4LFCC

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 52
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lfcC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lfcC02
1USPA 4DR3C 3LUSA 4B3RC 4DCVA 1IBMC 4JI5C 2EGTA 3AF5A 1HNXC 2E5LC 3CJEA 3IEUA 2QL8A 2ONFA 4XX2A 1KKGA 4JI4C 1MKYA 4MTNA 4BSZA 2PT7G 2HHHC 3R9XA 1ZB9A 1N34C 1PA4A 2CY1A 2UXCC 1ML8A 3IEVA 4B3MC 1UKKA 4DV3C 3T1HC 4LF5C 2BJOA 2E8FA 1IBLC 4DV6C 2ZM6C 1USPB 5LMUC 2PN2A 4JI2C 5FLXD 1NYEA 2JMPA 4DR2C 2E7GA 4DV1C 4B3SC 4LFAC 2CXCA 4NOZA 1HH2P 2HJGA 4AQYC 4GKKC 4NXNC 2F4VC 4DV5C 1N32C 4NXMC 1LQLA 4KHPC 3J81D 4DCTA 2XR1A 4X65C 4DCUA 4X62C 4OX9C 1FJGC 3JAMD 2OPLA 4DV7C 1I94C 1XNRC 4JI8C 3GKUA 1L2FA 3AF6A 2YCBA 2UU9C 4JI6C 1ZB8A 4DR1C 3R9WA 2UXBC 1JOSA 4DR5C 4LF4C 1K0RA 4MH4A 4YHHC 2VQFC 4LF9C 1XNQC 1N36C 4YY3C 1J5EC 4K0KC 3T1YC 2ASBA 2VQEC 4JYAC 1N33C 2E8CA 1XMOC 3J7AD 2D7VA 2KZFA 2DYJA 4DUYC 4LF6C 1IBKC 4JI1C 2UUAC 5IT9D 2UXDC 4LFBC 4DV2C 4B3TC 1HNZC 4JI7C 3EERA 4DR7C 2E8EA 1HNWC 4DV4C 1EGAA 2UUBC 2ATWA 2OPLB 1N2FA 1XMQC 3OTOC 4LF7C 5LMNC 5A2QD 3J80D 4LFCC 4GKJC 1WH9A 2UUCC 4LF8C 4DR4C 3I07A 4JI0C 4DV0C 4X66C 4JV5C 1HR0C 1WF3A 4DR6C 4JI3C 5IWAC 4DUZC 4DCSA 4X64C 1QWIA 1VLAA 5BR8C
chains in the Genus database with same CATH superfamily
2D1TA 2YWBA 3LUSA 4B3RC 4DCVA 2VZEA 5CZXA 2P2FA 4XX2A 1FLOA 4JI4C 3LNVA 4MTNA 3C5EA 2HHHC 1ZB9A 2BH1X 5T8SA 1QM4A 4BC9A 3N54B 3GR1A 4ODJA 3T1HC 4GS5A 4LF5C 2BJOA 2E8FA 3A4IA 1USPB 2WD9A 2JNVA 3NI2A 5LMUC 1T5DX 4JI2C 4DG8A 2JMPA 4DV1C 2P20A 4R1LA 4NOZA 4RVOA 2HJGA 2F4VC 2Y27A 2DPLA 4D4GA 3J81D 1P4EA 3IPLA 4FUQA 3ETCA 3FCEA 4G36A 2OPLA 2P2QA 4DV7C 4JI8C 3GKUA 1L2FA 3R9WA 4LF4C 3EQ6A 4YHHC 4LF9C 1XNQC 5E7QA 4GXRA 2ASBA 2VQEC 2P2MA 1N33C 4KTTA 1XMOC 3NPDA 3AY0A 1RG9A 2UUAC 2UXDC 2OBVA 4RLFA 4JI7C 2E8EA 2WP0C 4RLQA 3E7WA 1MXAA 2ATWA 3CQ1A 1FUGA 3OTOC 2D1RA 1PG3A 1LCIA 4IZ6A 2M5HA 5IFIA 4PUIA 4LFCC 4PUHA 4FTFA 3UZ0A 4JI0C 1P4EC 4ZLPA 4DR6C 4DUZC 2QVYX 4OYCA 5BSRA 4R0MA 1USPA 1IBMC 4JI5C 2QVXX 2Y4OA 1HNXC 1MDFA 2QL8A 4D57A 1KKGA 3TQIA 5JRHA 1BA3A 3L95X 5BSWA 3A25A 3O2EA 1AMUA 2PT7G 5LCIA 1GPMA 2AYAA 4B3MC 1UKKA 1IBLC 3UX3A 2PN2A 5FLXD 1XHJA 2E7GA 4RVNA 2YX1A 3K6RA 4B3SC 1RY2A 4LFAC 2MCQA 4L4QA 4PROC 3UEBA 4AQYC 3LNOA 4DV5C 2E0GA 4BBYA 3UOWA 1P7LA 3GR0A 4DCTA 4X65C 4X62C 1UWDA 3DHVA 5A1GA 3FCCA 3JAMD 4I9GA 3AF6A 4BC7A 4JI6C 4MH4A 3CQ3A 4LE5A 1N36C 3R44A 4YY3C 3NYQA 2DHMA 4JYAC 2E8CA 3RG2A 2D1SA 2DYJA 5BURA 4LF6C 4JI1C 4B3TC 2P02A 1HNZC 3EERA 3DLPX 4DV4C 1EGAA 1N2FA 4U5YD 4PUGA 1O92A 1XRAA 2Y4NA 5ADZA 1XRBA 5BUQA 5AE2A 4DV0C 4JV5C 1WF3A 4WV3A 1PU1A 4X64C 4GXQA 2YWCA 4G37A 5BSTA 4DR3C 4FUTA 2V7BA 5KYVA 2EGTA 3CJEA 3IEUA 5K8FA 1M6XA 3KXWA 5BSMA 4BSZA 3R9XA 1PA4A 3SO4A 4BCAA 1ML8A 1O90A 1MXCA 2MM9A 4D4IA 2M5OA 3UX2A 4DV6C 4L7IA 1TH5A 5KEIA 3N2QA 4DR2C 3H2TA 3B7WA 2CXCA 1XRCA 4I9FA 4GKKC 4NXNC 3CQ2A 1LQLA 1V26A 4KHPC 4D56A 1VEHA 4DCUA 4G1IA 3L8CA 4OX9C 3VNQA 1XNRC 1V60A 2YCBA 1V25A 1T5HX 2UXBC 4IR7A 1JOSA 1K0RA 2VQFC 1M6XC 1J5EC 3T1YC 4KTVA 1WCJA 2P2JA 3VNSA 5T8TA 2KZFA 2VSQA 5BUSA 1IBKC 2Z51A 5A19A 3VNRA 4DV2C 3G7SA 5K85A 1O9TA 5KYTA 2QVZX 5GTDA 5LMNC 1O93A 5A2QD 3J80D 3IMLA 5BSVA 4LF8C 5BSUA 2D28C 2KDNA 4HPVA 4R1MA 4JI3C 5IWAC 4DCSA 1QWIA 1ULTA 1VLAA 3PROC 3TR3A 5BR8C 1MDBA 4NDNA 3GPCA 3AF5A 3A9VA 2E5LC 3DAYA 2ONFA 3E7XA 5DV9A 4PZPA 1MKYA 5AE3A 3FM7A 2ZZMA 1N34C 5CZVA 2CY1A 2UXCC 3IEVA 3RV2A 4RM3A 3CW9A 4DV3C 5A1IA 2CU6A 2P2BA 3S82A 4WS9A 3PBKA 2ZM6C 2QW0X 3TDEA 1NYEA 3LGXA 2ZTBA 1HH2P 3A26A 1N32C 4NXMC 2XR1A 1FJGC 1PG4A 4PHTA 1YGTA 1NY8A 1I94C 2UU9C 4ZJZA 1ZB8A 4DR1C 4DR5C 3A9UA 2D1QA 3TUFA 3PESA 4K0KC 2MMAB 5H9UA 1XS3A 1XDXA 3J7AD 2D7VA 4RM2A 4EATA 4L2ZA 3ETOA 4DUYC 4K0BA 5IT9D 3I08A 1YJ7A 4LFBC 2ZZNA 4DR7C 4OXIA 1HNWC 3NYRA 5AE1A 2UUBC 4JM1A 3CW8X 4RMNA 1IB8A 2OPLB 2NCLA 1XMQC 1MD9A 2PROA 3LAXA 4LF7C 4TPSB 4ISBA 4GKJC 1WH9A 2UUCC 4DR4C 2D27A 3I07A 4DG9A 2OO4A 2PG1E 4X66C 1HR0C 2KZ0A 1MXBA
chains in the Genus database with same CATH topology
2D1TA 2YWBA 3LUSA 4B3RC 4DCVA 2VZEA 5CZXA 2P2FA 4XX2A 4JI4C 3LNVA 4MTNA 3C5EA 2HHHC 1ZB9A 2BH1X 5T8SA 1QM4A 4BC9A 3N54B 3GR1A 4ODJA 3T1HC 4GS5A 4LF5C 2BJOA 2E8FA 3A4IA 1USPB 2WD9A 3NI2A 5LMUC 1T5DX 4JI2C 4DG8A 2JMPA 4DV1C 2P20A 4R1LA 4NOZA 4RVOA 2HJGA 2F4VC 2Y27A 2DPLA 4D4GA 3J81D 3IPLA 4FUQA 3ETCA 3FCEA 4G36A 2OPLA 2P2QA 4DV7C 4JI8C 3GKUA 1L2FA 3R9WA 4LF4C 3EQ6A 4YHHC 4LF9C 1XNQC 5E7QA 4GXRA 2ASBA 2VQEC 2P2MA 1N33C 4KTTA 1XMOC 3NPDA 1RG9A 2UUAC 2UXDC 2OBVA 4RLFA 4JI7C 2E8EA 2WP0C 4RLQA 3E7WA 1MXAA 2ATWA 1FUGA 3OTOC 2D1RA 1PG3A 1LCIA 4IZ6A 5IFIA 4LFCC 4FTFA 3UZ0A 4JI0C 4ZLPA 4DR6C 4DUZC 2QVYX 4OYCA 5BSRA 4R0MA 1USPA 1IBMC 4JI5C 2QVXX 2Y4OA 1HNXC 1MDFA 2QL8A 4D57A 1KKGA 3TQIA 5JRHA 1BA3A 3L95X 5BSWA 1AMUA 2PT7G 1GPMA 2AYAA 4B3MC 1UKKA 1IBLC 2PN2A 5FLXD 2E7GA 4RVNA 4B3SC 1RY2A 4LFAC 4L4QA 4PROC 4AQYC 4DV5C 2E0GA 4BBYA 3UOWA 1P7LA 3GR0A 4DCTA 4X65C 4X62C 3DHVA 5A1GA 3FCCA 3JAMD 4I9GA 3AF6A 4BC7A 4JI6C 4MH4A 4LE5A 1N36C 3R44A 4YY3C 3NYQA 4JYAC 2E8CA 3RG2A 2D1SA 2DYJA 5BURA 4LF6C 4JI1C 4B3TC 2P02A 1HNZC 3EERA 3DLPX 4DV4C 1EGAA 1N2FA 4U5YD 1O92A 1XRAA 2Y4NA 5ADZA 1XRBA 5BUQA 5AE2A 4DV0C 4JV5C 1WF3A 4WV3A 4X64C 4GXQA 2YWCA 4G37A 5BSTA 4DR3C 4FUTA 2V7BA 5KYVA 2EGTA 3CJEA 3IEUA 5K8FA 3KXWA 5BSMA 4BSZA 3R9XA 1PA4A 3SO4A 4BCAA 1ML8A 1O90A 1MXCA 4D4IA 4DV6C 4L7IA 5KEIA 3N2QA 4DR2C 3H2TA 3B7WA 2CXCA 1XRCA 4I9FA 4GKKC 4NXNC 1LQLA 1V26A 4KHPC 4D56A 4DCUA 4G1IA 3L8CA 4OX9C 3VNQA 1XNRC 2YCBA 1V25A 1T5HX 2UXBC 4IR7A 1JOSA 1K0RA 2VQFC 1J5EC 3T1YC 4KTVA 2P2JA 3VNSA 5T8TA 2KZFA 2VSQA 5BUSA 1IBKC 5A19A 3VNRA 4DV2C 3G7SA 5K85A 1O9TA 5KYTA 2QVZX 5GTDA 5LMNC 1O93A 5A2QD 3J80D 3IMLA 5BSVA 4LF8C 5BSUA 2D28C 4HPVA 4R1MA 4JI3C 5IWAC 4DCSA 1QWIA 1ULTA 1VLAA 3PROC 5BR8C 1MDBA 4NDNA 3GPCA 3AF5A 3A9VA 2E5LC 3DAYA 2ONFA 3E7XA 5DV9A 4PZPA 1MKYA 5AE3A 1N34C 5CZVA 2CY1A 2UXCC 3IEVA 3RV2A 4RM3A 3CW9A 4DV3C 5A1IA 2P2BA 3S82A 4WS9A 3PBKA 2ZM6C 2QW0X 3TDEA 1NYEA 3LGXA 1HH2P 1N32C 4NXMC 2XR1A 1FJGC 1PG4A 4PHTA 1I94C 2UU9C 4ZJZA 1ZB8A 4DR1C 4DR5C 3A9UA 2D1QA 3TUFA 3PESA 4K0KC 5H9UA 3J7AD 2D7VA 4RM2A 4EATA 4L2ZA 3ETOA 4DUYC 4K0BA 5IT9D 3I08A 1YJ7A 4LFBC 4DR7C 4OXIA 1HNWC 3NYRA 5AE1A 2UUBC 4JM1A 3CW8X 4RMNA 2OPLB 1XMQC 1MD9A 2PROA 3LAXA 4LF7C 4TPSB 4ISBA 4GKJC 1WH9A 2UUCC 4DR4C 2D27A 3I07A 4DG9A 2OO4A 4X66C 1HR0C 1MXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP A;  4DR3 C;  3LUS A;  4B3R C;  4DCV A;  1IBM C;  4JI5 C;  2EGT A;  3AF5 A;  1HNX C;  2E5L C;  3CJE A;  3IEU A;  2QL8 A;  2ONF A;  4XX2 A;  1KKG A;  4JI4 C;  1MKY A;  4MTN A;  4BSZ A;  2PT7 G;  2HHH C;  3R9X A;  1ZB9 A;  1N34 C;  1PA4 A;  2CY1 A;  2UXC C;  1ML8 A;  3IEV A;  4B3M C;  1UKK A;  4DV3 C;  3T1H C;  4LF5 C;  2BJO A;  2E8F A;  1IBL C;  4DV6 C;  2ZM6 C;  1USP B;  5LMU C;  2PN2 A;  4JI2 C;  5FLX D;  1NYE A;  2JMP A;  4DR2 C;  2E7G A;  4DV1 C;  4B3S C;  4LFA C;  2CXC A;  4NOZ A;  1HH2 P;  2HJG A;  4AQY C;  4GKK C;  4NXN C;  2F4V C;  4DV5 C;  1N32 C;  4NXM C;  1LQL A;  4KHP C;  3J81 D;  4DCT A;  2XR1 A;  4X65 C;  4DCU A;  4X62 C;  4OX9 C;  1FJG C;  3JAM D;  2OPL A;  4DV7 C;  1I94 C;  1XNR C;  4JI8 C;  3GKU A;  1L2F A;  3AF6 A;  2YCB A;  2UU9 C;  4JI6 C;  1ZB8 A;  4DR1 C;  3R9W A;  2UXB C;  1JOS A;  4DR5 C;  4LF4 C;  1K0R A;  4MH4 A;  4YHH C;  2VQF C;  4LF9 C;  1XNQ C;  1N36 C;  4YY3 C;  1J5E C;  4K0K C;  3T1Y C;  2ASB A;  2VQE C;  4JYA C;  1N33 C;  2E8C A;  1XMO C;  3J7A D;  2D7V A;  2KZF A;  2DYJ A;  4DUY C;  4LF6 C;  1IBK C;  4JI1 C;  2UUA C;  5IT9 D;  2UXD C;  4LFB C;  4DV2 C;  4B3T C;  1HNZ C;  4JI7 C;  3EER A;  4DR7 C;  2E8E A;  1HNW C;  4DV4 C;  1EGA A;  2UUB C;  2ATW A;  2OPL B;  1N2F A;  1XMQ C;  3OTO C;  4LF7 C;  5LMN C;  5A2Q D;  3J80 D;  4LFC C;  4GKJ C;  1WH9 A;  2UUC C;  4LF8 C;  4DR4 C;  3I07 A;  4JI0 C;  4DV0 C;  4X66 C;  4JV5 C;  1HR0 C;  1WF3 A;  4DR6 C;  4JI3 C;  5IWA C;  4DUZ C;  4DCS A;  4X64 C;  1QWI A;  1VLA A;  5BR8 C; 
#chains in the Genus database with same CATH topology
 2D1T A;  2YWB A;  3LUS A;  4B3R C;  4DCV A;  2VZE A;  5CZX A;  2P2F A;  4XX2 A;  1FLO A;  4JI4 C;  3LNV A;  4MTN A;  3C5E A;  2HHH C;  1ZB9 A;  2BH1 X;  5T8S A;  1QM4 A;  4BC9 A;  3N54 B;  3GR1 A;  4ODJ A;  3T1H C;  4GS5 A;  4LF5 C;  2BJO A;  2E8F A;  3A4I A;  1USP B;  2WD9 A;  2JNV A;  3NI2 A;  5LMU C;  1T5D X;  4JI2 C;  4DG8 A;  2JMP A;  4DV1 C;  2P20 A;  4R1L A;  4NOZ A;  4RVO A;  2HJG A;  2F4V C;  2Y27 A;  2DPL A;  4D4G A;  3J81 D;  1P4E A;  3IPL A;  4FUQ A;  3ETC A;  3FCE A;  4G36 A;  2OPL A;  2P2Q A;  4DV7 C;  4JI8 C;  3GKU A;  1L2F A;  3R9W A;  4LF4 C;  3EQ6 A;  4YHH C;  4LF9 C;  1XNQ C;  5E7Q A;  4GXR A;  2ASB A;  2VQE C;  2P2M A;  1N33 C;  4KTT A;  1XMO C;  3NPD A;  3AY0 A;  1RG9 A;  2UUA C;  2UXD C;  2OBV A;  4RLF A;  4JI7 C;  2E8E A;  2WP0 C;  4RLQ A;  3E7W A;  1MXA A;  2ATW A;  3CQ1 A;  1FUG A;  3OTO C;  2D1R A;  1PG3 A;  1LCI A;  4IZ6 A;  2M5H A;  5IFI A;  4PUI A;  4LFC C;  4PUH A;  4FTF A;  3UZ0 A;  4JI0 C;  1P4E C;  4ZLP A;  4DR6 C;  4DUZ C;  2QVY X;  4OYC A;  5BSR A;  4R0M A;  1USP A;  1IBM C;  4JI5 C;  2QVX X;  2Y4O A;  1HNX C;  1MDF A;  2QL8 A;  4D57 A;  1KKG A;  3TQI A;  5JRH A;  1BA3 A;  3L95 X;  5BSW A;  3A25 A;  3O2E A;  1AMU A;  2PT7 G;  5LCI A;  1GPM A;  2AYA A;  4B3M C;  1UKK A;  1IBL C;  3UX3 A;  2PN2 A;  5FLX D;  1XHJ A;  2E7G A;  4RVN A;  2YX1 A;  3K6R A;  4B3S C;  1RY2 A;  4LFA C;  2MCQ A;  4L4Q A;  4PRO C;  3UEB A;  4AQY C;  3LNO A;  4DV5 C;  2E0G A;  4BBY A;  3UOW A;  1P7L A;  3GR0 A;  4DCT A;  4X65 C;  4X62 C;  1UWD A;  3DHV A;  5A1G A;  3FCC A;  3JAM D;  4I9G A;  3AF6 A;  4BC7 A;  4JI6 C;  4MH4 A;  3CQ3 A;  4LE5 A;  1N36 C;  3R44 A;  4YY3 C;  3NYQ A;  2DHM A;  4JYA C;  2E8C A;  3RG2 A;  2D1S A;  2DYJ A;  5BUR A;  4LF6 C;  4JI1 C;  4B3T C;  2P02 A;  1HNZ C;  3EER A;  3DLP X;  4DV4 C;  1EGA A;  1N2F A;  4U5Y D;  4PUG A;  1O92 A;  1XRA A;  2Y4N A;  5ADZ A;  1XRB A;  5BUQ A;  5AE2 A;  4DV0 C;  4JV5 C;  1WF3 A;  4WV3 A;  1PU1 A;  4X64 C;  4GXQ A;  2YWC A;  4G37 A;  5BST A;  4DR3 C;  4FUT A;  2V7B A;  5KYV A;  2EGT A;  3CJE A;  3IEU A;  5K8F A;  1M6X A;  3KXW A;  5BSM A;  4BSZ A;  3R9X A;  1PA4 A;  3SO4 A;  4BCA A;  1ML8 A;  1O90 A;  1MXC A;  2MM9 A;  4D4I A;  2M5O A;  3UX2 A;  4DV6 C;  4L7I A;  1TH5 A;  5KEI A;  3N2Q A;  4DR2 C;  3H2T A;  3B7W A;  2CXC A;  1XRC A;  4I9F A;  4GKK C;  4NXN C;  3CQ2 A;  1LQL A;  1V26 A;  4KHP C;  4D56 A;  1VEH A;  4DCU A;  4G1I A;  3L8C A;  4OX9 C;  3VNQ A;  1XNR C;  1V60 A;  2YCB A;  1V25 A;  1T5H X;  2UXB C;  4IR7 A;  1JOS A;  1K0R A;  2VQF C;  1M6X C;  1J5E C;  3T1Y C;  4KTV A;  1WCJ A;  2P2J A;  3VNS A;  5T8T A;  2KZF A;  2VSQ A;  5BUS A;  1IBK C;  2Z51 A;  5A19 A;  3VNR A;  4DV2 C;  3G7S A;  5K85 A;  1O9T A;  5KYT A;  2QVZ X;  5GTD A;  5LMN C;  1O93 A;  5A2Q D;  3J80 D;  3IML A;  5BSV A;  4LF8 C;  5BSU A;  2D28 C;  2KDN A;  4HPV A;  4R1M A;  4JI3 C;  5IWA C;  4DCS A;  1QWI A;  1ULT A;  1VLA A;  3PRO C;  3TR3 A;  5BR8 C;  1MDB A;  4NDN A;  3GPC A;  3AF5 A;  3A9V A;  2E5L C;  3DAY A;  2ONF A;  3E7X A;  5DV9 A;  4PZP A;  1MKY A;  5AE3 A;  3FM7 A;  2ZZM A;  1N34 C;  5CZV A;  2CY1 A;  2UXC C;  3IEV A;  3RV2 A;  4RM3 A;  3CW9 A;  4DV3 C;  5A1I A;  2CU6 A;  2P2B A;  3S82 A;  4WS9 A;  3PBK A;  2ZM6 C;  2QW0 X;  3TDE A;  1NYE A;  3LGX A;  2ZTB A;  1HH2 P;  3A26 A;  1N32 C;  4NXM C;  2XR1 A;  1FJG C;  1PG4 A;  4PHT A;  1YGT A;  1NY8 A;  1I94 C;  2UU9 C;  4ZJZ A;  1ZB8 A;  4DR1 C;  4DR5 C;  3A9U A;  2D1Q A;  3TUF A;  3PES A;  4K0K C;  2MMA B;  5H9U A;  1XS3 A;  1XDX A;  3J7A D;  2D7V A;  4RM2 A;  4EAT A;  4L2Z A;  3ETO A;  4DUY C;  4K0B A;  5IT9 D;  3I08 A;  1YJ7 A;  4LFB C;  2ZZN A;  4DR7 C;  4OXI A;  1HNW C;  3NYR A;  5AE1 A;  2UUB C;  4JM1 A;  3CW8 X;  4RMN A;  1IB8 A;  2OPL B;  2NCL A;  1XMQ C;  1MD9 A;  2PRO A;  3LAX A;  4LF7 C;  4TPS B;  4ISB A;  4GKJ C;  1WH9 A;  2UUC C;  4DR4 C;  2D27 A;  3I07 A;  4DG9 A;  2OO4 A;  2PG1 E;  4X66 C;  1HR0 C;  2KZ0 A;  1MXB A; 
#chains in the Genus database with same CATH homology
 2D1T A;  2YWB A;  3LUS A;  4B3R C;  4DCV A;  2VZE A;  5CZX A;  2P2F A;  4XX2 A;  4JI4 C;  3LNV A;  4MTN A;  3C5E A;  2HHH C;  1ZB9 A;  2BH1 X;  5T8S A;  1QM4 A;  4BC9 A;  3N54 B;  3GR1 A;  4ODJ A;  3T1H C;  4GS5 A;  4LF5 C;  2BJO A;  2E8F A;  3A4I A;  1USP B;  2WD9 A;  3NI2 A;  5LMU C;  1T5D X;  4JI2 C;  4DG8 A;  2JMP A;  4DV1 C;  2P20 A;  4R1L A;  4NOZ A;  4RVO A;  2HJG A;  2F4V C;  2Y27 A;  2DPL A;  4D4G A;  3J81 D;  3IPL A;  4FUQ A;  3ETC A;  3FCE A;  4G36 A;  2OPL A;  2P2Q A;  4DV7 C;  4JI8 C;  3GKU A;  1L2F A;  3R9W A;  4LF4 C;  3EQ6 A;  4YHH C;  4LF9 C;  1XNQ C;  5E7Q A;  4GXR A;  2ASB A;  2VQE C;  2P2M A;  1N33 C;  4KTT A;  1XMO C;  3NPD A;  1RG9 A;  2UUA C;  2UXD C;  2OBV A;  4RLF A;  4JI7 C;  2E8E A;  2WP0 C;  4RLQ A;  3E7W A;  1MXA A;  2ATW A;  1FUG A;  3OTO C;  2D1R A;  1PG3 A;  1LCI A;  4IZ6 A;  5IFI A;  4LFC C;  4FTF A;  3UZ0 A;  4JI0 C;  4ZLP A;  4DR6 C;  4DUZ C;  2QVY X;  4OYC A;  5BSR A;  4R0M A;  1USP A;  1IBM C;  4JI5 C;  2QVX X;  2Y4O A;  1HNX C;  1MDF A;  2QL8 A;  4D57 A;  1KKG A;  3TQI A;  5JRH A;  1BA3 A;  3L95 X;  5BSW A;  1AMU A;  2PT7 G;  1GPM A;  2AYA A;  4B3M C;  1UKK A;  1IBL C;  2PN2 A;  5FLX D;  2E7G A;  4RVN A;  4B3S C;  1RY2 A;  4LFA C;  4L4Q A;  4PRO C;  4AQY C;  4DV5 C;  2E0G A;  4BBY A;  3UOW A;  1P7L A;  3GR0 A;  4DCT A;  4X65 C;  4X62 C;  3DHV A;  5A1G A;  3FCC A;  3JAM D;  4I9G A;  3AF6 A;  4BC7 A;  4JI6 C;  4MH4 A;  4LE5 A;  1N36 C;  3R44 A;  4YY3 C;  3NYQ A;  4JYA C;  2E8C A;  3RG2 A;  2D1S A;  2DYJ A;  5BUR A;  4LF6 C;  4JI1 C;  4B3T C;  2P02 A;  1HNZ C;  3EER A;  3DLP X;  4DV4 C;  1EGA A;  1N2F A;  4U5Y D;  1O92 A;  1XRA A;  2Y4N A;  5ADZ A;  1XRB A;  5BUQ A;  5AE2 A;  4DV0 C;  4JV5 C;  1WF3 A;  4WV3 A;  4X64 C;  4GXQ A;  2YWC A;  4G37 A;  5BST A;  4DR3 C;  4FUT A;  2V7B A;  5KYV A;  2EGT A;  3CJE A;  3IEU A;  5K8F A;  3KXW A;  5BSM A;  4BSZ A;  3R9X A;  1PA4 A;  3SO4 A;  4BCA A;  1ML8 A;  1O90 A;  1MXC A;  4D4I A;  4DV6 C;  4L7I A;  5KEI A;  3N2Q A;  4DR2 C;  3H2T A;  3B7W A;  2CXC A;  1XRC A;  4I9F A;  4GKK C;  4NXN C;  1LQL A;  1V26 A;  4KHP C;  4D56 A;  4DCU A;  4G1I A;  3L8C A;  4OX9 C;  3VNQ A;  1XNR C;  2YCB A;  1V25 A;  1T5H X;  2UXB C;  4IR7 A;  1JOS A;  1K0R A;  2VQF C;  1J5E C;  3T1Y C;  4KTV A;  2P2J A;  3VNS A;  5T8T A;  2KZF A;  2VSQ A;  5BUS A;  1IBK C;  5A19 A;  3VNR A;  4DV2 C;  3G7S A;  5K85 A;  1O9T A;  5KYT A;  2QVZ X;  5GTD A;  5LMN C;  1O93 A;  5A2Q D;  3J80 D;  3IML A;  5BSV A;  4LF8 C;  5BSU A;  2D28 C;  4HPV A;  4R1M A;  4JI3 C;  5IWA C;  4DCS A;  1QWI A;  1ULT A;  1VLA A;  3PRO C;  5BR8 C;  1MDB A;  4NDN A;  3GPC A;  3AF5 A;  3A9V A;  2E5L C;  3DAY A;  2ONF A;  3E7X A;  5DV9 A;  4PZP A;  1MKY A;  5AE3 A;  1N34 C;  5CZV A;  2CY1 A;  2UXC C;  3IEV A;  3RV2 A;  4RM3 A;  3CW9 A;  4DV3 C;  5A1I A;  2P2B A;  3S82 A;  4WS9 A;  3PBK A;  2ZM6 C;  2QW0 X;  3TDE A;  1NYE A;  3LGX A;  1HH2 P;  1N32 C;  4NXM C;  2XR1 A;  1FJG C;  1PG4 A;  4PHT A;  1I94 C;  2UU9 C;  4ZJZ A;  1ZB8 A;  4DR1 C;  4DR5 C;  3A9U A;  2D1Q A;  3TUF A;  3PES A;  4K0K C;  5H9U A;  3J7A D;  2D7V A;  4RM2 A;  4EAT A;  4L2Z A;  3ETO A;  4DUY C;  4K0B A;  5IT9 D;  3I08 A;  1YJ7 A;  4LFB C;  4DR7 C;  4OXI A;  1HNW C;  3NYR A;  5AE1 A;  2UUB C;  4JM1 A;  3CW8 X;  4RMN A;  2OPL B;  1XMQ C;  1MD9 A;  2PRO A;  3LAX A;  4LF7 C;  4TPS B;  4ISB A;  4GKJ C;  1WH9 A;  2UUC C;  4DR4 C;  2D27 A;  3I07 A;  4DG9 A;  2OO4 A;  4X66 C;  1HR0 C;  1MXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...