4LFCC

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 52
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lfcC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lfcC02
1KKGA 3CJEA 3J80D 4DR3C 1VLAA 2UU9C 2OPLB 1FJGC 4GKKC 2E5LC 4B3SC 2UXDC 2HJGA 4X64C 4JI7C 4LF5C 1I94C 4XX2A 1L2FA 1LQLA 5IWAC 4DV2C 1XNQC 2UXCC 1WF3A 4DUYC 2F4VC 2CXCA 1UKKA 4DCUA 2VQFC 4DR6C 4LF7C 1JOSA 2PT7G 4LF4C 2YCBA 3EERA 1NYEA 4AQYC 3T1HC 1N34C 3GKUA 4DV7C 4LFAC 3LUSA 4JV5C 2E8CA 4NOZA 4DV1C 2HHHC 1IBLC 2E8EA 1HR0C 3IEUA 1HNXC 4DCTA 4YHHC 4JI5C 1USPB 4NXNC 4DV0C 4JYAC 3IEVA 4GKJC 2PN2A 4X66C 5A2QD 1HNZC 4BSZA 3I07A 4LF6C 2UUBC 3AF6A 3J81D 4DR1C 1QWIA 1ZB8A 2UUAC 2BJOA 4DV4C 3J7AD 4YY3C 4JI4C 1ML8A 4JI6C 4DV6C 1WH9A 4JI8C 5LMUC 4DR4C 5FLXD 4JI0C 4B3RC 4NXMC 1XNRC 2E7GA 2OPLA 3AF5A 4JI1C 4DR2C 2D7VA 2XR1A 1IBMC 4MH4A 1N36C 4DR7C 4JI2C 2UXBC 1XMOC 5LMNC 4X65C 3R9WA 2DYJA 5BR8C 1HH2P 4JI3C 1USPA 4DV5C 2KZFA 4DR5C 2UUCC 4KHPC 1EGAA 4LF9C 3R9XA 4DV3C 4OX9C 1N32C 2VQEC 4B3MC 3JAMD 2ZM6C 4DCVA 1N33C 1K0RA 1N2FA 1XMQC 2QL8A 5IT9D 1ZB9A 4LFBC 1MKYA 4K0KC 2ASBA 1PA4A 1IBKC 2EGTA 1J5EC 4LF8C 4MTNA 4DCSA 1HNWC 4B3TC 4LFCC 2ATWA 4DUZC 3OTOC 3T1YC 2JMPA 2E8FA 2CY1A 4X62C 2ONFA
chains in the Genus database with same CATH superfamily
3CJEA 3J80D 1V60A 1P7LA 2DHMA 4PZPA 4RMNA 2DPLA 4BC9A 4G36A 2HJGA 3I08A 3PESA 2UXCC 1WF3A 1XS3A 1UKKA 1UWDA 4DCUA 2VQFC 3EERA 2D1SA 5KYTA 1MXBA 4DV7C 4JV5C 1FLOA 4D4IA 4IR7A 3CQ2A 3FCCA 5A19A 2HHHC 1YJ7A 2E8EA 1M6XA 1HR0C 4DCTA 1USPB 3DLPX 4DV0C 2BH1X 3UX3A 2PN2A 4I9FA 2OO4A 5A2QD 4KTTA 1XDXA 2YWCA 2UUBC 5IFIA 1QWIA 1V25A 4FUTA 2PG1E 3IPLA 4JI6C 1WH9A 4DG9A 5LMUC 5BSVA 4LE5A 2D1QA 3NYRA 5BSTA 5BURA 3UZ0A 1MDBA 2ZZNA 4JI1C 1ULTA 4MH4A 3L8CA 5DV9A 4JI3C 2P02A 1O93A 4G37A 4D57A 2MMAB 4HPVA 1MXAA 4B3MC 2E0GA 3JAMD 2ZZMA 4DCVA 1N33C 1K0RA 1RG9A 4LFBC 1MKYA 1PA4A 1IBKC 5A1IA 3CW8X 1J5EC 4OXIA 1HNWC 4RM3A 3A4IA 4R0MA 5BUSA 4X62C 2P2FA 1AMUA 5BSRA 4TPSB 5E7QA 2KDNA 1TH5A 5BSWA 3LNOA 1IB8A 1LQLA 5GTDA 4DV2C 4D56A 3G7SA 2CXCA 2Y4NA 4DR6C 4LF7C 5ADZA 3T1HC 1N34C 3KXWA 4DV1C 1IBLC 1LCIA 3IEVA 5KEIA 2VZEA 4BCAA 3FCEA 2PROA 3I07A 4RLQA 3FM7A 2MCQA 3J81D 4DR1C 3LGXA 4BBYA 3A9UA 3DAYA 4RLFA 2CU6A 3LNVA 4JI4C 3TR3A 4ISBA 1PG3A 1QM4A 1FUGA 4JI8C 2V7BA 3LAXA 1BA3A 5FLXD 4JI0C 2WD9A 3GPCA 2E7GA 3A25A 3AF5A 1IBMC 4PUGA 2QVZX 5CZXA 4JI2C 1XMOC 2UXBC 3UX2A 2M5HA 3R9WA 1MDFA 2DYJA 1MXCA 3CQ3A 2D27A 1HH2P 2Y4OA 3TQIA 2QW0X 2KZFA 3E7XA 4G1IA 4DV3C 1N32C 2VQEC 3K6RA 1XHJA 1N2FA 1XMQC 2QL8A 3ETOA 2D28C 4RVOA 4WV3A 4BC7A 4GS5A 3DHVA 4DCSA 3GR1A 3VNQA 2Y27A 3T1YC 2JMPA 1N36C 2E8FA 5BSUA 1KKGA 3N2QA 2OPLB 2P2QA 1FJGC 4K0BA 3H2TA 4X64C 4DG8A 2WP0C 1I94C 1L2FA 5AE2A 1YGTA 5IWAC 1XNQC 1NY8A 2F4VC 1GPMA 2AYAA 4L2ZA 1JOSA 4LF4C 1NYEA 3GKUA 1V26A 4LFAC 3LUSA 4WS9A 2NCLA 2D1RA 4NOZA 4GXRA 4R1MA 3PBKA 3NPDA 4JI5C 4NXNC 4JYAC 4GKJC 1XRAA 4X66C 4PHTA 4FTFA 2YWBA 1MD9A 4LF6C 1ZB8A 2UUAC 3CQ1A 3VNSA 3J7AD 2KZ0A 1ML8A 3EQ6A 4DV6C 3VNRA 5KYVA 4OYCA 4JM1A 1P4EA 4B3RC 4NXMC 2D7VA 2P20A 2XR1A 4R1LA 4DR7C 5LMNC 1PU1A 4X65C 4L4QA 2OBVA 2UUCC 4KHPC 3GR0A 4KTVA 5AE3A 5JRHA 2ZM6C 5T8SA 2ZTBA 3E7WA 5K8FA 5IT9D 1ZB9A 3NI2A 2ASBA 2P2MA 4I9GA 2EGTA 3C5EA 3UEBA 4MTNA 5BUQA 4B3TC 3NYQA 1O90A 2ATWA 2QVYX 1O92A 3RV2A 5BSMA 3PROC 4FUQA 2CY1A 2ONFA 2P2BA 4PUIA 4DR3C 2MM9A 1XRBA 3TDEA 1VLAA 2UU9C 3S82A 3TUFA 4GKKC 5CZVA 2JNVA 2E5LC 4ZJZA 4B3SC 2UXDC 4JI7C 4LF5C 2QVXX 4L7IA 4XX2A 4EATA 4DUYC 3A9VA 4ODJA 4D4GA 3ETCA 5LCIA 1VEHA 2PT7G 2YCBA 4AQYC 4ZLPA 2VSQA 3RG2A 3L95X 3O2EA 3CW9A 2E8CA 1HNXC 3IEUA 4YHHC 2D1TA 5AE1A 4RM2A 1M6XC 1HNZC 1O9TA 4BSZA 3SO4A 4RVNA 1WCJA 4NDNA 3AF6A 2BJOA 4DV4C 4YY3C 1T5HX 3AY0A 4PROC 4DR4C 2P2JA 2M5OA 1XNRC 2OPLA 1P4EC 4DR2C 3IMLA 5T8TA 1RY2A 5BR8C 3N54B 2Z51A 1USPA 4DV5C 4DR5C 3UOWA 3A26A 1EGAA 4LF9C 3R9XA 5K85A 4OX9C 4GXQA 5A1GA 4PUHA 1T5DX 3R44A 3B7WA 1XRCA 4K0KC 1PG4A 4LF8C 4U5YD 5H9UA 4LFCC 4IZ6A 4DUZC 3OTOC 2YX1A
chains in the Genus database with same CATH topology
3CJEA 3J80D 1P7LA 4PZPA 4RMNA 2DPLA 4BC9A 4G36A 2HJGA 3I08A 3PESA 2UXCC 1WF3A 1UKKA 4DCUA 2VQFC 3EERA 2D1SA 5KYTA 1MXBA 4DV7C 4JV5C 4D4IA 4IR7A 3FCCA 5A19A 2HHHC 1YJ7A 2E8EA 1HR0C 4DCTA 1USPB 3DLPX 4DV0C 2BH1X 2PN2A 4I9FA 2OO4A 5A2QD 4KTTA 2YWCA 2UUBC 5IFIA 1QWIA 1V25A 4FUTA 3IPLA 4JI6C 1WH9A 4DG9A 5LMUC 5BSVA 4LE5A 2D1QA 3NYRA 5BSTA 5BURA 3UZ0A 1MDBA 4JI1C 1ULTA 4MH4A 3L8CA 5DV9A 4JI3C 2P02A 1O93A 4G37A 4D57A 4HPVA 1MXAA 4B3MC 2E0GA 3JAMD 4DCVA 1N33C 1K0RA 1RG9A 4LFBC 1MKYA 1PA4A 1IBKC 5A1IA 3CW8X 1J5EC 4OXIA 1HNWC 4RM3A 3A4IA 4R0MA 5BUSA 4X62C 2P2FA 1AMUA 5BSRA 4TPSB 5E7QA 5BSWA 1LQLA 5GTDA 4DV2C 4D56A 3G7SA 2CXCA 2Y4NA 4DR6C 4LF7C 5ADZA 3T1HC 1N34C 3KXWA 4DV1C 1IBLC 1LCIA 3IEVA 5KEIA 2VZEA 4BCAA 3FCEA 2PROA 3I07A 4RLQA 3J81D 4DR1C 3LGXA 4BBYA 3A9UA 3DAYA 4RLFA 3LNVA 4JI4C 4ISBA 1PG3A 1QM4A 1FUGA 4JI8C 2V7BA 3LAXA 1BA3A 5FLXD 4JI0C 2WD9A 3GPCA 2E7GA 3AF5A 1IBMC 2QVZX 5CZXA 4JI2C 1XMOC 2UXBC 3R9WA 1MDFA 2DYJA 1MXCA 2D27A 1HH2P 2Y4OA 3TQIA 2QW0X 2KZFA 3E7XA 4G1IA 4DV3C 1N32C 2VQEC 1N2FA 1XMQC 2QL8A 3ETOA 2D28C 4RVOA 4WV3A 4BC7A 4GS5A 3DHVA 4DCSA 3GR1A 3VNQA 2Y27A 1N36C 3T1YC 2JMPA 2E8FA 5BSUA 1KKGA 3N2QA 2OPLB 2P2QA 1FJGC 4K0BA 3H2TA 4X64C 4DG8A 2WP0C 1I94C 1L2FA 5AE2A 5IWAC 1XNQC 2F4VC 1GPMA 2AYAA 4L2ZA 1JOSA 4LF4C 1NYEA 3GKUA 1V26A 4LFAC 3LUSA 4WS9A 2D1RA 4NOZA 4GXRA 4R1MA 3PBKA 3NPDA 4JI5C 4NXNC 4JYAC 4GKJC 1XRAA 4X66C 4PHTA 4FTFA 2YWBA 1MD9A 4LF6C 1ZB8A 2UUAC 3VNSA 3J7AD 1ML8A 3EQ6A 4DV6C 3VNRA 5KYVA 4OYCA 4JM1A 4B3RC 4NXMC 2D7VA 2P20A 2XR1A 4R1LA 4DR7C 5LMNC 4X65C 4L4QA 2OBVA 2UUCC 4KHPC 3GR0A 4KTVA 5AE3A 5JRHA 2ZM6C 5T8SA 3E7WA 5K8FA 5IT9D 1ZB9A 3NI2A 2ASBA 2P2MA 4I9GA 2EGTA 3C5EA 4MTNA 5BUQA 4B3TC 3NYQA 1O90A 2ATWA 2QVYX 1O92A 3RV2A 5BSMA 3PROC 4FUQA 2CY1A 2ONFA 2P2BA 4DR3C 1XRBA 3TDEA 1VLAA 2UU9C 3S82A 3TUFA 4GKKC 5CZVA 2E5LC 4ZJZA 4B3SC 2UXDC 4JI7C 4LF5C 2QVXX 4L7IA 4XX2A 4EATA 4DUYC 3A9VA 4ODJA 4D4GA 3ETCA 2PT7G 2YCBA 4AQYC 4ZLPA 2VSQA 3RG2A 3L95X 3CW9A 2E8CA 1HNXC 3IEUA 4YHHC 2D1TA 5AE1A 4RM2A 1HNZC 1O9TA 4BSZA 3SO4A 4RVNA 4NDNA 3AF6A 2BJOA 4DV4C 4YY3C 1T5HX 4PROC 4DR4C 2P2JA 1XNRC 2OPLA 4DR2C 3IMLA 5T8TA 1RY2A 5BR8C 3N54B 1USPA 4DV5C 4DR5C 3UOWA 1EGAA 4LF9C 3R9XA 5K85A 4OX9C 4GXQA 5A1GA 1T5DX 3R44A 3B7WA 1XRCA 4K0KC 1PG4A 4LF8C 4U5YD 5H9UA 4LFCC 4IZ6A 4DUZC 3OTOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKG A;  3CJE A;  3J80 D;  4DR3 C;  1VLA A;  2UU9 C;  2OPL B;  1FJG C;  4GKK C;  2E5L C;  4B3S C;  2UXD C;  2HJG A;  4X64 C;  4JI7 C;  4LF5 C;  1I94 C;  4XX2 A;  1L2F A;  1LQL A;  5IWA C;  4DV2 C;  1XNQ C;  2UXC C;  1WF3 A;  4DUY C;  2F4V C;  2CXC A;  1UKK A;  4DCU A;  2VQF C;  4DR6 C;  4LF7 C;  1JOS A;  2PT7 G;  4LF4 C;  2YCB A;  3EER A;  1NYE A;  4AQY C;  3T1H C;  1N34 C;  3GKU A;  4DV7 C;  4LFA C;  3LUS A;  4JV5 C;  2E8C A;  4NOZ A;  4DV1 C;  2HHH C;  1IBL C;  2E8E A;  1HR0 C;  3IEU A;  1HNX C;  4DCT A;  4YHH C;  4JI5 C;  1USP B;  4NXN C;  4DV0 C;  4JYA C;  3IEV A;  4GKJ C;  2PN2 A;  4X66 C;  5A2Q D;  1HNZ C;  4BSZ A;  3I07 A;  4LF6 C;  2UUB C;  3AF6 A;  3J81 D;  4DR1 C;  1QWI A;  1ZB8 A;  2UUA C;  2BJO A;  4DV4 C;  3J7A D;  4YY3 C;  4JI4 C;  1ML8 A;  4JI6 C;  4DV6 C;  1WH9 A;  4JI8 C;  5LMU C;  4DR4 C;  5FLX D;  4JI0 C;  4B3R C;  4NXM C;  1XNR C;  2E7G A;  2OPL A;  3AF5 A;  4JI1 C;  4DR2 C;  2D7V A;  2XR1 A;  1IBM C;  4MH4 A;  1N36 C;  4DR7 C;  4JI2 C;  2UXB C;  1XMO C;  5LMN C;  4X65 C;  3R9W A;  2DYJ A;  5BR8 C;  1HH2 P;  4JI3 C;  1USP A;  4DV5 C;  2KZF A;  4DR5 C;  2UUC C;  4KHP C;  1EGA A;  4LF9 C;  3R9X A;  4DV3 C;  4OX9 C;  1N32 C;  2VQE C;  4B3M C;  3JAM D;  2ZM6 C;  4DCV A;  1N33 C;  1K0R A;  1N2F A;  1XMQ C;  2QL8 A;  5IT9 D;  1ZB9 A;  4LFB C;  1MKY A;  4K0K C;  2ASB A;  1PA4 A;  1IBK C;  2EGT A;  1J5E C;  4LF8 C;  4MTN A;  4DCS A;  1HNW C;  4B3T C;  4LFC C;  2ATW A;  4DUZ C;  3OTO C;  3T1Y C;  2JMP A;  2E8F A;  2CY1 A;  4X62 C;  2ONF A; 
#chains in the Genus database with same CATH topology
 3CJE A;  3J80 D;  1V60 A;  1P7L A;  2DHM A;  4PZP A;  4RMN A;  2DPL A;  4BC9 A;  4G36 A;  2HJG A;  3I08 A;  3PES A;  2UXC C;  1WF3 A;  1XS3 A;  1UKK A;  1UWD A;  4DCU A;  2VQF C;  3EER A;  2D1S A;  5KYT A;  1MXB A;  4DV7 C;  4JV5 C;  1FLO A;  4D4I A;  4IR7 A;  3CQ2 A;  3FCC A;  5A19 A;  2HHH C;  1YJ7 A;  2E8E A;  1M6X A;  1HR0 C;  4DCT A;  1USP B;  3DLP X;  4DV0 C;  2BH1 X;  3UX3 A;  2PN2 A;  4I9F A;  2OO4 A;  5A2Q D;  4KTT A;  1XDX A;  2YWC A;  2UUB C;  5IFI A;  1QWI A;  1V25 A;  4FUT A;  2PG1 E;  3IPL A;  4JI6 C;  1WH9 A;  4DG9 A;  5LMU C;  5BSV A;  4LE5 A;  2D1Q A;  3NYR A;  5BST A;  5BUR A;  3UZ0 A;  1MDB A;  2ZZN A;  4JI1 C;  1ULT A;  4MH4 A;  3L8C A;  5DV9 A;  4JI3 C;  2P02 A;  1O93 A;  4G37 A;  4D57 A;  2MMA B;  4HPV A;  1MXA A;  4B3M C;  2E0G A;  3JAM D;  2ZZM A;  4DCV A;  1N33 C;  1K0R A;  1RG9 A;  4LFB C;  1MKY A;  1PA4 A;  1IBK C;  5A1I A;  3CW8 X;  1J5E C;  4OXI A;  1HNW C;  4RM3 A;  3A4I A;  4R0M A;  5BUS A;  4X62 C;  2P2F A;  1AMU A;  5BSR A;  4TPS B;  5E7Q A;  2KDN A;  1TH5 A;  5BSW A;  3LNO A;  1IB8 A;  1LQL A;  5GTD A;  4DV2 C;  4D56 A;  3G7S A;  2CXC A;  2Y4N A;  4DR6 C;  4LF7 C;  5ADZ A;  3T1H C;  1N34 C;  3KXW A;  4DV1 C;  1IBL C;  1LCI A;  3IEV A;  5KEI A;  2VZE A;  4BCA A;  3FCE A;  2PRO A;  3I07 A;  4RLQ A;  3FM7 A;  2MCQ A;  3J81 D;  4DR1 C;  3LGX A;  4BBY A;  3A9U A;  3DAY A;  4RLF A;  2CU6 A;  3LNV A;  4JI4 C;  3TR3 A;  4ISB A;  1PG3 A;  1QM4 A;  1FUG A;  4JI8 C;  2V7B A;  3LAX A;  1BA3 A;  5FLX D;  4JI0 C;  2WD9 A;  3GPC A;  2E7G A;  3A25 A;  3AF5 A;  1IBM C;  4PUG A;  2QVZ X;  5CZX A;  4JI2 C;  1XMO C;  2UXB C;  3UX2 A;  2M5H A;  3R9W A;  1MDF A;  2DYJ A;  1MXC A;  3CQ3 A;  2D27 A;  1HH2 P;  2Y4O A;  3TQI A;  2QW0 X;  2KZF A;  3E7X A;  4G1I A;  4DV3 C;  1N32 C;  2VQE C;  3K6R A;  1XHJ A;  1N2F A;  1XMQ C;  2QL8 A;  3ETO A;  2D28 C;  4RVO A;  4WV3 A;  4BC7 A;  4GS5 A;  3DHV A;  4DCS A;  3GR1 A;  3VNQ A;  2Y27 A;  3T1Y C;  2JMP A;  1N36 C;  2E8F A;  5BSU A;  1KKG A;  3N2Q A;  2OPL B;  2P2Q A;  1FJG C;  4K0B A;  3H2T A;  4X64 C;  4DG8 A;  2WP0 C;  1I94 C;  1L2F A;  5AE2 A;  1YGT A;  5IWA C;  1XNQ C;  1NY8 A;  2F4V C;  1GPM A;  2AYA A;  4L2Z A;  1JOS A;  4LF4 C;  1NYE A;  3GKU A;  1V26 A;  4LFA C;  3LUS A;  4WS9 A;  2NCL A;  2D1R A;  4NOZ A;  4GXR A;  4R1M A;  3PBK A;  3NPD A;  4JI5 C;  4NXN C;  4JYA C;  4GKJ C;  1XRA A;  4X66 C;  4PHT A;  4FTF A;  2YWB A;  1MD9 A;  4LF6 C;  1ZB8 A;  2UUA C;  3CQ1 A;  3VNS A;  3J7A D;  2KZ0 A;  1ML8 A;  3EQ6 A;  4DV6 C;  3VNR A;  5KYV A;  4OYC A;  4JM1 A;  1P4E A;  4B3R C;  4NXM C;  2D7V A;  2P20 A;  2XR1 A;  4R1L A;  4DR7 C;  5LMN C;  1PU1 A;  4X65 C;  4L4Q A;  2OBV A;  2UUC C;  4KHP C;  3GR0 A;  4KTV A;  5AE3 A;  5JRH A;  2ZM6 C;  5T8S A;  2ZTB A;  3E7W A;  5K8F A;  5IT9 D;  1ZB9 A;  3NI2 A;  2ASB A;  2P2M A;  4I9G A;  2EGT A;  3C5E A;  3UEB A;  4MTN A;  5BUQ A;  4B3T C;  3NYQ A;  1O90 A;  2ATW A;  2QVY X;  1O92 A;  3RV2 A;  5BSM A;  3PRO C;  4FUQ A;  2CY1 A;  2ONF A;  2P2B A;  4PUI A;  4DR3 C;  2MM9 A;  1XRB A;  3TDE A;  1VLA A;  2UU9 C;  3S82 A;  3TUF A;  4GKK C;  5CZV A;  2JNV A;  2E5L C;  4ZJZ A;  4B3S C;  2UXD C;  4JI7 C;  4LF5 C;  2QVX X;  4L7I A;  4XX2 A;  4EAT A;  4DUY C;  3A9V A;  4ODJ A;  4D4G A;  3ETC A;  5LCI A;  1VEH A;  2PT7 G;  2YCB A;  4AQY C;  4ZLP A;  2VSQ A;  3RG2 A;  3L95 X;  3O2E A;  3CW9 A;  2E8C A;  1HNX C;  3IEU A;  4YHH C;  2D1T A;  5AE1 A;  4RM2 A;  1M6X C;  1HNZ C;  1O9T A;  4BSZ A;  3SO4 A;  4RVN A;  1WCJ A;  4NDN A;  3AF6 A;  2BJO A;  4DV4 C;  4YY3 C;  1T5H X;  3AY0 A;  4PRO C;  4DR4 C;  2P2J A;  2M5O A;  1XNR C;  2OPL A;  1P4E C;  4DR2 C;  3IML A;  5T8T A;  1RY2 A;  5BR8 C;  3N54 B;  2Z51 A;  1USP A;  4DV5 C;  4DR5 C;  3UOW A;  3A26 A;  1EGA A;  4LF9 C;  3R9X A;  5K85 A;  4OX9 C;  4GXQ A;  5A1G A;  4PUH A;  1T5D X;  3R44 A;  3B7W A;  1XRC A;  4K0K C;  1PG4 A;  4LF8 C;  4U5Y D;  5H9U A;  4LFC C;  4IZ6 A;  4DUZ C;  3OTO C;  2YX1 A; 
#chains in the Genus database with same CATH homology
 3CJE A;  3J80 D;  1P7L A;  4PZP A;  4RMN A;  2DPL A;  4BC9 A;  4G36 A;  2HJG A;  3I08 A;  3PES A;  2UXC C;  1WF3 A;  1UKK A;  4DCU A;  2VQF C;  3EER A;  2D1S A;  5KYT A;  1MXB A;  4DV7 C;  4JV5 C;  4D4I A;  4IR7 A;  3FCC A;  5A19 A;  2HHH C;  1YJ7 A;  2E8E A;  1HR0 C;  4DCT A;  1USP B;  3DLP X;  4DV0 C;  2BH1 X;  2PN2 A;  4I9F A;  2OO4 A;  5A2Q D;  4KTT A;  2YWC A;  2UUB C;  5IFI A;  1QWI A;  1V25 A;  4FUT A;  3IPL A;  4JI6 C;  1WH9 A;  4DG9 A;  5LMU C;  5BSV A;  4LE5 A;  2D1Q A;  3NYR A;  5BST A;  5BUR A;  3UZ0 A;  1MDB A;  4JI1 C;  1ULT A;  4MH4 A;  3L8C A;  5DV9 A;  4JI3 C;  2P02 A;  1O93 A;  4G37 A;  4D57 A;  4HPV A;  1MXA A;  4B3M C;  2E0G A;  3JAM D;  4DCV A;  1N33 C;  1K0R A;  1RG9 A;  4LFB C;  1MKY A;  1PA4 A;  1IBK C;  5A1I A;  3CW8 X;  1J5E C;  4OXI A;  1HNW C;  4RM3 A;  3A4I A;  4R0M A;  5BUS A;  4X62 C;  2P2F A;  1AMU A;  5BSR A;  4TPS B;  5E7Q A;  5BSW A;  1LQL A;  5GTD A;  4DV2 C;  4D56 A;  3G7S A;  2CXC A;  2Y4N A;  4DR6 C;  4LF7 C;  5ADZ A;  3T1H C;  1N34 C;  3KXW A;  4DV1 C;  1IBL C;  1LCI A;  3IEV A;  5KEI A;  2VZE A;  4BCA A;  3FCE A;  2PRO A;  3I07 A;  4RLQ A;  3J81 D;  4DR1 C;  3LGX A;  4BBY A;  3A9U A;  3DAY A;  4RLF A;  3LNV A;  4JI4 C;  4ISB A;  1PG3 A;  1QM4 A;  1FUG A;  4JI8 C;  2V7B A;  3LAX A;  1BA3 A;  5FLX D;  4JI0 C;  2WD9 A;  3GPC A;  2E7G A;  3AF5 A;  1IBM C;  2QVZ X;  5CZX A;  4JI2 C;  1XMO C;  2UXB C;  3R9W A;  1MDF A;  2DYJ A;  1MXC A;  2D27 A;  1HH2 P;  2Y4O A;  3TQI A;  2QW0 X;  2KZF A;  3E7X A;  4G1I A;  4DV3 C;  1N32 C;  2VQE C;  1N2F A;  1XMQ C;  2QL8 A;  3ETO A;  2D28 C;  4RVO A;  4WV3 A;  4BC7 A;  4GS5 A;  3DHV A;  4DCS A;  3GR1 A;  3VNQ A;  2Y27 A;  1N36 C;  3T1Y C;  2JMP A;  2E8F A;  5BSU A;  1KKG A;  3N2Q A;  2OPL B;  2P2Q A;  1FJG C;  4K0B A;  3H2T A;  4X64 C;  4DG8 A;  2WP0 C;  1I94 C;  1L2F A;  5AE2 A;  5IWA C;  1XNQ C;  2F4V C;  1GPM A;  2AYA A;  4L2Z A;  1JOS A;  4LF4 C;  1NYE A;  3GKU A;  1V26 A;  4LFA C;  3LUS A;  4WS9 A;  2D1R A;  4NOZ A;  4GXR A;  4R1M A;  3PBK A;  3NPD A;  4JI5 C;  4NXN C;  4JYA C;  4GKJ C;  1XRA A;  4X66 C;  4PHT A;  4FTF A;  2YWB A;  1MD9 A;  4LF6 C;  1ZB8 A;  2UUA C;  3VNS A;  3J7A D;  1ML8 A;  3EQ6 A;  4DV6 C;  3VNR A;  5KYV A;  4OYC A;  4JM1 A;  4B3R C;  4NXM C;  2D7V A;  2P20 A;  2XR1 A;  4R1L A;  4DR7 C;  5LMN C;  4X65 C;  4L4Q A;  2OBV A;  2UUC C;  4KHP C;  3GR0 A;  4KTV A;  5AE3 A;  5JRH A;  2ZM6 C;  5T8S A;  3E7W A;  5K8F A;  5IT9 D;  1ZB9 A;  3NI2 A;  2ASB A;  2P2M A;  4I9G A;  2EGT A;  3C5E A;  4MTN A;  5BUQ A;  4B3T C;  3NYQ A;  1O90 A;  2ATW A;  2QVY X;  1O92 A;  3RV2 A;  5BSM A;  3PRO C;  4FUQ A;  2CY1 A;  2ONF A;  2P2B A;  4DR3 C;  1XRB A;  3TDE A;  1VLA A;  2UU9 C;  3S82 A;  3TUF A;  4GKK C;  5CZV A;  2E5L C;  4ZJZ A;  4B3S C;  2UXD C;  4JI7 C;  4LF5 C;  2QVX X;  4L7I A;  4XX2 A;  4EAT A;  4DUY C;  3A9V A;  4ODJ A;  4D4G A;  3ETC A;  2PT7 G;  2YCB A;  4AQY C;  4ZLP A;  2VSQ A;  3RG2 A;  3L95 X;  3CW9 A;  2E8C A;  1HNX C;  3IEU A;  4YHH C;  2D1T A;  5AE1 A;  4RM2 A;  1HNZ C;  1O9T A;  4BSZ A;  3SO4 A;  4RVN A;  4NDN A;  3AF6 A;  2BJO A;  4DV4 C;  4YY3 C;  1T5H X;  4PRO C;  4DR4 C;  2P2J A;  1XNR C;  2OPL A;  4DR2 C;  3IML A;  5T8T A;  1RY2 A;  5BR8 C;  3N54 B;  1USP A;  4DV5 C;  4DR5 C;  3UOW A;  1EGA A;  4LF9 C;  3R9X A;  5K85 A;  4OX9 C;  4GXQ A;  5A1G A;  1T5D X;  3R44 A;  3B7W A;  1XRC A;  4K0K C;  1PG4 A;  4LF8 C;  4U5Y D;  5H9U A;  4LFC C;  4IZ6 A;  4DUZ C;  3OTO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...