2F4VC

30s ribosome + designer antibiotic
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2f4vC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2f4vC02
4LFCC 2E5LC 3R9WA 4GKJC 2KZFA 4MH4A 1NYEA 4LFBC 3J7AD 2EGTA 1ML8A 1J5EC 4JI5C 1FJGC 4JI8C 1LQLA 1I94C 1IBMC 2UXDC 2JMPA 4B3MC 4JI1C 4DV1C 1N36C 4DCUA 4K0KC 4JI6C 4DR7C 4B3RC 4DCTA 3T1YC 2HHHC 1MKYA 2PN2A 4DUZC 2E8EA 4YHHC 3I07A 4LFAC 4AQYC 1XNRC 4XX2A 4JI0C 4DR2C 4DV4C 5IT9D 4JI3C 3T1HC 3JAMD 1N2FA 5FLXD 4KHPC 2ONFA 2F4VC 3J81D 4X66C 1XMOC 1KKGA 1UKKA 1HH2P 2E8FA 4OX9C 2E7GA 1L2FA 1PA4A 2DYJA 2PT7G 5A2QD 2E8CA 3GKUA 2UUAC 4B3TC 4JYAC 4LF4C 4DCVA 5BR8C 5LMUC 2HJGA 4DR3C 1XNQC 1K0RA 3AF5A 4MTNA 5LMNC 1HR0C 4DR5C 4X65C 4BSZA 1HNWC 3IEUA 1HNZC 4DR1C 2UXCC 1VLAA 1N34C 4JV5C 2ATWA 4DR4C 4X64C 1N33C 2ZM6C 2ASBA 4NXMC 3IEVA 4X62C 2VQFC 4JI2C 1XMQC 4YY3C 4LF7C 4DV2C 1QWIA 4LF5C 1USPA 1HNXC 2OPLA 5IWAC 2XR1A 4LF6C 4DV3C 4JI7C 1WF3A 2D7VA 4JI4C 1WH9A 3OTOC 4DUYC 1N32C 1EGAA 4NOZA 3LUSA 4NXNC 1ZB9A 2UUBC 4DV0C 1IBKC 2BJOA 4DR6C 1USPB 4GKKC 3R9XA 3AF6A 4B3SC 2OPLB 3J80D 2UUCC 4DCSA 2UXBC 3EERA 2VQEC 2CXCA 4DV6C 2CY1A 1IBLC 2YCBA 2UU9C 4DV5C 2QL8A 1ZB8A 4DV7C 4LF8C 3CJEA 1JOSA 4LF9C
chains in the Genus database with same CATH superfamily
4PUHA 1VEHA 5BSVA 4DG9A 4LFBC 2P2MA 1WCJA 2EGTA 2P2BA 4R1LA 5BSUA 1T5HX 4JI5C 3S82A 3CQ3A 1LQLA 4PZPA 4WS9A 3B7WA 5E7QA 4FUTA 4K0KC 4JI6C 3VNRA 5BSRA 4B3RC 2HHHC 4HPVA 2MMAB 4FTFA 3I07A 5K8FA 4AQYC 4JI0C 4DR2C 4JI3C 1FLOA 3PESA 5FLXD 3A4IA 1XRCA 2ONFA 2F4VC 2P02A 4KTTA 4RLQA 3J81D 1XS3A 3O2EA 2V7BA 3EQ6A 2E0GA 2E7GA 1L2FA 2PT7G 3C5EA 5LMUC 1XNQC 1K0RA 5LMNC 1HR0C 4DR5C 3R44A 4BSZA 1YGTA 2QVZX 2DHMA 4ISBA 3IEUA 2UXCC 2YWBA 1IB8A 1N34C 4JV5C 3DLPX 5BUQA 1V26A 2M5HA 4DR4C 4X64C 4NXMC 3TDEA 4X62C 4JI2C 2D1QA 4YY3C 1GPMA 5H9UA 1USPA 3A9VA 1LCIA 5IWAC 3TUFA 4JI7C 3PROC 2D7VA 4JI4C 2YX1A 3FCCA 2ZZNA 3E7XA 3LAXA 1EGAA 5T8TA 4RVNA 3VNSA 2QW0X 4GXRA 3CW9A 4DR6C 4GKKC 4RM3A 3AF6A 2OPLB 1UWDA 2D27A 4GXQA 2YWCA 2KDNA 2UUCC 1O9TA 1PG4A 1MXBA 2CXCA 4NDNA 4BCAA 2CY1A 3TR3A 2QVYX 1IBLC 2YCBA 4DV5C 2D28C 2Y4OA 4DV7C 4LF8C 3CJEA 4LF9C 4R1MA 5BUSA 2KZFA 4MH4A 3ETCA 3CQ2A 3J7AD 4L7IA 4G37A 1ML8A 1J5EC 5JRHA 3L8CA 2PG1E 2UXDC 2DPLA 5BURA 2JMPA 4B3MC 1FUGA 4JI1C 3CQ1A 2PN2A 4R0MA 4DUZC 2E8EA 5CZXA 4YHHC 1MXCA 4XX2A 4ODJA 2QVXX 3JAMD 2OO4A 3IPLA 1XMOC 4ZJZA 1KKGA 5K85A 1HH2P 1UKKA 3LNVA 4RMNA 4OX9C 5A2QD 4JM1A 4EATA 4RLFA 4MTNA 5CZVA 3NPDA 4I9FA 4X65C 4PHTA 4K0BA 3DHVA 3L95X 3UOWA 1VLAA 1QM4A 3DAYA 2ATWA 2ZM6C 3SO4A 3IEVA 3UZ0A 3GPCA 1QWIA 2VSQA 3A26A 5AE1A 2XR1A 5AE2A 4OYCA 4D4GA 4LE5A 4DUYC 2D1RA 1N32C 4NOZA 4DV0C 3K6RA 3A9UA 1IBKC 2BJOA 3R9XA 2NCLA 4I9GA 3J80D 3EERA 4DV6C 5GTDA 3VNQA 2JNVA 1MDBA 1P4EC 3N2QA 5IFIA 2ZZMA 3UEBA 2E5LC 3R9WA 1NY8A 2VZEA 1M6XC 4D56A 1FJGC 1O93A 3NYQA 2D1SA 4DV1C 4DCUA 1AMUA 4KTVA 4DCTA 4DR7C 2KZ0A 2BH1X 5IT9D 3LNOA 1TH5A 4DG8A 4X66C 3RV2A 2DYJA 2Y27A 2E8CA 2UUAC 4B3TC 4JYAC 5BSMA 5BR8C 4DR3C 2HJGA 1RG9A 1ULTA 3TQIA 3UX3A 4GS5A 1HNWC 1HNZC 4DR1C 5KEIA 1O92A 4L4QA 3GR1A 1N33C 2ASBA 3KXWA 5ADZA 4DV2C 5BSTA 1P4EA 4LF5C 3LGXA 1V60A 2OPLA 1T5DX 4LF6C 3H2TA 4PUGA 2CU6A 3OTOC 3FM7A 4ZLPA 4OXIA 3LUSA 4NXNC 1XRAA 1USPB 1RY2A 2MCQA 5A19A 5A1GA 4B3SC 1M6XA 3IMLA 4DCSA 2VQEC 3G7SA 5KYTA 2M5OA 1PG3A 3ETOA 4RVOA 1ZB8A 1JOSA 2P2QA 5LCIA 4LFCC 4GKJC 1NYEA 4G1IA 4JI8C 1YJ7A 1I94C 1IBMC 4BC9A 1XDXA 4IZ6A 3UX2A 1N36C 1V25A 3T1YC 1MKYA 3A25A 2MM9A 1BA3A 1P7LA 3GR0A 4LFAC 1XNRC 2OBVA 4DV4C 3T1HC 1N2FA 4KHPC 3AY0A 3I08A 5AE3A 3FCEA 4U5YD 2E8FA 1PA4A 3GKUA 2PROA 4LF4C 4DCVA 3AF5A 2Z51A 3NI2A 1MD9A 4IR7A 5A1IA 5DV9A 2P2FA 2Y4NA 3RG2A 3PBKA 5BSWA 2VQFC 1XMQC 4LF7C 2P2JA 1MDFA 4FUQA 1PU1A 3CW8X 4L2ZA 1HNXC 4PUIA 5T8SA 4DV3C 1WF3A 1WH9A 2ZTBA 2AYAA 4BBYA 4PROC 1XRBA 1ZB9A 2WD9A 2UUBC 1XHJA 1O90A 4BC7A 4TPSB 4WV3A 2UXBC 4RM2A 2D1TA 3NYRA 1MXAA 2WP0C 3N54B 4D4IA 5KYVA 2UU9C 2QL8A 4D57A 4G36A 3E7WA 2P20A
chains in the Genus database with same CATH topology
5BSVA 4DG9A 4LFBC 2P2MA 2EGTA 2P2BA 4R1LA 5BSUA 1T5HX 4JI5C 3S82A 1LQLA 4PZPA 4WS9A 3B7WA 5E7QA 4FUTA 4K0KC 4JI6C 3VNRA 5BSRA 4B3RC 2HHHC 4HPVA 4FTFA 3I07A 5K8FA 4AQYC 4JI0C 4DR2C 4JI3C 3PESA 5FLXD 3A4IA 1XRCA 2ONFA 2F4VC 2P02A 4KTTA 4RLQA 3J81D 2V7BA 3EQ6A 2E0GA 2E7GA 1L2FA 2PT7G 3C5EA 5LMUC 1XNQC 5LMNC 1K0RA 1HR0C 4DR5C 3R44A 4BSZA 2QVZX 4ISBA 3IEUA 2UXCC 2YWBA 1N34C 4JV5C 3DLPX 5BUQA 1V26A 4DR4C 4X64C 4NXMC 3TDEA 4X62C 4JI2C 2D1QA 4YY3C 1GPMA 5H9UA 1USPA 3A9VA 1LCIA 5IWAC 3TUFA 4JI7C 3PROC 2D7VA 4JI4C 3FCCA 3E7XA 3LAXA 1EGAA 5T8TA 4RVNA 3VNSA 2QW0X 4GXRA 3CW9A 4DR6C 4GKKC 4RM3A 3AF6A 2OPLB 2D27A 4GXQA 2YWCA 2UUCC 1O9TA 1PG4A 1MXBA 2CXCA 4NDNA 4BCAA 2CY1A 2QVYX 1IBLC 2YCBA 4DV5C 2D28C 2Y4OA 4DV7C 4LF8C 3CJEA 4LF9C 4R1MA 5BUSA 2KZFA 4MH4A 3ETCA 3J7AD 4L7IA 4G37A 1ML8A 1J5EC 5JRHA 3L8CA 2UXDC 2DPLA 5BURA 2JMPA 4B3MC 1FUGA 4JI1C 2PN2A 4R0MA 4DUZC 2E8EA 5CZXA 4YHHC 1MXCA 4XX2A 4ODJA 2QVXX 3JAMD 2OO4A 3IPLA 1XMOC 4ZJZA 1KKGA 5K85A 1HH2P 1UKKA 3LNVA 4RMNA 4OX9C 5A2QD 4JM1A 4EATA 4RLFA 4MTNA 5CZVA 3NPDA 4I9FA 4X65C 4PHTA 4K0BA 3DHVA 3L95X 3UOWA 1VLAA 1QM4A 3DAYA 2ATWA 2ZM6C 3SO4A 3IEVA 3UZ0A 3GPCA 1QWIA 2VSQA 5AE1A 2XR1A 5AE2A 4OYCA 4D4GA 4LE5A 4DUYC 2D1RA 1N32C 4NOZA 4DV0C 3A9UA 1IBKC 2BJOA 3R9XA 4I9GA 3J80D 3EERA 4DV6C 5GTDA 3VNQA 1MDBA 3N2QA 5IFIA 2E5LC 3R9WA 2VZEA 4D56A 1FJGC 1O93A 3NYQA 2D1SA 4DV1C 4DCUA 1AMUA 4KTVA 4DCTA 4DR7C 2BH1X 5IT9D 4DG8A 4X66C 3RV2A 2DYJA 2Y27A 2E8CA 2UUAC 4B3TC 4JYAC 5BSMA 5BR8C 4DR3C 2HJGA 1RG9A 1ULTA 3TQIA 4GS5A 1HNWC 1HNZC 4DR1C 5KEIA 1O92A 4L4QA 3GR1A 1N33C 2ASBA 3KXWA 5ADZA 4DV2C 5BSTA 4LF5C 3LGXA 2OPLA 1T5DX 4LF6C 3H2TA 3OTOC 4ZLPA 4OXIA 3LUSA 4NXNC 1XRAA 1USPB 1RY2A 5A19A 5A1GA 4B3SC 3IMLA 4DCSA 2VQEC 3G7SA 5KYTA 1PG3A 3ETOA 4RVOA 1ZB8A 1JOSA 2P2QA 4LFCC 4GKJC 1NYEA 4G1IA 4JI8C 1YJ7A 1I94C 1IBMC 4BC9A 4IZ6A 1N36C 1V25A 3T1YC 1MKYA 1BA3A 1P7LA 3GR0A 4LFAC 1XNRC 2OBVA 4DV4C 3T1HC 1N2FA 4KHPC 3I08A 5AE3A 3FCEA 4U5YD 2E8FA 1PA4A 3GKUA 2PROA 4LF4C 4DCVA 3AF5A 3NI2A 1MD9A 4IR7A 5A1IA 5DV9A 2P2FA 2Y4NA 3RG2A 2VQFC 3PBKA 5BSWA 1XMQC 4LF7C 2P2JA 1MDFA 4FUQA 3CW8X 4L2ZA 1HNXC 5T8SA 4DV3C 1WF3A 1WH9A 2AYAA 4BBYA 4PROC 1XRBA 1ZB9A 2WD9A 2UUBC 1O90A 4BC7A 4TPSB 4WV3A 2UXBC 4RM2A 2D1TA 3NYRA 1MXAA 2WP0C 3N54B 4D4IA 5KYVA 2UU9C 2QL8A 4D57A 4G36A 3E7WA 2P20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC C;  2E5L C;  3R9W A;  4GKJ C;  2KZF A;  4MH4 A;  1NYE A;  4LFB C;  3J7A D;  2EGT A;  1ML8 A;  1J5E C;  4JI5 C;  1FJG C;  4JI8 C;  1LQL A;  1I94 C;  1IBM C;  2UXD C;  2JMP A;  4B3M C;  4JI1 C;  4DV1 C;  1N36 C;  4DCU A;  4K0K C;  4JI6 C;  4DR7 C;  4B3R C;  4DCT A;  3T1Y C;  2HHH C;  1MKY A;  2PN2 A;  4DUZ C;  2E8E A;  4YHH C;  3I07 A;  4LFA C;  4AQY C;  1XNR C;  4XX2 A;  4JI0 C;  4DR2 C;  4DV4 C;  5IT9 D;  4JI3 C;  3T1H C;  3JAM D;  1N2F A;  5FLX D;  4KHP C;  2ONF A;  2F4V C;  3J81 D;  4X66 C;  1XMO C;  1KKG A;  1UKK A;  1HH2 P;  2E8F A;  4OX9 C;  2E7G A;  1L2F A;  1PA4 A;  2DYJ A;  2PT7 G;  5A2Q D;  2E8C A;  3GKU A;  2UUA C;  4B3T C;  4JYA C;  4LF4 C;  4DCV A;  5BR8 C;  5LMU C;  2HJG A;  4DR3 C;  1XNQ C;  1K0R A;  3AF5 A;  4MTN A;  5LMN C;  1HR0 C;  4DR5 C;  4X65 C;  4BSZ A;  1HNW C;  3IEU A;  1HNZ C;  4DR1 C;  2UXC C;  1VLA A;  1N34 C;  4JV5 C;  2ATW A;  4DR4 C;  4X64 C;  1N33 C;  2ZM6 C;  2ASB A;  4NXM C;  3IEV A;  4X62 C;  2VQF C;  4JI2 C;  1XMQ C;  4YY3 C;  4LF7 C;  4DV2 C;  1QWI A;  4LF5 C;  1USP A;  1HNX C;  2OPL A;  5IWA C;  2XR1 A;  4LF6 C;  4DV3 C;  4JI7 C;  1WF3 A;  2D7V A;  4JI4 C;  1WH9 A;  3OTO C;  4DUY C;  1N32 C;  1EGA A;  4NOZ A;  3LUS A;  4NXN C;  1ZB9 A;  2UUB C;  4DV0 C;  1IBK C;  2BJO A;  4DR6 C;  1USP B;  4GKK C;  3R9X A;  3AF6 A;  4B3S C;  2OPL B;  3J80 D;  2UUC C;  4DCS A;  2UXB C;  3EER A;  2VQE C;  2CXC A;  4DV6 C;  2CY1 A;  1IBL C;  2YCB A;  2UU9 C;  4DV5 C;  2QL8 A;  1ZB8 A;  4DV7 C;  4LF8 C;  3CJE A;  1JOS A;  4LF9 C; 
#chains in the Genus database with same CATH topology
 4PUH A;  1VEH A;  5BSV A;  4DG9 A;  4LFB C;  2P2M A;  1WCJ A;  2EGT A;  2P2B A;  4R1L A;  5BSU A;  1T5H X;  4JI5 C;  3S82 A;  3CQ3 A;  1LQL A;  4PZP A;  4WS9 A;  3B7W A;  5E7Q A;  4FUT A;  4K0K C;  4JI6 C;  3VNR A;  5BSR A;  4B3R C;  2HHH C;  4HPV A;  2MMA B;  4FTF A;  3I07 A;  5K8F A;  4AQY C;  4JI0 C;  4DR2 C;  4JI3 C;  1FLO A;  3PES A;  5FLX D;  3A4I A;  1XRC A;  2ONF A;  2F4V C;  2P02 A;  4KTT A;  4RLQ A;  3J81 D;  1XS3 A;  3O2E A;  2V7B A;  3EQ6 A;  2E0G A;  2E7G A;  1L2F A;  2PT7 G;  3C5E A;  5LMU C;  1XNQ C;  1K0R A;  5LMN C;  1HR0 C;  4DR5 C;  3R44 A;  4BSZ A;  1YGT A;  2QVZ X;  2DHM A;  4ISB A;  3IEU A;  2UXC C;  2YWB A;  1IB8 A;  1N34 C;  4JV5 C;  3DLP X;  5BUQ A;  1V26 A;  2M5H A;  4DR4 C;  4X64 C;  4NXM C;  3TDE A;  4X62 C;  4JI2 C;  2D1Q A;  4YY3 C;  1GPM A;  5H9U A;  1USP A;  3A9V A;  1LCI A;  5IWA C;  3TUF A;  4JI7 C;  3PRO C;  2D7V A;  4JI4 C;  2YX1 A;  3FCC A;  2ZZN A;  3E7X A;  3LAX A;  1EGA A;  5T8T A;  4RVN A;  3VNS A;  2QW0 X;  4GXR A;  3CW9 A;  4DR6 C;  4GKK C;  4RM3 A;  3AF6 A;  2OPL B;  1UWD A;  2D27 A;  4GXQ A;  2YWC A;  2KDN A;  2UUC C;  1O9T A;  1PG4 A;  1MXB A;  2CXC A;  4NDN A;  4BCA A;  2CY1 A;  3TR3 A;  2QVY X;  1IBL C;  2YCB A;  4DV5 C;  2D28 C;  2Y4O A;  4DV7 C;  4LF8 C;  3CJE A;  4LF9 C;  4R1M A;  5BUS A;  2KZF A;  4MH4 A;  3ETC A;  3CQ2 A;  3J7A D;  4L7I A;  4G37 A;  1ML8 A;  1J5E C;  5JRH A;  3L8C A;  2PG1 E;  2UXD C;  2DPL A;  5BUR A;  2JMP A;  4B3M C;  1FUG A;  4JI1 C;  3CQ1 A;  2PN2 A;  4R0M A;  4DUZ C;  2E8E A;  5CZX A;  4YHH C;  1MXC A;  4XX2 A;  4ODJ A;  2QVX X;  3JAM D;  2OO4 A;  3IPL A;  1XMO C;  4ZJZ A;  1KKG A;  5K85 A;  1HH2 P;  1UKK A;  3LNV A;  4RMN A;  4OX9 C;  5A2Q D;  4JM1 A;  4EAT A;  4RLF A;  4MTN A;  5CZV A;  3NPD A;  4I9F A;  4X65 C;  4PHT A;  4K0B A;  3DHV A;  3L95 X;  3UOW A;  1VLA A;  1QM4 A;  3DAY A;  2ATW A;  2ZM6 C;  3SO4 A;  3IEV A;  3UZ0 A;  3GPC A;  1QWI A;  2VSQ A;  3A26 A;  5AE1 A;  2XR1 A;  5AE2 A;  4OYC A;  4D4G A;  4LE5 A;  4DUY C;  2D1R A;  1N32 C;  4NOZ A;  4DV0 C;  3K6R A;  3A9U A;  1IBK C;  2BJO A;  3R9X A;  2NCL A;  4I9G A;  3J80 D;  3EER A;  4DV6 C;  5GTD A;  3VNQ A;  2JNV A;  1MDB A;  1P4E C;  3N2Q A;  5IFI A;  2ZZM A;  3UEB A;  2E5L C;  3R9W A;  1NY8 A;  2VZE A;  1M6X C;  4D56 A;  1FJG C;  1O93 A;  3NYQ A;  2D1S A;  4DV1 C;  4DCU A;  1AMU A;  4KTV A;  4DCT A;  4DR7 C;  2KZ0 A;  2BH1 X;  5IT9 D;  3LNO A;  1TH5 A;  4DG8 A;  4X66 C;  3RV2 A;  2DYJ A;  2Y27 A;  2E8C A;  2UUA C;  4B3T C;  4JYA C;  5BSM A;  5BR8 C;  4DR3 C;  2HJG A;  1RG9 A;  1ULT A;  3TQI A;  3UX3 A;  4GS5 A;  1HNW C;  1HNZ C;  4DR1 C;  5KEI A;  1O92 A;  4L4Q A;  3GR1 A;  1N33 C;  2ASB A;  3KXW A;  5ADZ A;  4DV2 C;  5BST A;  1P4E A;  4LF5 C;  3LGX A;  1V60 A;  2OPL A;  1T5D X;  4LF6 C;  3H2T A;  4PUG A;  2CU6 A;  3OTO C;  3FM7 A;  4ZLP A;  4OXI A;  3LUS A;  4NXN C;  1XRA A;  1USP B;  1RY2 A;  2MCQ A;  5A19 A;  5A1G A;  4B3S C;  1M6X A;  3IML A;  4DCS A;  2VQE C;  3G7S A;  5KYT A;  2M5O A;  1PG3 A;  3ETO A;  4RVO A;  1ZB8 A;  1JOS A;  2P2Q A;  5LCI A;  4LFC C;  4GKJ C;  1NYE A;  4G1I A;  4JI8 C;  1YJ7 A;  1I94 C;  1IBM C;  4BC9 A;  1XDX A;  4IZ6 A;  3UX2 A;  1N36 C;  1V25 A;  3T1Y C;  1MKY A;  3A25 A;  2MM9 A;  1BA3 A;  1P7L A;  3GR0 A;  4LFA C;  1XNR C;  2OBV A;  4DV4 C;  3T1H C;  1N2F A;  4KHP C;  3AY0 A;  3I08 A;  5AE3 A;  3FCE A;  4U5Y D;  2E8F A;  1PA4 A;  3GKU A;  2PRO A;  4LF4 C;  4DCV A;  3AF5 A;  2Z51 A;  3NI2 A;  1MD9 A;  4IR7 A;  5A1I A;  5DV9 A;  2P2F A;  2Y4N A;  3RG2 A;  3PBK A;  5BSW A;  2VQF C;  1XMQ C;  4LF7 C;  2P2J A;  1MDF A;  4FUQ A;  1PU1 A;  3CW8 X;  4L2Z A;  1HNX C;  4PUI A;  5T8S A;  4DV3 C;  1WF3 A;  1WH9 A;  2ZTB A;  2AYA A;  4BBY A;  4PRO C;  1XRB A;  1ZB9 A;  2WD9 A;  2UUB C;  1XHJ A;  1O90 A;  4BC7 A;  4TPS B;  4WV3 A;  2UXB C;  4RM2 A;  2D1T A;  3NYR A;  1MXA A;  2WP0 C;  3N54 B;  4D4I A;  5KYV A;  2UU9 C;  2QL8 A;  4D57 A;  4G36 A;  3E7W A;  2P20 A; 
#chains in the Genus database with same CATH homology
 5BSV A;  4DG9 A;  4LFB C;  2P2M A;  2EGT A;  2P2B A;  4R1L A;  5BSU A;  1T5H X;  4JI5 C;  3S82 A;  1LQL A;  4PZP A;  4WS9 A;  3B7W A;  5E7Q A;  4FUT A;  4K0K C;  4JI6 C;  3VNR A;  5BSR A;  4B3R C;  2HHH C;  4HPV A;  4FTF A;  3I07 A;  5K8F A;  4AQY C;  4JI0 C;  4DR2 C;  4JI3 C;  3PES A;  5FLX D;  3A4I A;  1XRC A;  2ONF A;  2F4V C;  2P02 A;  4KTT A;  4RLQ A;  3J81 D;  2V7B A;  3EQ6 A;  2E0G A;  2E7G A;  1L2F A;  2PT7 G;  3C5E A;  5LMU C;  1XNQ C;  5LMN C;  1K0R A;  1HR0 C;  4DR5 C;  3R44 A;  4BSZ A;  2QVZ X;  4ISB A;  3IEU A;  2UXC C;  2YWB A;  1N34 C;  4JV5 C;  3DLP X;  5BUQ A;  1V26 A;  4DR4 C;  4X64 C;  4NXM C;  3TDE A;  4X62 C;  4JI2 C;  2D1Q A;  4YY3 C;  1GPM A;  5H9U A;  1USP A;  3A9V A;  1LCI A;  5IWA C;  3TUF A;  4JI7 C;  3PRO C;  2D7V A;  4JI4 C;  3FCC A;  3E7X A;  3LAX A;  1EGA A;  5T8T A;  4RVN A;  3VNS A;  2QW0 X;  4GXR A;  3CW9 A;  4DR6 C;  4GKK C;  4RM3 A;  3AF6 A;  2OPL B;  2D27 A;  4GXQ A;  2YWC A;  2UUC C;  1O9T A;  1PG4 A;  1MXB A;  2CXC A;  4NDN A;  4BCA A;  2CY1 A;  2QVY X;  1IBL C;  2YCB A;  4DV5 C;  2D28 C;  2Y4O A;  4DV7 C;  4LF8 C;  3CJE A;  4LF9 C;  4R1M A;  5BUS A;  2KZF A;  4MH4 A;  3ETC A;  3J7A D;  4L7I A;  4G37 A;  1ML8 A;  1J5E C;  5JRH A;  3L8C A;  2UXD C;  2DPL A;  5BUR A;  2JMP A;  4B3M C;  1FUG A;  4JI1 C;  2PN2 A;  4R0M A;  4DUZ C;  2E8E A;  5CZX A;  4YHH C;  1MXC A;  4XX2 A;  4ODJ A;  2QVX X;  3JAM D;  2OO4 A;  3IPL A;  1XMO C;  4ZJZ A;  1KKG A;  5K85 A;  1HH2 P;  1UKK A;  3LNV A;  4RMN A;  4OX9 C;  5A2Q D;  4JM1 A;  4EAT A;  4RLF A;  4MTN A;  5CZV A;  3NPD A;  4I9F A;  4X65 C;  4PHT A;  4K0B A;  3DHV A;  3L95 X;  3UOW A;  1VLA A;  1QM4 A;  3DAY A;  2ATW A;  2ZM6 C;  3SO4 A;  3IEV A;  3UZ0 A;  3GPC A;  1QWI A;  2VSQ A;  5AE1 A;  2XR1 A;  5AE2 A;  4OYC A;  4D4G A;  4LE5 A;  4DUY C;  2D1R A;  1N32 C;  4NOZ A;  4DV0 C;  3A9U A;  1IBK C;  2BJO A;  3R9X A;  4I9G A;  3J80 D;  3EER A;  4DV6 C;  5GTD A;  3VNQ A;  1MDB A;  3N2Q A;  5IFI A;  2E5L C;  3R9W A;  2VZE A;  4D56 A;  1FJG C;  1O93 A;  3NYQ A;  2D1S A;  4DV1 C;  4DCU A;  1AMU A;  4KTV A;  4DCT A;  4DR7 C;  2BH1 X;  5IT9 D;  4DG8 A;  4X66 C;  3RV2 A;  2DYJ A;  2Y27 A;  2E8C A;  2UUA C;  4B3T C;  4JYA C;  5BSM A;  5BR8 C;  4DR3 C;  2HJG A;  1RG9 A;  1ULT A;  3TQI A;  4GS5 A;  1HNW C;  1HNZ C;  4DR1 C;  5KEI A;  1O92 A;  4L4Q A;  3GR1 A;  1N33 C;  2ASB A;  3KXW A;  5ADZ A;  4DV2 C;  5BST A;  4LF5 C;  3LGX A;  2OPL A;  1T5D X;  4LF6 C;  3H2T A;  3OTO C;  4ZLP A;  4OXI A;  3LUS A;  4NXN C;  1XRA A;  1USP B;  1RY2 A;  5A19 A;  5A1G A;  4B3S C;  3IML A;  4DCS A;  2VQE C;  3G7S A;  5KYT A;  1PG3 A;  3ETO A;  4RVO A;  1ZB8 A;  1JOS A;  2P2Q A;  4LFC C;  4GKJ C;  1NYE A;  4G1I A;  4JI8 C;  1YJ7 A;  1I94 C;  1IBM C;  4BC9 A;  4IZ6 A;  1N36 C;  1V25 A;  3T1Y C;  1MKY A;  1BA3 A;  1P7L A;  3GR0 A;  4LFA C;  1XNR C;  2OBV A;  4DV4 C;  3T1H C;  1N2F A;  4KHP C;  3I08 A;  5AE3 A;  3FCE A;  4U5Y D;  2E8F A;  1PA4 A;  3GKU A;  2PRO A;  4LF4 C;  4DCV A;  3AF5 A;  3NI2 A;  1MD9 A;  4IR7 A;  5A1I A;  5DV9 A;  2P2F A;  2Y4N A;  3RG2 A;  2VQF C;  3PBK A;  5BSW A;  1XMQ C;  4LF7 C;  2P2J A;  1MDF A;  4FUQ A;  3CW8 X;  4L2Z A;  1HNX C;  5T8S A;  4DV3 C;  1WF3 A;  1WH9 A;  2AYA A;  4BBY A;  4PRO C;  1XRB A;  1ZB9 A;  2WD9 A;  2UUB C;  1O90 A;  4BC7 A;  4TPS B;  4WV3 A;  2UXB C;  4RM2 A;  2D1T A;  3NYR A;  1MXA A;  2WP0 C;  3N54 B;  4D4I A;  5KYV A;  2UU9 C;  2QL8 A;  4D57 A;  4G36 A;  3E7W A;  2P20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...