2F4VC

30s ribosome + designer antibiotic
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2f4vC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2f4vC02
3R9XA 2QL8A 2ONFA 4B3MC 2KZFA 1N33C 1XNQC 4DR3C 2E7GA 4B3RC 4GKJC 3I07A 1NYEA 3J81D 2ZM6C 4X65C 3J7AD 3EERA 2ASBA 1WH9A 2HHHC 1XMQC 4LFAC 2DYJA 4LF9C 2UXBC 1VLAA 1IBKC 4DUYC 2UXDC 4DV5C 1UKKA 5IT9D 4DV6C 4B3SC 4GKKC 2BJOA 4OX9C 3T1HC 1JOSA 1PA4A 2UUBC 2E8FA 2PT7G 2HJGA 4X64C 2OPLA 4JI6C 3T1YC 1N34C 4DV3C 1IBMC 5LMUC 4DR7C 4LF8C 4X66C 4B3TC 2YCBA 3IEVA 4JI7C 4DR2C 4LF7C 2UUCC 1IBLC 2D7VA 3OTOC 4DV2C 4JI4C 1QWIA 4JYAC 3AF5A 4AQYC 4JV5C 1USPB 2F4VC 4BSZA 4DCVA 3J80D 4YY3C 4XX2A 4NXMC 4JI3C 4NOZA 4KHPC 1N2FA 4DV7C 1HNZC 4DCUA 1KKGA 1XNRC 4JI0C 4K0KC 1L2FA 2CXCA 1J5EC 2E8CA 3LUSA 1HNXC 4DCSA 3IEUA 4JI8C 2ATWA 2XR1A 4MH4A 1LQLA 4LFCC 3CJEA 5A2QD 2VQEC 4DR4C 4DR6C 1N36C 1ML8A 2UXCC 1HNWC 4DR1C 4YHHC 2PN2A 2VQFC 4LFBC 2UU9C 1HR0C 2EGTA 1MKYA 4DUZC 2E8EA 1ZB8A 3AF6A 4JI1C 4DV1C 4JI2C 4JI5C 1N32C 1WF3A 5LMNC 4X62C 4MTNA 4DV0C 2CY1A 1I94C 2E5LC 2OPLB 4NXNC 3R9WA 1ZB9A 2UUAC 1HH2P 4LF5C 4DCTA 5IWAC 3JAMD 1USPA 3GKUA 1FJGC 4LF6C 1EGAA 4LF4C 1K0RA 5FLXD 2JMPA 4DR5C 1XMOC 5BR8C 4DV4C
chains in the Genus database with same CATH superfamily
1XRBA 1RY2A 2QL8A 4ZLPA 1N33C 3CW8X 4DR3C 4B3RC 5LCIA 1NY8A 1YGTA 3J7AD 3NI2A 2D27A 5AE3A 1IBKC 5BUSA 2P2MA 4GKKC 3T1HC 2M5HA 3PBKA 3RV2A 3LNVA 4RM3A 4JI6C 4DV3C 3GR1A 4DR7C 4G37A 5K85A 4KTTA 3EQ6A 3FCCA 4LF7C 3AY0A 1MXCA 1IBLC 2D28C 1TH5A 4DV2C 4RLQA 4D56A 3L95X 1P7LA 4JYAC 2F4VC 5H9UA 3J80D 2ZTBA 4NDNA 4NOZA 5BSMA 3DAYA 4D4GA 4DV7C 4DG9A 4GS5A 4JI0C 3O2EA 3GR0A 1HNXC 3LUSA 4DCSA 3IEUA 5CZVA 3GPCA 4MH4A 4LFCC 4R1MA 2VQEC 4DR4C 2DHMA 5A1GA 4DR1C 3IPLA 3PESA 3H2TA 3N2QA 2UU9C 1QM4A 3ETOA 3VNSA 3UX2A 1ULTA 2P2JA 4JI2C 1N32C 3IMLA 1WF3A 3LAXA 3DLPX 1RG9A 2UUAC 1HH2P 5DV9A 2E0GA 5FLXD 2OO4A 2KZFA 2Z51A 4GKJC 1M6XA 5KYVA 3ETCA 1WH9A 5ADZA 1PG3A 5BSWA 2DYJA 4LF9C 1VLAA 2WP0C 2DPLA 5A1IA 5IT9D 4DV6C 2BJOA 4OX9C 2D1TA 4IR7A 2ZZNA 1MD9A 2ZZMA 3NYQA 2UUBC 2PG1E 2E8FA 2PT7G 2HJGA 2V7BA 5BSVA 2OPLA 3T1YC 1N34C 4ISBA 1IBMC 4PZPA 4G36A 1XS3A 3CQ1A 4DR2C 1T5HX 4JI4C 4L4QA 3AF5A 4AQYC 1USPB 3SO4A 4XX2A 4JI3C 2D1QA 4PUIA 5GTDA 1HNZC 4DCUA 1KKGA 4I9GA 2E8CA 4D4IA 2Y4NA 2KZ0A 4JI8C 4RVOA 3LNOA 1MXAA 2P02A 3CJEA 4WV3A 5A2QD 4PROC 1O92A 4HPVA 1N36C 2JNVA 2UXCC 1HNWC 2VQFC 2PROA 4L2ZA 4RLFA 4RM2A 2E8EA 3B7WA 4DV1C 4BBYA 1LCIA 1I94C 2E5LC 1ZB9A 3JAMD 5JRHA 3GKUA 1FJGC 4LF4C 2JMPA 4PHTA 4DV4C 1FUGA 3R9XA 2ONFA 4B3MC 1MDFA 4LE5A 3J81D 2Y4OA 1XMQC 3KXWA 4LFAC 2UXDC 4DV5C 1BA3A 4BC7A 4JM1A 1UKKA 5AE2A 2WD9A 2QVZX 3R44A 5T8TA 1GPMA 1JOSA 1PA4A 2VZEA 1XDXA 4X64C 2CU6A 3NPDA 1VEHA 1M6XC 3FM7A 4WS9A 5T8SA 3UZ0A 3IEVA 4JI7C 3L8CA 4RMNA 2D7VA 1O9TA 2OBVA 3OTOC 5KEIA 1QWIA 4OXIA 2BH1X 5K8FA 4ZJZA 3S82A 3UX3A 3A9UA 3UOWA 3CQ3A 2P2QA 1O93A 4I9FA 4NXMC 3FCEA 3RG2A 1XNRC 1L2FA 3A25A 2ATWA 1LQLA 1IB8A 4DR6C 1ML8A 3A9VA 1V60A 2PN2A 5BSTA 1O90A 3A26A 3TQIA 4EATA 1HR0C 2EGTA 5BURA 4DUZC 1ZB8A 3AF6A 4JI1C 5AE1A 4JI5C 3N54B 5LMNC 4X62C 4L7IA 4DV0C 1P4EC 1P4EA 3NYRA 4OYCA 4LF5C 4DCTA 5IWAC 2MCQA 1USPA 4LF6C 1K0RA 1PG4A 1XMOC 3A4IA 4KTVA 1XNQC 4U5YD 2E7GA 2VSQA 3I07A 1NYEA 2ZM6C 1PU1A 4X65C 3TDEA 3EERA 2ASBA 2HHHC 2MM9A 2UXBC 4DUYC 1V26A 2YWCA 2P20A 1AMUA 2AYAA 5E7QA 4B3SC 1UWDA 4K0BA 3G7SA 4BC9A 2NCLA 4D57A 5BUQA 2D1SA 5LMUC 4LF8C 2YWBA 4X66C 1YJ7A 1T5DX 4B3TC 2YCBA 5BSRA 5A19A 2UUCC 4PUHA 4PUGA 3UEBA 4G1IA 4JV5C 1XHJA 3LGXA 2M5OA 4BSZA 1V25A 4DCVA 4YY3C 4GXQA 1MDBA 3TR3A 4KHPC 1N2FA 3VNQA 5CZXA 4K0KC 2CXCA 1J5EC 4ODJA 4R1LA 2P2FA 2XR1A 2KDNA 3E7WA 1XRCA 2Y27A 3PROC 5IFIA 4YHHC 4LFBC 2MMAB 4FUTA 5BSUA 3DHVA 4R0MA 1MKYA 3C5EA 1MXBA 4IZ6A 3K6RA 5KYTA 4TPSB 1WCJA 1FLOA 3VNRA 4MTNA 3CW9A 4FUQA 2CY1A 2YX1A 4GXRA 2OPLB 4RVNA 4NXNC 3R9WA 2QVYX 2QW0X 1EGAA 3CQ2A 3E7XA 4BCAA 3I08A 3TUFA 2P2BA 4FTFA 1XRAA 4DR5C 5BR8C 2QVXX 4DG8A 2D1RA
chains in the Genus database with same CATH topology
1XRBA 1RY2A 2QL8A 4ZLPA 1N33C 3CW8X 4DR3C 4B3RC 2D1RA 3J7AD 3NI2A 2D27A 5AE3A 1IBKC 5BUSA 2P2MA 4GKKC 3T1HC 3PBKA 3RV2A 3LNVA 4RM3A 4JI6C 4DV3C 3GR1A 4DR7C 4G37A 5K85A 4KTTA 3EQ6A 3FCCA 4LF7C 1MXCA 1IBLC 2D28C 4DV2C 4RLQA 4D56A 3L95X 1P7LA 4JYAC 2F4VC 5H9UA 3J80D 4NDNA 4NOZA 5BSMA 3DAYA 4D4GA 4DV7C 4DG9A 4GS5A 4JI0C 3GR0A 1HNXC 3LUSA 4DCSA 3IEUA 5CZVA 3GPCA 4MH4A 4LFCC 4R1MA 2VQEC 4DR4C 5A1GA 4DR1C 3IPLA 3PESA 3H2TA 3N2QA 2UU9C 1QM4A 3ETOA 3VNSA 1ULTA 2P2JA 4JI2C 1N32C 3IMLA 1WF3A 3LAXA 3DLPX 1RG9A 2UUAC 1HH2P 5DV9A 2E0GA 5FLXD 2OO4A 2KZFA 4GKJC 5KYVA 3ETCA 1WH9A 5ADZA 1PG3A 5BSWA 2DYJA 4LF9C 1VLAA 2WP0C 2DPLA 5A1IA 5IT9D 4DV6C 2BJOA 4OX9C 2D1TA 4IR7A 1MD9A 3NYQA 2UUBC 2E8FA 2PT7G 2HJGA 2V7BA 5BSVA 2OPLA 3T1YC 1N34C 4ISBA 1IBMC 4PZPA 4G36A 4DR2C 1T5HX 4JI4C 4L4QA 3AF5A 4AQYC 1USPB 3SO4A 4XX2A 4JI3C 2D1QA 5GTDA 1HNZC 4DCUA 1KKGA 4I9GA 2E8CA 4D4IA 2Y4NA 4JI8C 4RVOA 1MXAA 2P02A 3CJEA 4WV3A 5A2QD 4PROC 1O92A 4HPVA 1N36C 2UXCC 1HNWC 2VQFC 2PROA 4L2ZA 4RLFA 4RM2A 2E8EA 3B7WA 4DV1C 4BBYA 1LCIA 1I94C 2E5LC 1ZB9A 3JAMD 5JRHA 3GKUA 1FJGC 4LF4C 2JMPA 4PHTA 4DV4C 1FUGA 3R9XA 2ONFA 4B3MC 1MDFA 4LE5A 3J81D 2Y4OA 1XMQC 3KXWA 4LFAC 2UXDC 4DV5C 1BA3A 4BC7A 4JM1A 1UKKA 5AE2A 2WD9A 2QVZX 3R44A 5T8TA 1GPMA 1JOSA 1PA4A 2VZEA 4X64C 3NPDA 4WS9A 5T8SA 3UZ0A 3IEVA 4JI7C 3L8CA 4RMNA 2D7VA 1O9TA 2OBVA 3OTOC 5KEIA 1QWIA 4OXIA 2BH1X 5K8FA 4ZJZA 3S82A 3A9UA 3UOWA 2P2QA 1O93A 4I9FA 4NXMC 3FCEA 3RG2A 1XNRC 1L2FA 2ATWA 1LQLA 4DR6C 1ML8A 3A9VA 2PN2A 5BSTA 1O90A 3TQIA 4EATA 1HR0C 2EGTA 5BURA 4DUZC 1ZB8A 3AF6A 4JI1C 5AE1A 4JI5C 3N54B 5LMNC 4X62C 4L7IA 4DV0C 3NYRA 4OYCA 4LF5C 4DCTA 5IWAC 1USPA 4LF6C 1K0RA 1PG4A 1XMOC 3A4IA 4KTVA 1XNQC 4U5YD 2E7GA 2VSQA 3I07A 1NYEA 2ZM6C 4X65C 3TDEA 3EERA 2ASBA 2HHHC 2UXBC 4DUYC 1V26A 2YWCA 2P20A 1AMUA 2AYAA 5E7QA 4B3SC 4K0BA 4BC9A 3G7SA 4D57A 5BUQA 2D1SA 5LMUC 4LF8C 2YWBA 4X66C 1YJ7A 1T5DX 4B3TC 2YCBA 5BSRA 5A19A 2UUCC 4G1IA 4JV5C 3LGXA 4BSZA 1V25A 4DCVA 4YY3C 4GXQA 1MDBA 4KHPC 1N2FA 3VNQA 5CZXA 4K0KC 2CXCA 1J5EC 4ODJA 4R1LA 2P2FA 2XR1A 3E7WA 1XRCA 2Y27A 3PROC 5IFIA 4YHHC 4LFBC 5BSUA 4FUTA 3DHVA 4R0MA 1MKYA 3C5EA 1MXBA 4IZ6A 5KYTA 4TPSB 3VNRA 4MTNA 3CW9A 4FUQA 2CY1A 4GXRA 4RVNA 2OPLB 4NXNC 3R9WA 2QVYX 2QW0X 1EGAA 3E7XA 4BCAA 3I08A 3TUFA 2P2BA 4FTFA 1XRAA 5BR8C 2QVXX 4DG8A 4DR5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R9X A;  2QL8 A;  2ONF A;  4B3M C;  2KZF A;  1N33 C;  1XNQ C;  4DR3 C;  2E7G A;  4B3R C;  4GKJ C;  3I07 A;  1NYE A;  3J81 D;  2ZM6 C;  4X65 C;  3J7A D;  3EER A;  2ASB A;  1WH9 A;  2HHH C;  1XMQ C;  4LFA C;  2DYJ A;  4LF9 C;  2UXB C;  1VLA A;  1IBK C;  4DUY C;  2UXD C;  4DV5 C;  1UKK A;  5IT9 D;  4DV6 C;  4B3S C;  4GKK C;  2BJO A;  4OX9 C;  3T1H C;  1JOS A;  1PA4 A;  2UUB C;  2E8F A;  2PT7 G;  2HJG A;  4X64 C;  2OPL A;  4JI6 C;  3T1Y C;  1N34 C;  4DV3 C;  1IBM C;  5LMU C;  4DR7 C;  4LF8 C;  4X66 C;  4B3T C;  2YCB A;  3IEV A;  4JI7 C;  4DR2 C;  4LF7 C;  2UUC C;  1IBL C;  2D7V A;  3OTO C;  4DV2 C;  4JI4 C;  1QWI A;  4JYA C;  3AF5 A;  4AQY C;  4JV5 C;  1USP B;  2F4V C;  4BSZ A;  4DCV A;  3J80 D;  4YY3 C;  4XX2 A;  4NXM C;  4JI3 C;  4NOZ A;  4KHP C;  1N2F A;  4DV7 C;  1HNZ C;  4DCU A;  1KKG A;  1XNR C;  4JI0 C;  4K0K C;  1L2F A;  2CXC A;  1J5E C;  2E8C A;  3LUS A;  1HNX C;  4DCS A;  3IEU A;  4JI8 C;  2ATW A;  2XR1 A;  4MH4 A;  1LQL A;  4LFC C;  3CJE A;  5A2Q D;  2VQE C;  4DR4 C;  4DR6 C;  1N36 C;  1ML8 A;  2UXC C;  1HNW C;  4DR1 C;  4YHH C;  2PN2 A;  2VQF C;  4LFB C;  2UU9 C;  1HR0 C;  2EGT A;  1MKY A;  4DUZ C;  2E8E A;  1ZB8 A;  3AF6 A;  4JI1 C;  4DV1 C;  4JI2 C;  4JI5 C;  1N32 C;  1WF3 A;  5LMN C;  4X62 C;  4MTN A;  4DV0 C;  2CY1 A;  1I94 C;  2E5L C;  2OPL B;  4NXN C;  3R9W A;  1ZB9 A;  2UUA C;  1HH2 P;  4LF5 C;  4DCT A;  5IWA C;  3JAM D;  1USP A;  3GKU A;  1FJG C;  4LF6 C;  1EGA A;  4LF4 C;  1K0R A;  5FLX D;  2JMP A;  4DR5 C;  1XMO C;  5BR8 C;  4DV4 C; 
#chains in the Genus database with same CATH topology
 1XRB A;  1RY2 A;  2QL8 A;  4ZLP A;  1N33 C;  3CW8 X;  4DR3 C;  4B3R C;  5LCI A;  1NY8 A;  1YGT A;  3J7A D;  3NI2 A;  2D27 A;  5AE3 A;  1IBK C;  5BUS A;  2P2M A;  4GKK C;  3T1H C;  2M5H A;  3PBK A;  3RV2 A;  3LNV A;  4RM3 A;  4JI6 C;  4DV3 C;  3GR1 A;  4DR7 C;  4G37 A;  5K85 A;  4KTT A;  3EQ6 A;  3FCC A;  4LF7 C;  3AY0 A;  1MXC A;  1IBL C;  2D28 C;  1TH5 A;  4DV2 C;  4RLQ A;  4D56 A;  3L95 X;  1P7L A;  4JYA C;  2F4V C;  5H9U A;  3J80 D;  2ZTB A;  4NDN A;  4NOZ A;  5BSM A;  3DAY A;  4D4G A;  4DV7 C;  4DG9 A;  4GS5 A;  4JI0 C;  3O2E A;  3GR0 A;  1HNX C;  3LUS A;  4DCS A;  3IEU A;  5CZV A;  3GPC A;  4MH4 A;  4LFC C;  4R1M A;  2VQE C;  4DR4 C;  2DHM A;  5A1G A;  4DR1 C;  3IPL A;  3PES A;  3H2T A;  3N2Q A;  2UU9 C;  1QM4 A;  3ETO A;  3VNS A;  3UX2 A;  1ULT A;  2P2J A;  4JI2 C;  1N32 C;  3IML A;  1WF3 A;  3LAX A;  3DLP X;  1RG9 A;  2UUA C;  1HH2 P;  5DV9 A;  2E0G A;  5FLX D;  2OO4 A;  2KZF A;  2Z51 A;  4GKJ C;  1M6X A;  5KYV A;  3ETC A;  1WH9 A;  5ADZ A;  1PG3 A;  5BSW A;  2DYJ A;  4LF9 C;  1VLA A;  2WP0 C;  2DPL A;  5A1I A;  5IT9 D;  4DV6 C;  2BJO A;  4OX9 C;  2D1T A;  4IR7 A;  2ZZN A;  1MD9 A;  2ZZM A;  3NYQ A;  2UUB C;  2PG1 E;  2E8F A;  2PT7 G;  2HJG A;  2V7B A;  5BSV A;  2OPL A;  3T1Y C;  1N34 C;  4ISB A;  1IBM C;  4PZP A;  4G36 A;  1XS3 A;  3CQ1 A;  4DR2 C;  1T5H X;  4JI4 C;  4L4Q A;  3AF5 A;  4AQY C;  1USP B;  3SO4 A;  4XX2 A;  4JI3 C;  2D1Q A;  4PUI A;  5GTD A;  1HNZ C;  4DCU A;  1KKG A;  4I9G A;  2E8C A;  4D4I A;  2Y4N A;  2KZ0 A;  4JI8 C;  4RVO A;  3LNO A;  1MXA A;  2P02 A;  3CJE A;  4WV3 A;  5A2Q D;  4PRO C;  1O92 A;  4HPV A;  1N36 C;  2JNV A;  2UXC C;  1HNW C;  2VQF C;  2PRO A;  4L2Z A;  4RLF A;  4RM2 A;  2E8E A;  3B7W A;  4DV1 C;  4BBY A;  1LCI A;  1I94 C;  2E5L C;  1ZB9 A;  3JAM D;  5JRH A;  3GKU A;  1FJG C;  4LF4 C;  2JMP A;  4PHT A;  4DV4 C;  1FUG A;  3R9X A;  2ONF A;  4B3M C;  1MDF A;  4LE5 A;  3J81 D;  2Y4O A;  1XMQ C;  3KXW A;  4LFA C;  2UXD C;  4DV5 C;  1BA3 A;  4BC7 A;  4JM1 A;  1UKK A;  5AE2 A;  2WD9 A;  2QVZ X;  3R44 A;  5T8T A;  1GPM A;  1JOS A;  1PA4 A;  2VZE A;  1XDX A;  4X64 C;  2CU6 A;  3NPD A;  1VEH A;  1M6X C;  3FM7 A;  4WS9 A;  5T8S A;  3UZ0 A;  3IEV A;  4JI7 C;  3L8C A;  4RMN A;  2D7V A;  1O9T A;  2OBV A;  3OTO C;  5KEI A;  1QWI A;  4OXI A;  2BH1 X;  5K8F A;  4ZJZ A;  3S82 A;  3UX3 A;  3A9U A;  3UOW A;  3CQ3 A;  2P2Q A;  1O93 A;  4I9F A;  4NXM C;  3FCE A;  3RG2 A;  1XNR C;  1L2F A;  3A25 A;  2ATW A;  1LQL A;  1IB8 A;  4DR6 C;  1ML8 A;  3A9V A;  1V60 A;  2PN2 A;  5BST A;  1O90 A;  3A26 A;  3TQI A;  4EAT A;  1HR0 C;  2EGT A;  5BUR A;  4DUZ C;  1ZB8 A;  3AF6 A;  4JI1 C;  5AE1 A;  4JI5 C;  3N54 B;  5LMN C;  4X62 C;  4L7I A;  4DV0 C;  1P4E C;  1P4E A;  3NYR A;  4OYC A;  4LF5 C;  4DCT A;  5IWA C;  2MCQ A;  1USP A;  4LF6 C;  1K0R A;  1PG4 A;  1XMO C;  3A4I A;  4KTV A;  1XNQ C;  4U5Y D;  2E7G A;  2VSQ A;  3I07 A;  1NYE A;  2ZM6 C;  1PU1 A;  4X65 C;  3TDE A;  3EER A;  2ASB A;  2HHH C;  2MM9 A;  2UXB C;  4DUY C;  1V26 A;  2YWC A;  2P20 A;  1AMU A;  2AYA A;  5E7Q A;  4B3S C;  1UWD A;  4K0B A;  3G7S A;  4BC9 A;  2NCL A;  4D57 A;  5BUQ A;  2D1S A;  5LMU C;  4LF8 C;  2YWB A;  4X66 C;  1YJ7 A;  1T5D X;  4B3T C;  2YCB A;  5BSR A;  5A19 A;  2UUC C;  4PUH A;  4PUG A;  3UEB A;  4G1I A;  4JV5 C;  1XHJ A;  3LGX A;  2M5O A;  4BSZ A;  1V25 A;  4DCV A;  4YY3 C;  4GXQ A;  1MDB A;  3TR3 A;  4KHP C;  1N2F A;  3VNQ A;  5CZX A;  4K0K C;  2CXC A;  1J5E C;  4ODJ A;  4R1L A;  2P2F A;  2XR1 A;  2KDN A;  3E7W A;  1XRC A;  2Y27 A;  3PRO C;  5IFI A;  4YHH C;  4LFB C;  2MMA B;  4FUT A;  5BSU A;  3DHV A;  4R0M A;  1MKY A;  3C5E A;  1MXB A;  4IZ6 A;  3K6R A;  5KYT A;  4TPS B;  1WCJ A;  1FLO A;  3VNR A;  4MTN A;  3CW9 A;  4FUQ A;  2CY1 A;  2YX1 A;  4GXR A;  2OPL B;  4RVN A;  4NXN C;  3R9W A;  2QVY X;  2QW0 X;  1EGA A;  3CQ2 A;  3E7X A;  4BCA A;  3I08 A;  3TUF A;  2P2B A;  4FTF A;  1XRA A;  4DR5 C;  5BR8 C;  2QVX X;  4DG8 A;  2D1R A; 
#chains in the Genus database with same CATH homology
 1XRB A;  1RY2 A;  2QL8 A;  4ZLP A;  1N33 C;  3CW8 X;  4DR3 C;  4B3R C;  2D1R A;  3J7A D;  3NI2 A;  2D27 A;  5AE3 A;  1IBK C;  5BUS A;  2P2M A;  4GKK C;  3T1H C;  3PBK A;  3RV2 A;  3LNV A;  4RM3 A;  4JI6 C;  4DV3 C;  3GR1 A;  4DR7 C;  4G37 A;  5K85 A;  4KTT A;  3EQ6 A;  3FCC A;  4LF7 C;  1MXC A;  1IBL C;  2D28 C;  4DV2 C;  4RLQ A;  4D56 A;  3L95 X;  1P7L A;  4JYA C;  2F4V C;  5H9U A;  3J80 D;  4NDN A;  4NOZ A;  5BSM A;  3DAY A;  4D4G A;  4DV7 C;  4DG9 A;  4GS5 A;  4JI0 C;  3GR0 A;  1HNX C;  3LUS A;  4DCS A;  3IEU A;  5CZV A;  3GPC A;  4MH4 A;  4LFC C;  4R1M A;  2VQE C;  4DR4 C;  5A1G A;  4DR1 C;  3IPL A;  3PES A;  3H2T A;  3N2Q A;  2UU9 C;  1QM4 A;  3ETO A;  3VNS A;  1ULT A;  2P2J A;  4JI2 C;  1N32 C;  3IML A;  1WF3 A;  3LAX A;  3DLP X;  1RG9 A;  2UUA C;  1HH2 P;  5DV9 A;  2E0G A;  5FLX D;  2OO4 A;  2KZF A;  4GKJ C;  5KYV A;  3ETC A;  1WH9 A;  5ADZ A;  1PG3 A;  5BSW A;  2DYJ A;  4LF9 C;  1VLA A;  2WP0 C;  2DPL A;  5A1I A;  5IT9 D;  4DV6 C;  2BJO A;  4OX9 C;  2D1T A;  4IR7 A;  1MD9 A;  3NYQ A;  2UUB C;  2E8F A;  2PT7 G;  2HJG A;  2V7B A;  5BSV A;  2OPL A;  3T1Y C;  1N34 C;  4ISB A;  1IBM C;  4PZP A;  4G36 A;  4DR2 C;  1T5H X;  4JI4 C;  4L4Q A;  3AF5 A;  4AQY C;  1USP B;  3SO4 A;  4XX2 A;  4JI3 C;  2D1Q A;  5GTD A;  1HNZ C;  4DCU A;  1KKG A;  4I9G A;  2E8C A;  4D4I A;  2Y4N A;  4JI8 C;  4RVO A;  1MXA A;  2P02 A;  3CJE A;  4WV3 A;  5A2Q D;  4PRO C;  1O92 A;  4HPV A;  1N36 C;  2UXC C;  1HNW C;  2VQF C;  2PRO A;  4L2Z A;  4RLF A;  4RM2 A;  2E8E A;  3B7W A;  4DV1 C;  4BBY A;  1LCI A;  1I94 C;  2E5L C;  1ZB9 A;  3JAM D;  5JRH A;  3GKU A;  1FJG C;  4LF4 C;  2JMP A;  4PHT A;  4DV4 C;  1FUG A;  3R9X A;  2ONF A;  4B3M C;  1MDF A;  4LE5 A;  3J81 D;  2Y4O A;  1XMQ C;  3KXW A;  4LFA C;  2UXD C;  4DV5 C;  1BA3 A;  4BC7 A;  4JM1 A;  1UKK A;  5AE2 A;  2WD9 A;  2QVZ X;  3R44 A;  5T8T A;  1GPM A;  1JOS A;  1PA4 A;  2VZE A;  4X64 C;  3NPD A;  4WS9 A;  5T8S A;  3UZ0 A;  3IEV A;  4JI7 C;  3L8C A;  4RMN A;  2D7V A;  1O9T A;  2OBV A;  3OTO C;  5KEI A;  1QWI A;  4OXI A;  2BH1 X;  5K8F A;  4ZJZ A;  3S82 A;  3A9U A;  3UOW A;  2P2Q A;  1O93 A;  4I9F A;  4NXM C;  3FCE A;  3RG2 A;  1XNR C;  1L2F A;  2ATW A;  1LQL A;  4DR6 C;  1ML8 A;  3A9V A;  2PN2 A;  5BST A;  1O90 A;  3TQI A;  4EAT A;  1HR0 C;  2EGT A;  5BUR A;  4DUZ C;  1ZB8 A;  3AF6 A;  4JI1 C;  5AE1 A;  4JI5 C;  3N54 B;  5LMN C;  4X62 C;  4L7I A;  4DV0 C;  3NYR A;  4OYC A;  4LF5 C;  4DCT A;  5IWA C;  1USP A;  4LF6 C;  1K0R A;  1PG4 A;  1XMO C;  3A4I A;  4KTV A;  1XNQ C;  4U5Y D;  2E7G A;  2VSQ A;  3I07 A;  1NYE A;  2ZM6 C;  4X65 C;  3TDE A;  3EER A;  2ASB A;  2HHH C;  2UXB C;  4DUY C;  1V26 A;  2YWC A;  2P20 A;  1AMU A;  2AYA A;  5E7Q A;  4B3S C;  4K0B A;  4BC9 A;  3G7S A;  4D57 A;  5BUQ A;  2D1S A;  5LMU C;  4LF8 C;  2YWB A;  4X66 C;  1YJ7 A;  1T5D X;  4B3T C;  2YCB A;  5BSR A;  5A19 A;  2UUC C;  4G1I A;  4JV5 C;  3LGX A;  4BSZ A;  1V25 A;  4DCV A;  4YY3 C;  4GXQ A;  1MDB A;  4KHP C;  1N2F A;  3VNQ A;  5CZX A;  4K0K C;  2CXC A;  1J5E C;  4ODJ A;  4R1L A;  2P2F A;  2XR1 A;  3E7W A;  1XRC A;  2Y27 A;  3PRO C;  5IFI A;  4YHH C;  4LFB C;  5BSU A;  4FUT A;  3DHV A;  4R0M A;  1MKY A;  3C5E A;  1MXB A;  4IZ6 A;  5KYT A;  4TPS B;  3VNR A;  4MTN A;  3CW9 A;  4FUQ A;  2CY1 A;  4GXR A;  4RVN A;  2OPL B;  4NXN C;  3R9W A;  2QVY X;  2QW0 X;  1EGA A;  3E7X A;  4BCA A;  3I08 A;  3TUF A;  2P2B A;  4FTF A;  1XRA A;  5BR8 C;  2QVX X;  4DG8 A;  4DR5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...