2F4VC

30s ribosome + designer antibiotic
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
total genus 29
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2f4vC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2f4vC02
2XR1A 5A2QD 2ASBA 4LF9C 1IBMC 3J80D 4LFAC 2VQFC 1LQLA 2ATWA 4NXMC 4LFCC 1KKGA 4XX2A 1UKKA 4X65C 3GKUA 1IBKC 4JI4C 4LF4C 1USPA 2OPLA 4GKKC 2UXCC 2HJGA 2VQEC 2UXBC 4DV6C 4BSZA 2UUAC 1JOSA 2UUBC 4B3MC 2JMPA 4LF5C 4X66C 1IBLC 1L2FA 4JI8C 1N32C 4DCSA 4JI2C 1HH2P 3IEUA 1WH9A 4JYAC 1FJGC 4LF6C 1XMOC 4JI1C 2UXDC 1K0RA 2E5LC 3EERA 2E8EA 3T1HC 1ML8A 1XNRC 4DV2C 5BR8C 4YHHC 2ONFA 1PA4A 4DV1C 1XNQC 4JI0C 4LF7C 4MTNA 2E8FA 2HHHC 4DCVA 3I07A 3AF5A 1VLAA 1EGAA 2OPLB 1ZB8A 5IT9D 4DR1C 4MH4A 1N2FA 1HR0C 4DR2C 1ZB9A 4NOZA 4DCUA 4LF8C 1J5EC 3LUSA 5IWAC 4JI3C 1N36C 1HNXC 3T1YC 2D7VA 3J81D 2F4VC 4JI5C 3R9WA 2UU9C 4LFBC 4DCTA 1WF3A 4DR5C 4AQYC 2YCBA 4GKJC 1I94C 4JI7C 4DR3C 4YY3C 2PT7G 4DR6C 4NXNC 4DV5C 4DR4C 1N33C 1USPB 4DV7C 4X62C 1QWIA 3CJEA 1HNWC 2KZFA 4JI6C 4DV4C 2ZM6C 2BJOA 4B3SC 4B3TC 3J7AD 3OTOC 4B3RC 4JV5C 4DUYC 1HNZC 3IEVA 4DR7C 5FLXD 1NYEA 2E7GA 2CY1A 4KHPC 2UUCC 5LMNC 4DV0C 4X64C 3AF6A 2DYJA 2PN2A 4DUZC 3R9XA 1N34C 4K0KC 4DV3C 2QL8A 1XMQC 2CXCA 1MKYA 3JAMD 2E8CA 2EGTA 5LMUC 4OX9C
chains in the Genus database with same CATH superfamily
2D27A 2XR1A 5A2QD 4LF9C 3FCEA 3C5EA 4TPSB 2VQFC 4LFAC 1LQLA 4NXMC 4LFCC 5K8FA 1O93A 2WD9A 4LF4C 3PBKA 4FUTA 5A1GA 3PROC 3SO4A 3S82A 2NCLA 3ETOA 4DV6C 2MM9A 2JMPA 1LCIA 2QVZX 5A1IA 4JI8C 1N32C 4WV3A 3A9UA 1HH2P 4JM1A 4RLQA 2MCQA 4D4IA 2AYAA 4JYAC 5JRHA 3A25A 4PUGA 5KEIA 3NI2A 3EERA 2E8EA 3T1HC 2P2JA 4YHHC 2KDNA 1PA4A 2ONFA 4RVNA 2E8FA 3I07A 3RG2A 1XHJA 2OO4A 3DLPX 4RM2A 1ZB8A 5BSRA 5GTDA 3EQ6A 3G7SA 1N2FA 2BH1X 3LUSA 1IB8A 4JI3C 4OXIA 3J81D 2F4VC 4JI5C 4K0BA 4PUHA 2KZ0A 4L2ZA 4AQYC 4PHTA 4R0MA 1N33C 4LE5A 2OBVA 3IMLA 1HNWC 1QM4A 4I9FA 3TUFA 1MDBA 2P02A 4RLFA 2ZZNA 4B3RC 5AE3A 2DPLA 1MXAA 3FCCA 4U5YD 3R9XA 1MDFA 4KTTA 5BURA 3LGXA 2QL8A 5BSUA 2CXCA 1MKYA 2E8CA 3LAXA 4EATA 4G36A 3IEVA 5E7QA 5LMUC 1TH5A 4OX9C 2ASBA 1NY8A 2ATWA 1O92A 3N54B 1GPMA 4XX2A 3RV2A 1IBKC 3GKUA 1RY2A 2D1RA 3LNVA 2HJGA 4GXQA 2UXBC 2PROA 1JOSA 5T8TA 4ZLPA 4X66C 2P2FA 1IBLC 4PZPA 4DG8A 4DCSA 4JI2C 1FUGA 5CZXA 4NDNA 3IEUA 1XMOC 4JI1C 2UXDC 2E5LC 1PG4A 5BSWA 4KTVA 1XNQC 3PESA 4PUIA 4MTNA 3KXWA 2HHHC 3AF5A 4ZJZA 2ZTBA 4RVOA 5IFIA 2QVXX 4LF8C 4DCUA 1J5EC 5IWAC 3TQIA 4BC9A 1HNXC 1XRCA 1YGTA 4LFBC 4WS9A 2YCBA 4RMNA 4JI7C 4DR6C 4NXNC 4DV5C 4DR4C 4DV7C 4X62C 1QWIA 3CJEA 4R1MA 1ULTA 4DV4C 2ZM6C 1HNZC 3O2EA 4DR7C 4IZ6A 5BSVA 4D4GA 5LMNC 4DV0C 4IR7A 2CU6A 3E7WA 4D56A 3VNSA 4PROC 4DV3C 2WP0C 3A9VA 3LNOA 2Y27A 3GR1A 1PU1A 1XRBA 1XMQC 3JAMD 3CW9A 3A26A 1XRAA 1M6XA 3L95X 1KKGA 1UKKA 4X65C 1O9TA 2MMAB 1USPA 1MXCA 2UXCC 3UZ0A 4ISBA 2UUBC 3TDEA 5CZVA 3NYQA 1V60A 1WH9A 4BCAA 5BSTA 3DAYA 4DG9A 2VZEA 1K0RA 1V25A 1M6XC 3FM7A 3AY0A 1ML8A 1XNRC 2M5OA 3A4IA 3H2TA 5AE2A 5BR8C 4ODJA 4JI0C 2VSQA 4BBYA 1FLOA 1VLAA 1EGAA 5IT9D 3CW8X 3GPCA 4L4QA 4DR1C 5LCIA 4DR2C 1ZB9A 3CQ3A 3NPDA 2D7VA 5H9UA 3N2QA 4D57A 3R9WA 4G1IA 2UU9C 4DCTA 4R1LA 5KYVA 3NYRA 4GKJC 1I94C 4BC7A 2P2MA 4DR3C 2QVYX 4YY3C 3UOWA 3UX2A 2P2QA 5BSMA 5KYTA 2KZFA 2D28C 2YWCA 4JI6C 2P2BA 4B3SC 2BJOA 3L8CA 2YX1A 3OTOC 4JV5C 1UWDA 1NYEA 2V7BA 2E7GA 4KHPC 2UUCC 5BUSA 3UX3A 3AF6A 2DYJA 4DUZC 1N34C 5ADZA 2QW0X 2EGTA 1IBMC 3J80D 3VNQA 1MXBA 1MD9A 2D1SA 1V26A 4JI4C 1P7LA 2OPLA 4GKKC 2VQEC 4BSZA 2UUAC 4B3MC 2M5HA 4FTFA 4LF5C 1L2FA 1PG3A 5T8SA 1FJGC 4LF6C 3I08A 2ZZMA 2Y4NA 1P4EA 5A19A 2P20A 4DV2C 2Z51A 4DV1C 4LF7C 1T5DX 5DV9A 4DCVA 2D1QA 2D1TA 3VNRA 4G37A 2OPLB 3DHVA 4MH4A 1O90A 1HR0C 4NOZA 2YWBA 2JNVA 1XDXA 1N36C 3T1YC 1P4EC 1VEHA 3IPLA 4I9GA 4HPVA 3GR0A 1XS3A 1WCJA 2E0GA 4GXRA 1WF3A 5BUQA 3B7WA 4DR5C 3E7XA 1AMUA 3UEBA 2PT7G 1USPB 4L7IA 1YJ7A 2PG1E 4OYCA 3K6RA 3J7AD 5AE1A 4B3TC 1BA3A 4DUYC 5K85A 5FLXD 3TR3A 2CY1A 1T5HX 2DHMA 2Y4OA 4X64C 1RG9A 2PN2A 4FUQA 4RM3A 4K0KC 3ETCA 4GS5A 3CQ2A 3R44A 3CQ1A
chains in the Genus database with same CATH topology
2D27A 2XR1A 5A2QD 4LF9C 3FCEA 3C5EA 4TPSB 2VQFC 4LFAC 1LQLA 4NXMC 4LFCC 5K8FA 1O93A 2WD9A 4LF4C 3PBKA 4FUTA 5A1GA 3PROC 3SO4A 3S82A 3ETOA 4DV6C 2JMPA 1LCIA 2QVZX 5A1IA 4JI8C 1N32C 4WV3A 3A9UA 1HH2P 4JM1A 4RLQA 4D4IA 2AYAA 4JYAC 5JRHA 5KEIA 3NI2A 3EERA 2E8EA 3T1HC 2P2JA 4YHHC 2ONFA 1PA4A 4RVNA 2E8FA 3I07A 3RG2A 2OO4A 3DLPX 4RM2A 1ZB8A 5BSRA 5GTDA 3EQ6A 3G7SA 1N2FA 2BH1X 3LUSA 4JI3C 4OXIA 3J81D 2F4VC 4JI5C 4K0BA 4L2ZA 4AQYC 4PHTA 4R0MA 1N33C 4LE5A 2OBVA 3IMLA 1HNWC 1QM4A 4I9FA 3TUFA 1MDBA 2P02A 4RLFA 4B3RC 5AE3A 2DPLA 1MXAA 3FCCA 4U5YD 3R9XA 1MDFA 4KTTA 5BURA 3LGXA 2QL8A 5BSUA 2CXCA 1MKYA 2E8CA 3LAXA 4EATA 4G36A 3IEVA 5E7QA 5LMUC 4OX9C 2ASBA 2ATWA 1O92A 3N54B 1GPMA 4XX2A 3RV2A 1IBKC 3GKUA 1RY2A 2D1RA 3LNVA 2HJGA 4GXQA 2UXBC 2PROA 1JOSA 5T8TA 4ZLPA 4X66C 2P2FA 1IBLC 4PZPA 4DG8A 4DCSA 4JI2C 1FUGA 5CZXA 4NDNA 3IEUA 1XMOC 4JI1C 2UXDC 2E5LC 1PG4A 5BSWA 4KTVA 1XNQC 3PESA 4MTNA 3KXWA 2HHHC 3AF5A 4ZJZA 4RVOA 5IFIA 2QVXX 4LF8C 4DCUA 1J5EC 5IWAC 3TQIA 4BC9A 1HNXC 1XRCA 4LFBC 4WS9A 2YCBA 4RMNA 4JI7C 4DR6C 4NXNC 4DV5C 4DR4C 4DV7C 4X62C 1QWIA 3CJEA 4R1MA 1ULTA 4DV4C 2ZM6C 1HNZC 4DR7C 4IZ6A 5BSVA 4D4GA 5LMNC 4DV0C 4IR7A 3E7WA 4D56A 3VNSA 4PROC 4DV3C 2WP0C 3A9VA 2Y27A 3GR1A 1XRBA 1XMQC 3JAMD 3CW9A 1XRAA 3L95X 1KKGA 1UKKA 4X65C 1O9TA 1USPA 1MXCA 2UXCC 3UZ0A 4ISBA 2UUBC 3TDEA 5CZVA 3NYQA 1WH9A 4BCAA 5BSTA 3DAYA 4DG9A 2VZEA 1K0RA 1V25A 1ML8A 1XNRC 3A4IA 3H2TA 5AE2A 5BR8C 4ODJA 4JI0C 2VSQA 4BBYA 1VLAA 1EGAA 5IT9D 3CW8X 3GPCA 4L4QA 4DR1C 4DR2C 1ZB9A 3NPDA 2D7VA 5H9UA 3N2QA 4D57A 3R9WA 4G1IA 2UU9C 4DCTA 4R1LA 5KYVA 3NYRA 4GKJC 1I94C 4BC7A 2P2MA 4DR3C 2QVYX 4YY3C 3UOWA 2P2QA 5BSMA 5KYTA 2KZFA 2D28C 2YWCA 4JI6C 2P2BA 4B3SC 2BJOA 3L8CA 3OTOC 4JV5C 1NYEA 2V7BA 2E7GA 4KHPC 2UUCC 5BUSA 3AF6A 2DYJA 4DUZC 1N34C 5ADZA 2QW0X 2EGTA 1IBMC 3J80D 3VNQA 1MXBA 1MD9A 2D1SA 1V26A 4JI4C 1P7LA 2OPLA 4GKKC 2VQEC 4BSZA 2UUAC 4B3MC 4FTFA 4LF5C 1L2FA 1PG3A 5T8SA 1FJGC 4LF6C 3I08A 2Y4NA 5A19A 2P20A 4DV2C 4DV1C 4LF7C 1T5DX 5DV9A 4DCVA 2D1QA 2D1TA 3VNRA 4G37A 2OPLB 3DHVA 4MH4A 1O90A 1HR0C 4NOZA 2YWBA 1N36C 3T1YC 3IPLA 4I9GA 4HPVA 3GR0A 2E0GA 4GXRA 1WF3A 5BUQA 3B7WA 4DR5C 3E7XA 1AMUA 2PT7G 1USPB 4L7IA 1YJ7A 4OYCA 3J7AD 5AE1A 4B3TC 1BA3A 4DUYC 5K85A 5FLXD 2CY1A 1T5HX 2Y4OA 4X64C 1RG9A 2PN2A 4FUQA 4RM3A 4K0KC 3ETCA 4GS5A 3R44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XR1 A;  5A2Q D;  2ASB A;  4LF9 C;  1IBM C;  3J80 D;  4LFA C;  2VQF C;  1LQL A;  2ATW A;  4NXM C;  4LFC C;  1KKG A;  4XX2 A;  1UKK A;  4X65 C;  3GKU A;  1IBK C;  4JI4 C;  4LF4 C;  1USP A;  2OPL A;  4GKK C;  2UXC C;  2HJG A;  2VQE C;  2UXB C;  4DV6 C;  4BSZ A;  2UUA C;  1JOS A;  2UUB C;  4B3M C;  2JMP A;  4LF5 C;  4X66 C;  1IBL C;  1L2F A;  4JI8 C;  1N32 C;  4DCS A;  4JI2 C;  1HH2 P;  3IEU A;  1WH9 A;  4JYA C;  1FJG C;  4LF6 C;  1XMO C;  4JI1 C;  2UXD C;  1K0R A;  2E5L C;  3EER A;  2E8E A;  3T1H C;  1ML8 A;  1XNR C;  4DV2 C;  5BR8 C;  4YHH C;  2ONF A;  1PA4 A;  4DV1 C;  1XNQ C;  4JI0 C;  4LF7 C;  4MTN A;  2E8F A;  2HHH C;  4DCV A;  3I07 A;  3AF5 A;  1VLA A;  1EGA A;  2OPL B;  1ZB8 A;  5IT9 D;  4DR1 C;  4MH4 A;  1N2F A;  1HR0 C;  4DR2 C;  1ZB9 A;  4NOZ A;  4DCU A;  4LF8 C;  1J5E C;  3LUS A;  5IWA C;  4JI3 C;  1N36 C;  1HNX C;  3T1Y C;  2D7V A;  3J81 D;  2F4V C;  4JI5 C;  3R9W A;  2UU9 C;  4LFB C;  4DCT A;  1WF3 A;  4DR5 C;  4AQY C;  2YCB A;  4GKJ C;  1I94 C;  4JI7 C;  4DR3 C;  4YY3 C;  2PT7 G;  4DR6 C;  4NXN C;  4DV5 C;  4DR4 C;  1N33 C;  1USP B;  4DV7 C;  4X62 C;  1QWI A;  3CJE A;  1HNW C;  2KZF A;  4JI6 C;  4DV4 C;  2ZM6 C;  2BJO A;  4B3S C;  4B3T C;  3J7A D;  3OTO C;  4B3R C;  4JV5 C;  4DUY C;  1HNZ C;  3IEV A;  4DR7 C;  5FLX D;  1NYE A;  2E7G A;  2CY1 A;  4KHP C;  2UUC C;  5LMN C;  4DV0 C;  4X64 C;  3AF6 A;  2DYJ A;  2PN2 A;  4DUZ C;  3R9X A;  1N34 C;  4K0K C;  4DV3 C;  2QL8 A;  1XMQ C;  2CXC A;  1MKY A;  3JAM D;  2E8C A;  2EGT A;  5LMU C;  4OX9 C; 
#chains in the Genus database with same CATH topology
 2D27 A;  2XR1 A;  5A2Q D;  4LF9 C;  3FCE A;  3C5E A;  4TPS B;  2VQF C;  4LFA C;  1LQL A;  4NXM C;  4LFC C;  5K8F A;  1O93 A;  2WD9 A;  4LF4 C;  3PBK A;  4FUT A;  5A1G A;  3PRO C;  3SO4 A;  3S82 A;  2NCL A;  3ETO A;  4DV6 C;  2MM9 A;  2JMP A;  1LCI A;  2QVZ X;  5A1I A;  4JI8 C;  1N32 C;  4WV3 A;  3A9U A;  1HH2 P;  4JM1 A;  4RLQ A;  2MCQ A;  4D4I A;  2AYA A;  4JYA C;  5JRH A;  3A25 A;  4PUG A;  5KEI A;  3NI2 A;  3EER A;  2E8E A;  3T1H C;  2P2J A;  4YHH C;  2KDN A;  1PA4 A;  2ONF A;  4RVN A;  2E8F A;  3I07 A;  3RG2 A;  1XHJ A;  2OO4 A;  3DLP X;  4RM2 A;  1ZB8 A;  5BSR A;  5GTD A;  3EQ6 A;  3G7S A;  1N2F A;  2BH1 X;  3LUS A;  1IB8 A;  4JI3 C;  4OXI A;  3J81 D;  2F4V C;  4JI5 C;  4K0B A;  4PUH A;  2KZ0 A;  4L2Z A;  4AQY C;  4PHT A;  4R0M A;  1N33 C;  4LE5 A;  2OBV A;  3IML A;  1HNW C;  1QM4 A;  4I9F A;  3TUF A;  1MDB A;  2P02 A;  4RLF A;  2ZZN A;  4B3R C;  5AE3 A;  2DPL A;  1MXA A;  3FCC A;  4U5Y D;  3R9X A;  1MDF A;  4KTT A;  5BUR A;  3LGX A;  2QL8 A;  5BSU A;  2CXC A;  1MKY A;  2E8C A;  3LAX A;  4EAT A;  4G36 A;  3IEV A;  5E7Q A;  5LMU C;  1TH5 A;  4OX9 C;  2ASB A;  1NY8 A;  2ATW A;  1O92 A;  3N54 B;  1GPM A;  4XX2 A;  3RV2 A;  1IBK C;  3GKU A;  1RY2 A;  2D1R A;  3LNV A;  2HJG A;  4GXQ A;  2UXB C;  2PRO A;  1JOS A;  5T8T A;  4ZLP A;  4X66 C;  2P2F A;  1IBL C;  4PZP A;  4DG8 A;  4DCS A;  4JI2 C;  1FUG A;  5CZX A;  4NDN A;  3IEU A;  1XMO C;  4JI1 C;  2UXD C;  2E5L C;  1PG4 A;  5BSW A;  4KTV A;  1XNQ C;  3PES A;  4PUI A;  4MTN A;  3KXW A;  2HHH C;  3AF5 A;  4ZJZ A;  2ZTB A;  4RVO A;  5IFI A;  2QVX X;  4LF8 C;  4DCU A;  1J5E C;  5IWA C;  3TQI A;  4BC9 A;  1HNX C;  1XRC A;  1YGT A;  4LFB C;  4WS9 A;  2YCB A;  4RMN A;  4JI7 C;  4DR6 C;  4NXN C;  4DV5 C;  4DR4 C;  4DV7 C;  4X62 C;  1QWI A;  3CJE A;  4R1M A;  1ULT A;  4DV4 C;  2ZM6 C;  1HNZ C;  3O2E A;  4DR7 C;  4IZ6 A;  5BSV A;  4D4G A;  5LMN C;  4DV0 C;  4IR7 A;  2CU6 A;  3E7W A;  4D56 A;  3VNS A;  4PRO C;  4DV3 C;  2WP0 C;  3A9V A;  3LNO A;  2Y27 A;  3GR1 A;  1PU1 A;  1XRB A;  1XMQ C;  3JAM D;  3CW9 A;  3A26 A;  1XRA A;  1M6X A;  3L95 X;  1KKG A;  1UKK A;  4X65 C;  1O9T A;  2MMA B;  1USP A;  1MXC A;  2UXC C;  3UZ0 A;  4ISB A;  2UUB C;  3TDE A;  5CZV A;  3NYQ A;  1V60 A;  1WH9 A;  4BCA A;  5BST A;  3DAY A;  4DG9 A;  2VZE A;  1K0R A;  1V25 A;  1M6X C;  3FM7 A;  3AY0 A;  1ML8 A;  1XNR C;  2M5O A;  3A4I A;  3H2T A;  5AE2 A;  5BR8 C;  4ODJ A;  4JI0 C;  2VSQ A;  4BBY A;  1FLO A;  1VLA A;  1EGA A;  5IT9 D;  3CW8 X;  3GPC A;  4L4Q A;  4DR1 C;  5LCI A;  4DR2 C;  1ZB9 A;  3CQ3 A;  3NPD A;  2D7V A;  5H9U A;  3N2Q A;  4D57 A;  3R9W A;  4G1I A;  2UU9 C;  4DCT A;  4R1L A;  5KYV A;  3NYR A;  4GKJ C;  1I94 C;  4BC7 A;  2P2M A;  4DR3 C;  2QVY X;  4YY3 C;  3UOW A;  3UX2 A;  2P2Q A;  5BSM A;  5KYT A;  2KZF A;  2D28 C;  2YWC A;  4JI6 C;  2P2B A;  4B3S C;  2BJO A;  3L8C A;  2YX1 A;  3OTO C;  4JV5 C;  1UWD A;  1NYE A;  2V7B A;  2E7G A;  4KHP C;  2UUC C;  5BUS A;  3UX3 A;  3AF6 A;  2DYJ A;  4DUZ C;  1N34 C;  5ADZ A;  2QW0 X;  2EGT A;  1IBM C;  3J80 D;  3VNQ A;  1MXB A;  1MD9 A;  2D1S A;  1V26 A;  4JI4 C;  1P7L A;  2OPL A;  4GKK C;  2VQE C;  4BSZ A;  2UUA C;  4B3M C;  2M5H A;  4FTF A;  4LF5 C;  1L2F A;  1PG3 A;  5T8S A;  1FJG C;  4LF6 C;  3I08 A;  2ZZM A;  2Y4N A;  1P4E A;  5A19 A;  2P20 A;  4DV2 C;  2Z51 A;  4DV1 C;  4LF7 C;  1T5D X;  5DV9 A;  4DCV A;  2D1Q A;  2D1T A;  3VNR A;  4G37 A;  2OPL B;  3DHV A;  4MH4 A;  1O90 A;  1HR0 C;  4NOZ A;  2YWB A;  2JNV A;  1XDX A;  1N36 C;  3T1Y C;  1P4E C;  1VEH A;  3IPL A;  4I9G A;  4HPV A;  3GR0 A;  1XS3 A;  1WCJ A;  2E0G A;  4GXR A;  1WF3 A;  5BUQ A;  3B7W A;  4DR5 C;  3E7X A;  1AMU A;  3UEB A;  2PT7 G;  1USP B;  4L7I A;  1YJ7 A;  2PG1 E;  4OYC A;  3K6R A;  3J7A D;  5AE1 A;  4B3T C;  1BA3 A;  4DUY C;  5K85 A;  5FLX D;  3TR3 A;  2CY1 A;  1T5H X;  2DHM A;  2Y4O A;  4X64 C;  1RG9 A;  2PN2 A;  4FUQ A;  4RM3 A;  4K0K C;  3ETC A;  4GS5 A;  3CQ2 A;  3R44 A;  3CQ1 A; 
#chains in the Genus database with same CATH homology
 2D27 A;  2XR1 A;  5A2Q D;  4LF9 C;  3FCE A;  3C5E A;  4TPS B;  2VQF C;  4LFA C;  1LQL A;  4NXM C;  4LFC C;  5K8F A;  1O93 A;  2WD9 A;  4LF4 C;  3PBK A;  4FUT A;  5A1G A;  3PRO C;  3SO4 A;  3S82 A;  3ETO A;  4DV6 C;  2JMP A;  1LCI A;  2QVZ X;  5A1I A;  4JI8 C;  1N32 C;  4WV3 A;  3A9U A;  1HH2 P;  4JM1 A;  4RLQ A;  4D4I A;  2AYA A;  4JYA C;  5JRH A;  5KEI A;  3NI2 A;  3EER A;  2E8E A;  3T1H C;  2P2J A;  4YHH C;  2ONF A;  1PA4 A;  4RVN A;  2E8F A;  3I07 A;  3RG2 A;  2OO4 A;  3DLP X;  4RM2 A;  1ZB8 A;  5BSR A;  5GTD A;  3EQ6 A;  3G7S A;  1N2F A;  2BH1 X;  3LUS A;  4JI3 C;  4OXI A;  3J81 D;  2F4V C;  4JI5 C;  4K0B A;  4L2Z A;  4AQY C;  4PHT A;  4R0M A;  1N33 C;  4LE5 A;  2OBV A;  3IML A;  1HNW C;  1QM4 A;  4I9F A;  3TUF A;  1MDB A;  2P02 A;  4RLF A;  4B3R C;  5AE3 A;  2DPL A;  1MXA A;  3FCC A;  4U5Y D;  3R9X A;  1MDF A;  4KTT A;  5BUR A;  3LGX A;  2QL8 A;  5BSU A;  2CXC A;  1MKY A;  2E8C A;  3LAX A;  4EAT A;  4G36 A;  3IEV A;  5E7Q A;  5LMU C;  4OX9 C;  2ASB A;  2ATW A;  1O92 A;  3N54 B;  1GPM A;  4XX2 A;  3RV2 A;  1IBK C;  3GKU A;  1RY2 A;  2D1R A;  3LNV A;  2HJG A;  4GXQ A;  2UXB C;  2PRO A;  1JOS A;  5T8T A;  4ZLP A;  4X66 C;  2P2F A;  1IBL C;  4PZP A;  4DG8 A;  4DCS A;  4JI2 C;  1FUG A;  5CZX A;  4NDN A;  3IEU A;  1XMO C;  4JI1 C;  2UXD C;  2E5L C;  1PG4 A;  5BSW A;  4KTV A;  1XNQ C;  3PES A;  4MTN A;  3KXW A;  2HHH C;  3AF5 A;  4ZJZ A;  4RVO A;  5IFI A;  2QVX X;  4LF8 C;  4DCU A;  1J5E C;  5IWA C;  3TQI A;  4BC9 A;  1HNX C;  1XRC A;  4LFB C;  4WS9 A;  2YCB A;  4RMN A;  4JI7 C;  4DR6 C;  4NXN C;  4DV5 C;  4DR4 C;  4DV7 C;  4X62 C;  1QWI A;  3CJE A;  4R1M A;  1ULT A;  4DV4 C;  2ZM6 C;  1HNZ C;  4DR7 C;  4IZ6 A;  5BSV A;  4D4G A;  5LMN C;  4DV0 C;  4IR7 A;  3E7W A;  4D56 A;  3VNS A;  4PRO C;  4DV3 C;  2WP0 C;  3A9V A;  2Y27 A;  3GR1 A;  1XRB A;  1XMQ C;  3JAM D;  3CW9 A;  1XRA A;  3L95 X;  1KKG A;  1UKK A;  4X65 C;  1O9T A;  1USP A;  1MXC A;  2UXC C;  3UZ0 A;  4ISB A;  2UUB C;  3TDE A;  5CZV A;  3NYQ A;  1WH9 A;  4BCA A;  5BST A;  3DAY A;  4DG9 A;  2VZE A;  1K0R A;  1V25 A;  1ML8 A;  1XNR C;  3A4I A;  3H2T A;  5AE2 A;  5BR8 C;  4ODJ A;  4JI0 C;  2VSQ A;  4BBY A;  1VLA A;  1EGA A;  5IT9 D;  3CW8 X;  3GPC A;  4L4Q A;  4DR1 C;  4DR2 C;  1ZB9 A;  3NPD A;  2D7V A;  5H9U A;  3N2Q A;  4D57 A;  3R9W A;  4G1I A;  2UU9 C;  4DCT A;  4R1L A;  5KYV A;  3NYR A;  4GKJ C;  1I94 C;  4BC7 A;  2P2M A;  4DR3 C;  2QVY X;  4YY3 C;  3UOW A;  2P2Q A;  5BSM A;  5KYT A;  2KZF A;  2D28 C;  2YWC A;  4JI6 C;  2P2B A;  4B3S C;  2BJO A;  3L8C A;  3OTO C;  4JV5 C;  1NYE A;  2V7B A;  2E7G A;  4KHP C;  2UUC C;  5BUS A;  3AF6 A;  2DYJ A;  4DUZ C;  1N34 C;  5ADZ A;  2QW0 X;  2EGT A;  1IBM C;  3J80 D;  3VNQ A;  1MXB A;  1MD9 A;  2D1S A;  1V26 A;  4JI4 C;  1P7L A;  2OPL A;  4GKK C;  2VQE C;  4BSZ A;  2UUA C;  4B3M C;  4FTF A;  4LF5 C;  1L2F A;  1PG3 A;  5T8S A;  1FJG C;  4LF6 C;  3I08 A;  2Y4N A;  5A19 A;  2P20 A;  4DV2 C;  4DV1 C;  4LF7 C;  1T5D X;  5DV9 A;  4DCV A;  2D1Q A;  2D1T A;  3VNR A;  4G37 A;  2OPL B;  3DHV A;  4MH4 A;  1O90 A;  1HR0 C;  4NOZ A;  2YWB A;  1N36 C;  3T1Y C;  3IPL A;  4I9G A;  4HPV A;  3GR0 A;  2E0G A;  4GXR A;  1WF3 A;  5BUQ A;  3B7W A;  4DR5 C;  3E7X A;  1AMU A;  2PT7 G;  1USP B;  4L7I A;  1YJ7 A;  4OYC A;  3J7A D;  5AE1 A;  4B3T C;  1BA3 A;  4DUY C;  5K85 A;  5FLX D;  2CY1 A;  1T5H X;  2Y4O A;  4X64 C;  1RG9 A;  2PN2 A;  4FUQ A;  4RM3 A;  4K0K C;  3ETC A;  4GS5 A;  3R44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...