA 4DV7C 2DYJA 5ADZA 5GTDA 1ZB8A 4LFCC 3ETOA 1XRBA 3CJEA 4G37A 4WS9A 3LGXA 4X64C 4DV3C 4D4IA 1IBKC 5BUQA 4DUYC 4L7IA 5BSMA 4GKJC 4FTFA 3LUSA 3EERA 2PROA 2MM9A 1MKYA 2D1RA 1P4EA 3VNRA 1J5EC 4JV5C 2WP0C 1WCJA 2HJGA 3NI2A 1O9TA 5LMNC 3CQ3A 4RLFA 3VNSA 4L4QA 4RMNA 2P20A 1UWDA 1P4EC 3LAXA 2E7GA 1N36C 3AF5A 1XMOC 1YGTA 3TDEA 3UOWA 3UX3A 2UUCC 1KKGA 3H2TA 3T1HC 3AY0A 4IR7A 2HHHC 2M5OA 4G1IA 4RM3A 2E5LC 4MTNA 1TH5A 2ZZMA 3K6RA 4ODJA
chains in the Genus database with same CATH topology
3AF6A 2ASBA 5BR8C 4R1MA 5BSRA 3R9WA 2UXDC 2Y4NA 3A9VA 1XRAA 3L8CA 4BCAA 2VQEC 1YJ7A 4JI3C 4ZLPA 5IT9D 2P2QA 3TQIA 5BSTA 4D56A 5K8FA 2YCBA 3PBKA 4GXQA 2UXBC 1FJGC 3GPCA 4JI1C 4RM2A 4LF7C 1T5DX 4GS5A 3E7WA 4D57A 3IMLA 5A1GA 3JAMD 4DV6C 2PN2A 1I94C 3PROC 1O93A 1K0RA 4NDNA 1EGAA 2V7BA 2E8EA 5BUSA 3B7WA 2F4VC 1L2FA 4X65C 1N32C 5E7QA 3TUFA 3PESA 4DR1C 3IEVA 4GKKC 3OTOC 1V26A 3FCCA 4JM1A 2D1SA 3FCEA 1IBLC 4L2ZA 1LCIA 1MDFA 4DV1C 5BSUA 4DCSA 3A9UA 3NYRA 4I9FA 4DUZC 2D1QA 2E8CA 3E7XA 2QW0X 2VSQA 2D27A 3A4IA 4BSZA 3NYQA 1GPMA 5BURA 1HNWC 4B3MC 2YWCA 1JOSA 4DV0C 1MXAA 5AE3A 2OPLA 4DV4C 2BJOA 1HR0C 1FUGA 3IEUA 4B3RC 2DPLA 4KHPC 4ISBA 4LFBC 1USPB 1NYEA 2PT7G 4DG9A 5BSWA 1BA3A 1USPA 2UXCC 5A2QD 3T1YC 4U5YD 2P2FA 4K0KC 4JI7C 5IWAC 2D7VA 4FUQA 2YWBA 5JRHA 4HPVA 3EQ6A 2D28C 5CZVA 2EGTA 4RVOA 4YHHC 1HNXC 3CW8X 1N34C 1VLAA 4BBYA 3IPLA 1XNQC 5H9UA 3R44A 4OX9C 5LMUC 1MDBA 4DR7C 2OBVA 4DCTA 3R9XA 4JI2C 3J81D 1V25A 4DR6C 1RG9A 4R0MA 3GR0A 4B3TC 2KZFA 5FLXD 2UUBC 3SO4A 3J80D 4LF6C 5DV9A 1ULTA 5A1IA 4OXIA 1WH9A 3C5EA 4DR5C 4K0BA 5BSVA 4ZJZA 4LE5A 5AE2A 2WD9A 1QM4A 4AQYC 1WF3A 2QVYX 1T5HX 1UKKA 2Y27A 1HNZC 3I07A 4XX2A 4JYAC 1HH2P 2ONFA 1ML8A 1IBMC 1PA4A 4R1LA 4DR3C 4NXMC 4G36A 2JMPA 4JI8C 4B3SC 3VNQA 3DHVA 2QVXX 2UUAC 1AMUA 4JI5C 2XR1A 3L95X 2VQFC 3N54B 4GXRA 1RY2A 5K85A 4KTTA 4OYCA 1QWIA 4D4GA 1LQLA 1MXBA 5KYVA 4LFAC 4LF4C 4LF9C 2Y4OA 3DLPX 4DR2C 3RG2A 2QL8A 4X62C 3NPDA 3GKUA 4NOZA 1PG4A 2UU9C 3UZ0A 4YY3C 4TPSB 3N2QA 1P7LA 4KTVA 2P2MA 4WV3A 1ZB9A 4FUTA 2D1TA 2CY1A 1XRCA 2E0GA 2ZM6C 2P02A 4LF8C 4BC9A 3DAYA 4JI6C 5IFIA 4DV5C 1PG3A 4DR4C 1MD9A 3I08A 3G7SA 2P2BA 4MH4A 4PROC 3KXWA 4JI4C 3CW9A 1N33C 3GR1A 5KEIA 2E8FA 3LNVA 4I9GA 5T8TA 5KYTA 2CXCA 4DCVA 1O90A 4NXNC 1XNRC 3ETCA 2P2JA 3RV2A 1MXCA 4RLQA 1XMQC 4PZPA 2BH1X 5CZXA 2QVZX 1O92A 1N2FA 2OO4A 4BC7A 5A19A 4PHTA 5AE1A 4X66C 4LF5C 4DCUA 2VZEA 4RVNA 4JI0C 4DG8A 4IZ6A 4DV2C 2OPLB 5T8SA 3S82A 3J7AD 4EATA 2AYAA 2ATWA 4DV7C 2DYJA 5ADZA 5GTDA 1ZB8A 4LFCC 3ETOA 1XRBA 3CJEA 4G37A 4WS9A 3LGXA 4X64C 4DV3C 4D4IA 1IBKC 5BUQA 4DUYC 4L7IA 5BSMA 4GKJC 4FTFA 3LUSA 3EERA 2PROA 1MKYA 2D1RA 3VNRA 1J5EC 4JV5C 2WP0C 2HJGA 3NI2A 1O9TA 5LMNC 4RLFA 3VNSA 4L4QA 4RMNA 2P20A 3LAXA 2E7GA 1N36C 3AF5A 1XMOC 3TDEA 3UOWA 2UUCC 1KKGA 3H2TA 3T1HC 4IR7A 2HHHC 4G1IA 4RM3A 2E5LC 4MTNA 4ODJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM C;  2OPL A;  4DV4 C;  1PA4 A;  2BJO A;  3AF6 A;  4DR3 C;  4NXM C;  1XNR C;  1HR0 C;  1XMQ C;  2ASB A;  5BR8 C;  2JMP A;  3IEU A;  4B3S C;  4JI8 C;  4B3R C;  2UUA C;  3R9W A;  4KHP C;  2UXD C;  4LFB C;  2VQE C;  1N2F A;  1USP B;  1NYE A;  2PT7 G;  4JI3 C;  4JI5 C;  5IT9 D;  1USP A;  2XR1 A;  2VQF C;  4X66 C;  4LF5 C;  4DCU A;  1QWI A;  2UXC C;  4JI0 C;  2YCB A;  5A2Q D;  1LQL A;  3T1Y C;  2UXB C;  4DV2 C;  1FJG C;  2OPL B;  4K0K C;  4JI1 C;  4JI7 C;  4LF7 C;  3J7A D;  5IWA C;  2D7V A;  4LFA C;  4LF4 C;  4LF9 C;  2ATW A;  4DV7 C;  2DYJ A;  4DR2 C;  2EGT A;  1ZB8 A;  4LFC C;  3CJE A;  2QL8 A;  4X62 C;  4YHH C;  1HNX C;  3JAM D;  4DV6 C;  2PN2 A;  4X64 C;  1I94 C;  3GKU A;  4NOZ A;  4DV3 C;  1IBK C;  2UU9 C;  1N34 C;  1VLA A;  1XNQ C;  1K0R A;  4YY3 C;  4DUY C;  4OX9 C;  1EGA A;  2E8E A;  4GKJ C;  5LMU C;  4DR7 C;  3LUS A;  3EER A;  2F4V C;  1L2F A;  4X65 C;  1ZB9 A;  4DCT A;  1MKY A;  1N32 C;  2CY1 A;  1J5E C;  4JV5 C;  3R9X A;  2HJG A;  4JI2 C;  4DR1 C;  3IEV A;  3J81 D;  4GKK C;  3OTO C;  2ZM6 C;  5LMN C;  4DR6 C;  4LF8 C;  4B3T C;  4JI6 C;  2KZF A;  5FLX D;  2UUB C;  1IBL C;  4DV5 C;  3J80 D;  4LF6 C;  4DV1 C;  4DR4 C;  2E7G A;  1N36 C;  4DCS A;  3AF5 A;  1WH9 A;  1XMO C;  4DR5 C;  4MH4 A;  4DUZ C;  2E8C A;  2UUC C;  4JI4 C;  1N33 C;  1KKG A;  4AQY C;  3T1H C;  4BSZ A;  1WF3 A;  2HHH C;  2E8F A;  1HNW C;  4B3M C;  1UKK A;  2CXC A;  1HNZ C;  4DCV A;  3I07 A;  4XX2 A;  4JYA C;  1HH2 P;  2ONF A;  1ML8 A;  4MTN A;  1JOS A;  2E5L C;  4NXN C;  4DV0 C; 
#chains in the Genus database with same CATH topology
 3AF6 A;  5LCI A;  3UX2 A;  2ASB A;  5BR8 C;  4R1M A;  4PUH A;  5BSR A;  3R9W A;  2UXD C;  2Y4N A;  3A9V A;  1XRA A;  3L8C A;  4BCA A;  2VQE C;  1YJ7 A;  4JI3 C;  4ZLP A;  5IT9 D;  2P2Q A;  3TQI A;  5BST A;  4D56 A;  5K8F A;  2YCB A;  3PBK A;  4GXQ A;  2UXB C;  1FJG C;  3GPC A;  1NY8 A;  4JI1 C;  4RM2 A;  4LF7 C;  1T5D X;  4GS5 A;  3E7W A;  4D57 A;  3IML A;  5A1G A;  3JAM D;  4DV6 C;  2PN2 A;  1I94 C;  1V60 A;  3PRO C;  1O93 A;  1K0R A;  4NDN A;  1EGA A;  2V7B A;  2E8E A;  5BUS A;  3B7W A;  2F4V C;  1L2F A;  4X65 C;  1N32 C;  5E7Q A;  3TUF A;  3PES A;  4DR1 C;  3IEV A;  4GKK C;  3OTO C;  1V26 A;  3FCC A;  4JM1 A;  3A26 A;  2D1S A;  3FCE A;  1IBL C;  4L2Z A;  1LCI A;  1MDF A;  3UEB A;  4DV1 C;  5BSU A;  4DCS A;  3A9U A;  3NYR A;  4I9F A;  4DUZ C;  2D1Q A;  2E8C A;  3E7X A;  2QW0 X;  2VSQ A;  2D27 A;  3A4I A;  4BSZ A;  3NYQ A;  1GPM A;  5BUR A;  1HNW C;  4B3M C;  2YWC A;  1JOS A;  4DV0 C;  1MXA A;  5AE3 A;  2OPL A;  4DV4 C;  2JNV A;  2BJO A;  4PUG A;  1HR0 C;  1FUG A;  3IEU A;  4B3R C;  2DPL A;  4KHP C;  4ISB A;  4LFB C;  1USP B;  1NYE A;  2PT7 G;  4DG9 A;  5BSW A;  1BA3 A;  1USP A;  1XDX A;  2UXC C;  5A2Q D;  3T1Y C;  2CU6 A;  4U5Y D;  2P2F A;  4K0K C;  4JI7 C;  5IWA C;  2D7V A;  4FUQ A;  2YWB A;  5JRH A;  4HPV A;  3EQ6 A;  2D28 C;  5CZV A;  2EGT A;  4RVO A;  4YHH C;  2Z51 A;  3CW8 X;  1HNX C;  3CQ1 A;  1VLA A;  1N34 C;  2MCQ A;  3IPL A;  4BBY A;  1XNQ C;  5H9U A;  3FM7 A;  3R44 A;  4OX9 C;  5LMU C;  1MDB A;  4DR7 C;  2OBV A;  4PUI A;  4DCT A;  3R9X A;  4JI2 C;  3J81 D;  1V25 A;  4DR6 C;  1RG9 A;  4R0M A;  3GR0 A;  4B3T C;  2KZF A;  5FLX D;  2UUB C;  3SO4 A;  3J80 D;  4LF6 C;  5DV9 A;  1ULT A;  3A25 A;  5A1I A;  4OXI A;  1WH9 A;  3C5E A;  4DR5 C;  4K0B A;  5BSV A;  4ZJZ A;  4LE5 A;  5AE2 A;  2WD9 A;  1QM4 A;  4AQY C;  1M6X C;  1WF3 A;  2QVY X;  1T5H X;  2KZ0 A;  2MMA B;  1UKK A;  2Y27 A;  1HNZ C;  3I07 A;  4XX2 A;  4JYA C;  1HH2 P;  2DHM A;  1ML8 A;  2ONF A;  1M6X A;  1IBM C;  1PA4 A;  4R1L A;  4DR3 C;  4NXM C;  4G36 A;  2JMP A;  4JI8 C;  4B3S C;  3VNQ A;  3DHV A;  2QVX X;  2UUA C;  1AMU A;  2KDN A;  4JI5 C;  3CQ2 A;  2XR1 A;  2YX1 A;  3L95 X;  2VQF C;  3N54 B;  4GXR A;  1RY2 A;  5K85 A;  4KTT A;  4OYC A;  1QWI A;  2M5H A;  4D4G A;  1LQL A;  1FLO A;  1MXB A;  1VEH A;  5KYV A;  4LFA C;  4LF4 C;  4LF9 C;  2Y4O A;  3DLP X;  4DR2 C;  3RG2 A;  2QL8 A;  4X62 C;  3NPD A;  1XHJ A;  3GKU A;  3O2E A;  4NOZ A;  1PG4 A;  2UU9 C;  2NCL A;  3UZ0 A;  4YY3 C;  4TPS B;  3N2Q A;  1P7L A;  4KTV A;  2P2M A;  4WV3 A;  1ZB9 A;  4FUT A;  2D1T A;  1XS3 A;  2CY1 A;  1XRC A;  2E0G A;  3LNO A;  3TR3 A;  2ZM6 C;  2P02 A;  4LF8 C;  4BC9 A;  3DAY A;  4JI6 C;  5IFI A;  4DV5 C;  1PG3 A;  4DR4 C;  1MD9 A;  3I08 A;  3G7S A;  2P2B A;  4MH4 A;  4PRO C;  3KXW A;  4JI4 C;  3CW9 A;  1N33 C;  3GR1 A;  5KEI A;  2E8F A;  3LNV A;  4I9G A;  5T8T A;  2ZZN A;  5KYT A;  2CXC A;  4DCV A;  1O90 A;  4NXN C;  1XNR C;  3ETC A;  2P2J A;  3RV2 A;  1MXC A;  4RLQ A;  1XMQ C;  2ZTB A;  4PZP A;  2BH1 X;  5CZX A;  2QVZ X;  1O92 A;  1N2F A;  2OO4 A;  4BC7 A;  5A19 A;  4PHT A;  5AE1 A;  4X66 C;  4LF5 C;  4DCU A;  2VZE A;  4RVN A;  4JI0 C;  4DG8 A;  4IZ6 A;  4DV2 C;  2OPL B;  5T8S A;  3S82 A;  3J7A D;  2PG1 E;  1IB8 A;  4EAT A;  2AYA A;  1PU1 A;  2ATW A;  4DV7 C;  2DYJ A;  5ADZ A;  5GTD A;  1ZB8 A;  4LFC C;  3ETO A;  1XRB A;  3CJE A;  4G37 A;  4WS9 A;  3LGX A;  4X64 C;  4DV3 C;  4D4I A;  1IBK C;  5BUQ A;  4DUY C;  4L7I A;  5BSM A;  4GKJ C;  4FTF A;  3LUS A;  3EER A;  2PRO A;  2MM9 A;  1MKY A;  2D1R A;  1P4E A;  3VNR A;  1J5E C;  4JV5 C;  2WP0 C;  1WCJ A;  2HJG A;  3NI2 A;  1O9T A;  5LMN C;  3CQ3 A;  4RLF A;  3VNS A;  4L4Q A;  4RMN A;  2P20 A;  1UWD A;  1P4E C;  3LAX A;  2E7G A;  1N36 C;  3AF5 A;  1XMO C;  1YGT A;  3TDE A;  3UOW A;  3UX3 A;  2UUC C;  1KKG A;  3H2T A;  3T1H C;  3AY0 A;  4IR7 A;  2HHH C;  2M5O A;  4G1I A;  4RM3 A;  2E5L C;  4MTN A;  1TH5 A;  2ZZM A;  3K6R A;  4ODJ A; 
#chains in the Genus database with same CATH homology
 3AF6 A;  2ASB A;  5BR8 C;  4R1M A;  5BSR A;  3R9W A;  2UXD C;  2Y4N A;  3A9V A;  1XRA A;  3L8C A;  4BCA A;  2VQE C;  1YJ7 A;  4JI3 C;  4ZLP A;  5IT9 D;  2P2Q A;  3TQI A;  5BST A;  4D56 A;  5K8F A;  2YCB A;  3PBK A;  4GXQ A;  2UXB C;  1FJG C;  3GPC A;  4JI1 C;  4RM2 A;  4LF7 C;  1T5D X;  4GS5 A;  3E7W A;  4D57 A;  3IML A;  5A1G A;  3JAM D;  4DV6 C;  2PN2 A;  1I94 C;  3PRO C;  1O93 A;  1K0R A;  4NDN A;  1EGA A;  2V7B A;  2E8E A;  5BUS A;  3B7W A;  2F4V C;  1L2F A;  4X65 C;  1N32 C;  5E7Q A;  3TUF A;  3PES A;  4DR1 C;  3IEV A;  4GKK C;  3OTO C;  1V26 A;  3FCC A;  4JM1 A;  2D1S A;  3FCE A;  1IBL C;  4L2Z A;  1LCI A;  1MDF A;  4DV1 C;  5BSU A;  4DCS A;  3A9U A;  3NYR A;  4I9F A;  4DUZ C;  2D1Q A;  2E8C A;  3E7X A;  2QW0 X;  2VSQ A;  2D27 A;  3A4I A;  4BSZ A;  3NYQ A;  1GPM A;  5BUR A;  1HNW C;  4B3M C;  2YWC A;  1JOS A;  4DV0 C;  1MXA A;  5AE3 A;  2OPL A;  4DV4 C;  2BJO A;  1HR0 C;  1FUG A;  3IEU A;  4B3R C;  2DPL A;  4KHP C;  4ISB A;  4LFB C;  1USP B;  1NYE A;  2PT7 G;  4DG9 A;  5BSW A;  1BA3 A;  1USP A;  2UXC C;  5A2Q D;  3T1Y C;  4U5Y D;  2P2F A;  4K0K C;  4JI7 C;  5IWA C;  2D7V A;  4FUQ A;  2YWB A;  5JRH A;  4HPV A;  3EQ6 A;  2D28 C;  5CZV A;  2EGT A;  4RVO A;  4YHH C;  1HNX C;  3CW8 X;  1N34 C;  1VLA A;  4BBY A;  3IPL A;  1XNQ C;  5H9U A;  3R44 A;  4OX9 C;  5LMU C;  1MDB A;  4DR7 C;  2OBV A;  4DCT A;  3R9X A;  4JI2 C;  3J81 D;  1V25 A;  4DR6 C;  1RG9 A;  4R0M A;  3GR0 A;  4B3T C;  2KZF A;  5FLX D;  2UUB C;  3SO4 A;  3J80 D;  4LF6 C;  5DV9 A;  1ULT A;  5A1I A;  4OXI A;  1WH9 A;  3C5E A;  4DR5 C;  4K0B A;  5BSV A;  4ZJZ A;  4LE5 A;  5AE2 A;  2WD9 A;  1QM4 A;  4AQY C;  1WF3 A;  2QVY X;  1T5H X;  1UKK A;  2Y27 A;  1HNZ C;  3I07 A;  4XX2 A;  4JYA C;  1HH2 P;  2ONF A;  1ML8 A;  1IBM C;  1PA4 A;  4R1L A;  4DR3 C;  4NXM C;  4G36 A;  2JMP A;  4JI8 C;  4B3S C;  3VNQ A;  3DHV A;  2QVX X;  2UUA C;  1AMU A;  4JI5 C;  2XR1 A;  3L95 X;  2VQF C;  3N54 B;  4GXR A;  1RY2 A;  5K85 A;  4KTT A;  4OYC A;  1QWI A;  4D4G A;  1LQL A;  1MXB A;  5KYV A;  4LFA C;  4LF4 C;  4LF9 C;  2Y4O A;  3DLP X;  4DR2 C;  3RG2 A;  2QL8 A;  4X62 C;  3NPD A;  3GKU A;  4NOZ A;  1PG4 A;  2UU9 C;  3UZ0 A;  4YY3 C;  4TPS B;  3N2Q A;  1P7L A;  4KTV A;  2P2M A;  4WV3 A;  1ZB9 A;  4FUT A;  2D1T A;  2CY1 A;  1XRC A;  2E0G A;  2ZM6 C;  2P02 A;  4LF8 C;  4BC9 A;  3DAY A;  4JI6 C;  5IFI A;  4DV5 C;  1PG3 A;  4DR4 C;  1MD9 A;  3I08 A;  3G7S A;  2P2B A;  4MH4 A;  4PRO C;  3KXW A;  4JI4 C;  3CW9 A;  1N33 C;  3GR1 A;  5KEI A;  2E8F A;  3LNV A;  4I9G A;  5T8T A;  5KYT A;  2CXC A;  4DCV A;  1O90 A;  4NXN C;  1XNR C;  3ETC A;  2P2J A;  3RV2 A;  1MXC A;  4RLQ A;  1XMQ C;  4PZP A;  2BH1 X;  5CZX A;  2QVZ X;  1O92 A;  1N2F A;  2OO4 A;  4BC7 A;  5A19 A;  4PHT A;  5AE1 A;  4X66 C;  4LF5 C;  4DCU A;  2VZE A;  4RVN A;  4JI0 C;  4DG8 A;  4IZ6 A;  4DV2 C;  2OPL B;  5T8S A;  3S82 A;  3J7A D;  4EAT A;  2AYA A;  2ATW A;  4DV7 C;  2DYJ A;  5ADZ A;  5GTD A;  1ZB8 A;  4LFC C;  3ETO A;  1XRB A;  3CJE A;  4G37 A;  4WS9 A;  3LGX A;  4X64 C;  4DV3 C;  4D4I A;  1IBK C;  5BUQ A;  4DUY C;  4L7I A;  5BSM A;  4GKJ C;  4FTF A;  3LUS A;  3EER A;  2PRO A;  1MKY A;  2D1R A;  3VNR A;  1J5E C;  4JV5 C;  2WP0 C;  2HJG A;  3NI2 A;  1O9T A;  5LMN C;  4RLF A;  3VNS A;  4L4Q A;  4RMN A;  2P20 A;  3LAX A;  2E7G A;  1N36 C;  3AF5 A;  1XMO C;  3TDE A;  3UOW A;  2UUC C;  1KKG A;  3H2T A;  3T1H C;  4IR7 A;  2HHH C;  4G1I A;  4RM3 A;  2E5L C;  4MTN A;  4ODJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...