2F4VC

30s ribosome + designer antibiotic
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 29
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2f4vC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2f4vC02
4JI8C 1XMQC 1NYEA 4DV0C 2ATWA 2OPLA 1PA4A 4DCSA 2CXCA 1WF3A 4DR1C 4NXMC 5BR8C 5LMNC 4DR3C 4JI3C 4DCTA 5A2QD 3CJEA 2D7VA 4X65C 2BJOA 4DR5C 1EGAA 4YY3C 4DR4C 2UUCC 4B3RC 1ML8A 2E8FA 1IBKC 4GKJC 5IWAC 1I94C 2UXDC 2OPLB 4LFAC 1HR0C 4MH4A 3J81D 4LF8C 2UU9C 3J80D 1QWIA 1N36C 2UUAC 4JV5C 2E8EA 4LF4C 3OTOC 4AQYC 4X64C 4B3MC 1JOSA 3EERA 4NXNC 4DV3C 3AF6A 2E5LC 4GKKC 1FJGC 3IEVA 1ZB9A 4B3SC 4B3TC 4K0KC 2ASBA 4KHPC 4JI4C 3I07A 2XR1A 1HH2P 3R9XA 1KKGA 2CY1A 3AF5A 1ZB8A 1N33C 2EGTA 1N32C 1N2FA 4X62C 1IBLC 4DR7C 4DV2C 4DR2C 4DCVA 1K0RA 2JMPA 3IEUA 2DYJA 2E8CA 2ZM6C 4NOZA 3LUSA 1XMOC 1J5EC 3GKUA 4YHHC 1UKKA 4LF5C 1HNXC 4JI2C 1N34C 1XNRC 1MKYA 2HJGA 1USPB 2YCBA 3J7AD 2HHHC 2ONFA 4LF9C 2PT7G 1USPA 4XX2A 1WH9A 4LF6C 2UXCC 1L2FA 4DUZC 4DV1C 4JI5C 4DV6C 1HNZC 4JYAC 1XNQC 4JI1C 2PN2A 4JI6C 4DV5C 2F4VC 3R9WA 1LQLA 4JI7C 1IBMC 1HNWC 4OX9C 2VQFC 4MTNA 4DUYC 2E7GA 2UUBC 4BSZA 4DV7C 4LFCC 4LFBC 2QL8A 4LF7C 4JI0C 3T1YC 4DR6C 4DV4C 4DCUA 5LMUC 2VQEC 5IT9D 3T1HC 2UXBC 1VLAA 2KZFA 3JAMD 4X66C 5FLXD
chains in the Genus database with same CATH superfamily
4BC9A 2OPLA 1PA4A 4DR1C 1WF3A 5LMNC 4JI3C 5A2QD 4D4IA 2KZ0A 1BA3A 5T8TA 4D57A 2UUCC 4B3RC 4PUGA 4R0MA 5IWAC 5K8FA 2Z51A 4LFAC 5A1IA 1HR0C 3PROC 1TH5A 4U5YD 5K85A 1N36C 2UU9C 4JV5C 1MDFA 3RV2A 4X64C 3B7WA 1JOSA 5BSWA 4K0BA 1ULTA 3UX2A 4DV3C 1GPMA 1ZB9A 3UOWA 4B3SC 4K0KC 4D4GA 5KYTA 2ASBA 2XR1A 3S82A 2D1QA 3AF5A 5AE3A 1MD9A 2P20A 4DCVA 3A9UA 4GXQA 2JMPA 3IEUA 2DYJA 3UEBA 3GPCA 2ZM6C 3NYQA 3TDEA 1J5EC 4YHHC 4LF5C 1MXCA 4LF9C 4G37A 3DHVA 4PUIA 4I9GA 3NPDA 4R1LA 1L2FA 2E0GA 1T5HX 1HNZC 3R9WA 1HNWC 3A9VA 4D56A 2E7GA 3GR1A 4BSZA 4R1MA 2M5HA 5BSTA 2QL8A 2CU6A 2QVYX 3N2QA 4DCUA 5IT9D 3T1HC 2V7BA 3JAMD 1T5DX 4X66C 1O92A 5AE2A 2P2JA 1V25A 3NI2A 4JI8C 2MCQA 3G7SA 4PHTA 2ATWA 4DCSA 2CXCA 2ZZMA 4NXMC 2D7VA 2BJOA 2WD9A 4DR5C 2P2MA 4RLQA 1EGAA 4DR4C 2QW0X 3CQ1A 1ML8A 4GKJC 2JNVA 1M6XC 2UXDC 2OPLB 1YGTA 2DHMA 4ZJZA 1NY8A 4WS9A 3J81D 3L8CA 2PROA 2YX1A 2Y4OA 3A26A 2UUAC 2ZZNA 4LF4C 5LCIA 3TR3A 4B3MC 3NYRA 3LNVA 3EERA 1RG9A 1FJGC 3CQ3A 5BSVA 4GS5A 3ETOA 4JI4C 2YWBA 1HH2P 1KKGA 1ZB8A 5BSUA 1N2FA 4X62C 4DG9A 4DV2C 1M6XA 5JRHA 5KEIA 1QM4A 3VNQA 3LUSA 3AY0A 1UKKA 1HNXC 3GR0A 4JI2C 3L95X 3EQ6A 3LGXA 1USPB 3FCEA 3J7AD 2ONFA 2QVZX 1O93A 1WH9A 2D27A 4PUHA 2OBVA 2NCLA 2Y4NA 4DV6C 4JYAC 1MDBA 2KDNA 4DV5C 4FUQA 1VEHA 4L4QA 4RM2A 3IPLA 4IR7A 4MTNA 4DUYC 5BSMA 1RY2A 4RVOA 2UUBC 3R44A 3UX3A 4LF7C 3FM7A 4IZ6A 5IFIA 4L7IA 3N54B 3IMLA 2VQEC 5LMUC 2UXBC 1VLAA 2KZFA 2Y27A 2MM9A 1XMQC 1V60A 1FUGA 4DV0C 2ZTBA 5BR8C 2AYAA 1IB8A 3CJEA 4RM3A 1XS3A 5BSRA 3KXWA 2E8FA 1IBKC 1V26A 1O9TA 4LF8C 3FCCA 2VSQA 3ETCA 3J80D 2P2BA 2E8EA 1WCJA 1MXAA 3OTOC 4AQYC 1XHJA 3CW8X 2MMAB 1P7LA 4TPSB 3VNRA 2DPLA 1UWDA 3DAYA 3R9XA 2CY1A 2PG1E 1N33C 2EGTA 4KTVA 3K6RA 1IBLC 2OO4A 1K0RA 4NOZA 1XMOC 3GKUA 2P2FA 4HPVA 1N34C 1XNRC 1MKYA 2HJGA 5BUQA 4L2ZA 2YCBA 2D28C 2PT7G 1USPA 4XX2A 4LF6C 4JM1A 2D1SA 2UXCC 5CZXA 4JI5C 5BURA 3E7WA 2PN2A 4JI1C 1PU1A 5T8SA 1LQLA 1AMUA 4JI7C 1IBMC 3UZ0A 4OX9C 1P4EA 5A19A 2VQFC 2YWCA 5KYVA 2D1TA 4BCAA 1P4EC 4JI0C 5A1GA 4ZLPA 5ADZA 4RLFA 2VZEA 4DG8A 5FLXD 4PZPA 4GXRA 3E7XA 1O90A 1NYEA 3H2TA 2M5OA 4DR3C 4RVNA 4DCTA 5H9UA 4X65C 3I08A 3LAXA 3RG2A 4YY3C 1YJ7A 4FTFA 3PESA 4EATA 1XRAA 1MXBA 1I94C 1XDXA 4NDNA 4MH4A 2P02A 3VNSA 1QWIA 4OYCA 4LE5A 4NXNC 3AF6A 3O2EA 2E5LC 4GKKC 2P2QA 3IEVA 1FLOA 4B3TC 1XRCA 4KHPC 3I07A 5CZVA 4I9FA 4ODJA 1N32C 5E7QA 4FUTA 1LCIA 4BBYA 4DR7C 4DR2C 1XRBA 3LNOA 4WV3A 2E8CA 4OXIA 4ISBA 4RMNA 2HHHC 2D1RA 4G1IA 2QVXX 2BH1X 4BC7A 4DUZC 4DV1C 3PBKA 4KTTA 1XNQC 4JI6C 2F4VC 3DLPX 3A4IA 3A25A 5AE1A 5BUSA 3CQ2A 4PROC 4DV7C 4LFCC 3CW9A 2WP0C 5DV9A 4G36A 3TQIA 4LFBC 1PG3A 3T1YC 4DR6C 4DV4C 1PG4A 3SO4A 5GTDA 3TUFA 3C5EA
chains in the Genus database with same CATH topology
4BC9A 2OPLA 1PA4A 4DR1C 1WF3A 5LMNC 4JI3C 5A2QD 4D4IA 1BA3A 5T8TA 4D57A 2UUCC 4B3RC 4R0MA 5IWAC 5K8FA 4LFAC 5A1IA 1HR0C 3PROC 4U5YD 5K85A 1N36C 2UU9C 4JV5C 1MDFA 3RV2A 4X64C 3B7WA 1JOSA 5BSWA 4K0BA 1ULTA 4DV3C 1GPMA 1ZB9A 3UOWA 4B3SC 4K0KC 4D4GA 5KYTA 2ASBA 2XR1A 3S82A 2D1QA 3AF5A 5AE3A 1MD9A 2P20A 4DCVA 3A9UA 4GXQA 2JMPA 3IEUA 2DYJA 3GPCA 2ZM6C 3NYQA 3TDEA 1J5EC 4YHHC 4LF5C 1MXCA 4LF9C 4G37A 3DHVA 4I9GA 3NPDA 4R1LA 1L2FA 2E0GA 1T5HX 1HNZC 3R9WA 1HNWC 3A9VA 4D56A 2E7GA 3GR1A 4BSZA 4R1MA 5BSTA 2QL8A 2QVYX 3N2QA 4DCUA 5IT9D 3T1HC 2V7BA 3JAMD 1T5DX 4X66C 1O92A 5AE2A 1V25A 2P2JA 3NI2A 4JI8C 3G7SA 4PHTA 2ATWA 4DCSA 2CXCA 4NXMC 2D7VA 2BJOA 2WD9A 4DR5C 2P2MA 4RLQA 1EGAA 4DR4C 2QW0X 1ML8A 4GKJC 2UXDC 2OPLB 4ZJZA 4WS9A 3J81D 3L8CA 2PROA 2Y4OA 2UUAC 4LF4C 4B3MC 3NYRA 3LNVA 3EERA 1RG9A 1FJGC 5BSVA 4GS5A 3ETOA 4JI4C 2YWBA 1HH2P 1KKGA 1ZB8A 5BSUA 1N2FA 4X62C 4DG9A 4DV2C 5JRHA 5KEIA 1QM4A 3VNQA 3LUSA 1UKKA 1HNXC 3GR0A 4JI2C 3L95X 3EQ6A 3LGXA 1USPB 3FCEA 3J7AD 2ONFA 2QVZX 1O93A 1WH9A 2D27A 2OBVA 2Y4NA 4DV6C 4JYAC 1MDBA 4DV5C 4FUQA 4L4QA 4RM2A 3IPLA 4IR7A 4MTNA 4DUYC 5BSMA 1RY2A 4RVOA 2UUBC 3R44A 4LF7C 4IZ6A 5IFIA 4L7IA 3N54B 3IMLA 2VQEC 5LMUC 2UXBC 1VLAA 2KZFA 2Y27A 1XMQC 1FUGA 4DV0C 5BR8C 2AYAA 3CJEA 4RM3A 5BSRA 3KXWA 2E8FA 1IBKC 1V26A 1O9TA 4LF8C 3FCCA 2VSQA 3ETCA 3J80D 2P2BA 2E8EA 1MXAA 3OTOC 4AQYC 3CW8X 1P7LA 4TPSB 3VNRA 2DPLA 3DAYA 3R9XA 2CY1A 1N33C 2EGTA 4KTVA 1IBLC 2OO4A 1K0RA 4NOZA 1XMOC 3GKUA 2P2FA 4HPVA 1N34C 1XNRC 1MKYA 2HJGA 5BUQA 4L2ZA 2YCBA 2D28C 2PT7G 1USPA 4XX2A 4LF6C 4JM1A 2D1SA 2UXCC 5CZXA 4JI5C 5BURA 3E7WA 2PN2A 4JI1C 5T8SA 1LQLA 1AMUA 4JI7C 1IBMC 3UZ0A 4OX9C 5A19A 2VQFC 2YWCA 5KYVA 2D1TA 4BCAA 4JI0C 5A1GA 4ZLPA 5ADZA 4RLFA 2VZEA 4DG8A 5FLXD 4PZPA 4GXRA 3E7XA 1O90A 1NYEA 3H2TA 4DR3C 4RVNA 4DCTA 5H9UA 4X65C 3I08A 3LAXA 3RG2A 4YY3C 1YJ7A 4FTFA 3PESA 4EATA 1XRAA 1MXBA 1I94C 4NDNA 4MH4A 2P02A 3VNSA 1QWIA 4OYCA 4LE5A 4NXNC 3AF6A 2E5LC 4GKKC 2P2QA 3IEVA 4B3TC 1XRCA 4KHPC 3I07A 5CZVA 4I9FA 4ODJA 1N32C 5E7QA 4FUTA 1LCIA 4BBYA 4DR7C 4DR2C 1XRBA 4WV3A 2E8CA 4OXIA 4ISBA 4RMNA 2HHHC 2D1RA 4G1IA 2QVXX 2BH1X 4BC7A 4DUZC 4DV1C 3PBKA 4KTTA 1XNQC 4JI6C 2F4VC 3DLPX 3A4IA 5AE1A 5BUSA 4DV7C 4PROC 4LFCC 3CW9A 2WP0C 5DV9A 4G36A 3TQIA 4LFBC 1PG3A 3T1YC 4DR6C 4DV4C 1PG4A 3SO4A 5GTDA 3TUFA 3C5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 C;  1XMQ C;  1NYE A;  4DV0 C;  2ATW A;  2OPL A;  1PA4 A;  4DCS A;  2CXC A;  1WF3 A;  4DR1 C;  4NXM C;  5BR8 C;  5LMN C;  4DR3 C;  4JI3 C;  4DCT A;  5A2Q D;  3CJE A;  2D7V A;  4X65 C;  2BJO A;  4DR5 C;  1EGA A;  4YY3 C;  4DR4 C;  2UUC C;  4B3R C;  1ML8 A;  2E8F A;  1IBK C;  4GKJ C;  5IWA C;  1I94 C;  2UXD C;  2OPL B;  4LFA C;  1HR0 C;  4MH4 A;  3J81 D;  4LF8 C;  2UU9 C;  3J80 D;  1QWI A;  1N36 C;  2UUA C;  4JV5 C;  2E8E A;  4LF4 C;  3OTO C;  4AQY C;  4X64 C;  4B3M C;  1JOS A;  3EER A;  4NXN C;  4DV3 C;  3AF6 A;  2E5L C;  4GKK C;  1FJG C;  3IEV A;  1ZB9 A;  4B3S C;  4B3T C;  4K0K C;  2ASB A;  4KHP C;  4JI4 C;  3I07 A;  2XR1 A;  1HH2 P;  3R9X A;  1KKG A;  2CY1 A;  3AF5 A;  1ZB8 A;  1N33 C;  2EGT A;  1N32 C;  1N2F A;  4X62 C;  1IBL C;  4DR7 C;  4DV2 C;  4DR2 C;  4DCV A;  1K0R A;  2JMP A;  3IEU A;  2DYJ A;  2E8C A;  2ZM6 C;  4NOZ A;  3LUS A;  1XMO C;  1J5E C;  3GKU A;  4YHH C;  1UKK A;  4LF5 C;  1HNX C;  4JI2 C;  1N34 C;  1XNR C;  1MKY A;  2HJG A;  1USP B;  2YCB A;  3J7A D;  2HHH C;  2ONF A;  4LF9 C;  2PT7 G;  1USP A;  4XX2 A;  1WH9 A;  4LF6 C;  2UXC C;  1L2F A;  4DUZ C;  4DV1 C;  4JI5 C;  4DV6 C;  1HNZ C;  4JYA C;  1XNQ C;  4JI1 C;  2PN2 A;  4JI6 C;  4DV5 C;  2F4V C;  3R9W A;  1LQL A;  4JI7 C;  1IBM C;  1HNW C;  4OX9 C;  2VQF C;  4MTN A;  4DUY C;  2E7G A;  2UUB C;  4BSZ A;  4DV7 C;  4LFC C;  4LFB C;  2QL8 A;  4LF7 C;  4JI0 C;  3T1Y C;  4DR6 C;  4DV4 C;  4DCU A;  5LMU C;  2VQE C;  5IT9 D;  3T1H C;  2UXB C;  1VLA A;  2KZF A;  3JAM D;  4X66 C;  5FLX D; 
#chains in the Genus database with same CATH topology
 4BC9 A;  2OPL A;  1PA4 A;  4DR1 C;  1WF3 A;  5LMN C;  4JI3 C;  5A2Q D;  4D4I A;  2KZ0 A;  1BA3 A;  5T8T A;  4D57 A;  2UUC C;  4B3R C;  4PUG A;  4R0M A;  5IWA C;  5K8F A;  2Z51 A;  4LFA C;  5A1I A;  1HR0 C;  3PRO C;  1TH5 A;  4U5Y D;  5K85 A;  1N36 C;  2UU9 C;  4JV5 C;  1MDF A;  3RV2 A;  4X64 C;  3B7W A;  1JOS A;  5BSW A;  4K0B A;  1ULT A;  3UX2 A;  4DV3 C;  1GPM A;  1ZB9 A;  3UOW A;  4B3S C;  4K0K C;  4D4G A;  5KYT A;  2ASB A;  2XR1 A;  3S82 A;  2D1Q A;  3AF5 A;  5AE3 A;  1MD9 A;  2P20 A;  4DCV A;  3A9U A;  4GXQ A;  2JMP A;  3IEU A;  2DYJ A;  3UEB A;  3GPC A;  2ZM6 C;  3NYQ A;  3TDE A;  1J5E C;  4YHH C;  4LF5 C;  1MXC A;  4LF9 C;  4G37 A;  3DHV A;  4PUI A;  4I9G A;  3NPD A;  4R1L A;  1L2F A;  2E0G A;  1T5H X;  1HNZ C;  3R9W A;  1HNW C;  3A9V A;  4D56 A;  2E7G A;  3GR1 A;  4BSZ A;  4R1M A;  2M5H A;  5BST A;  2QL8 A;  2CU6 A;  2QVY X;  3N2Q A;  4DCU A;  5IT9 D;  3T1H C;  2V7B A;  3JAM D;  1T5D X;  4X66 C;  1O92 A;  5AE2 A;  2P2J A;  1V25 A;  3NI2 A;  4JI8 C;  2MCQ A;  3G7S A;  4PHT A;  2ATW A;  4DCS A;  2CXC A;  2ZZM A;  4NXM C;  2D7V A;  2BJO A;  2WD9 A;  4DR5 C;  2P2M A;  4RLQ A;  1EGA A;  4DR4 C;  2QW0 X;  3CQ1 A;  1ML8 A;  4GKJ C;  2JNV A;  1M6X C;  2UXD C;  2OPL B;  1YGT A;  2DHM A;  4ZJZ A;  1NY8 A;  4WS9 A;  3J81 D;  3L8C A;  2PRO A;  2YX1 A;  2Y4O A;  3A26 A;  2UUA C;  2ZZN A;  4LF4 C;  5LCI A;  3TR3 A;  4B3M C;  3NYR A;  3LNV A;  3EER A;  1RG9 A;  1FJG C;  3CQ3 A;  5BSV A;  4GS5 A;  3ETO A;  4JI4 C;  2YWB A;  1HH2 P;  1KKG A;  1ZB8 A;  5BSU A;  1N2F A;  4X62 C;  4DG9 A;  4DV2 C;  1M6X A;  5JRH A;  5KEI A;  1QM4 A;  3VNQ A;  3LUS A;  3AY0 A;  1UKK A;  1HNX C;  3GR0 A;  4JI2 C;  3L95 X;  3EQ6 A;  3LGX A;  1USP B;  3FCE A;  3J7A D;  2ONF A;  2QVZ X;  1O93 A;  1WH9 A;  2D27 A;  4PUH A;  2OBV A;  2NCL A;  2Y4N A;  4DV6 C;  4JYA C;  1MDB A;  2KDN A;  4DV5 C;  4FUQ A;  1VEH A;  4L4Q A;  4RM2 A;  3IPL A;  4IR7 A;  4MTN A;  4DUY C;  5BSM A;  1RY2 A;  4RVO A;  2UUB C;  3R44 A;  3UX3 A;  4LF7 C;  3FM7 A;  4IZ6 A;  5IFI A;  4L7I A;  3N54 B;  3IML A;  2VQE C;  5LMU C;  2UXB C;  1VLA A;  2KZF A;  2Y27 A;  2MM9 A;  1XMQ C;  1V60 A;  1FUG A;  4DV0 C;  2ZTB A;  5BR8 C;  2AYA A;  1IB8 A;  3CJE A;  4RM3 A;  1XS3 A;  5BSR A;  3KXW A;  2E8F A;  1IBK C;  1V26 A;  1O9T A;  4LF8 C;  3FCC A;  2VSQ A;  3ETC A;  3J80 D;  2P2B A;  2E8E A;  1WCJ A;  1MXA A;  3OTO C;  4AQY C;  1XHJ A;  3CW8 X;  2MMA B;  1P7L A;  4TPS B;  3VNR A;  2DPL A;  1UWD A;  3DAY A;  3R9X A;  2CY1 A;  2PG1 E;  1N33 C;  2EGT A;  4KTV A;  3K6R A;  1IBL C;  2OO4 A;  1K0R A;  4NOZ A;  1XMO C;  3GKU A;  2P2F A;  4HPV A;  1N34 C;  1XNR C;  1MKY A;  2HJG A;  5BUQ A;  4L2Z A;  2YCB A;  2D28 C;  2PT7 G;  1USP A;  4XX2 A;  4LF6 C;  4JM1 A;  2D1S A;  2UXC C;  5CZX A;  4JI5 C;  5BUR A;  3E7W A;  2PN2 A;  4JI1 C;  1PU1 A;  5T8S A;  1LQL A;  1AMU A;  4JI7 C;  1IBM C;  3UZ0 A;  4OX9 C;  1P4E A;  5A19 A;  2VQF C;  2YWC A;  5KYV A;  2D1T A;  4BCA A;  1P4E C;  4JI0 C;  5A1G A;  4ZLP A;  5ADZ A;  4RLF A;  2VZE A;  4DG8 A;  5FLX D;  4PZP A;  4GXR A;  3E7X A;  1O90 A;  1NYE A;  3H2T A;  2M5O A;  4DR3 C;  4RVN A;  4DCT A;  5H9U A;  4X65 C;  3I08 A;  3LAX A;  3RG2 A;  4YY3 C;  1YJ7 A;  4FTF A;  3PES A;  4EAT A;  1XRA A;  1MXB A;  1I94 C;  1XDX A;  4NDN A;  4MH4 A;  2P02 A;  3VNS A;  1QWI A;  4OYC A;  4LE5 A;  4NXN C;  3AF6 A;  3O2E A;  2E5L C;  4GKK C;  2P2Q A;  3IEV A;  1FLO A;  4B3T C;  1XRC A;  4KHP C;  3I07 A;  5CZV A;  4I9F A;  4ODJ A;  1N32 C;  5E7Q A;  4FUT A;  1LCI A;  4BBY A;  4DR7 C;  4DR2 C;  1XRB A;  3LNO A;  4WV3 A;  2E8C A;  4OXI A;  4ISB A;  4RMN A;  2HHH C;  2D1R A;  4G1I A;  2QVX X;  2BH1 X;  4BC7 A;  4DUZ C;  4DV1 C;  3PBK A;  4KTT A;  1XNQ C;  4JI6 C;  2F4V C;  3DLP X;  3A4I A;  3A25 A;  5AE1 A;  5BUS A;  3CQ2 A;  4PRO C;  4DV7 C;  4LFC C;  3CW9 A;  2WP0 C;  5DV9 A;  4G36 A;  3TQI A;  4LFB C;  1PG3 A;  3T1Y C;  4DR6 C;  4DV4 C;  1PG4 A;  3SO4 A;  5GTD A;  3TUF A;  3C5E A; 
#chains in the Genus database with same CATH homology
 4BC9 A;  2OPL A;  1PA4 A;  4DR1 C;  1WF3 A;  5LMN C;  4JI3 C;  5A2Q D;  4D4I A;  1BA3 A;  5T8T A;  4D57 A;  2UUC C;  4B3R C;  4R0M A;  5IWA C;  5K8F A;  4LFA C;  5A1I A;  1HR0 C;  3PRO C;  4U5Y D;  5K85 A;  1N36 C;  2UU9 C;  4JV5 C;  1MDF A;  3RV2 A;  4X64 C;  3B7W A;  1JOS A;  5BSW A;  4K0B A;  1ULT A;  4DV3 C;  1GPM A;  1ZB9 A;  3UOW A;  4B3S C;  4K0K C;  4D4G A;  5KYT A;  2ASB A;  2XR1 A;  3S82 A;  2D1Q A;  3AF5 A;  5AE3 A;  1MD9 A;  2P20 A;  4DCV A;  3A9U A;  4GXQ A;  2JMP A;  3IEU A;  2DYJ A;  3GPC A;  2ZM6 C;  3NYQ A;  3TDE A;  1J5E C;  4YHH C;  4LF5 C;  1MXC A;  4LF9 C;  4G37 A;  3DHV A;  4I9G A;  3NPD A;  4R1L A;  1L2F A;  2E0G A;  1T5H X;  1HNZ C;  3R9W A;  1HNW C;  3A9V A;  4D56 A;  2E7G A;  3GR1 A;  4BSZ A;  4R1M A;  5BST A;  2QL8 A;  2QVY X;  3N2Q A;  4DCU A;  5IT9 D;  3T1H C;  2V7B A;  3JAM D;  1T5D X;  4X66 C;  1O92 A;  5AE2 A;  1V25 A;  2P2J A;  3NI2 A;  4JI8 C;  3G7S A;  4PHT A;  2ATW A;  4DCS A;  2CXC A;  4NXM C;  2D7V A;  2BJO A;  2WD9 A;  4DR5 C;  2P2M A;  4RLQ A;  1EGA A;  4DR4 C;  2QW0 X;  1ML8 A;  4GKJ C;  2UXD C;  2OPL B;  4ZJZ A;  4WS9 A;  3J81 D;  3L8C A;  2PRO A;  2Y4O A;  2UUA C;  4LF4 C;  4B3M C;  3NYR A;  3LNV A;  3EER A;  1RG9 A;  1FJG C;  5BSV A;  4GS5 A;  3ETO A;  4JI4 C;  2YWB A;  1HH2 P;  1KKG A;  1ZB8 A;  5BSU A;  1N2F A;  4X62 C;  4DG9 A;  4DV2 C;  5JRH A;  5KEI A;  1QM4 A;  3VNQ A;  3LUS A;  1UKK A;  1HNX C;  3GR0 A;  4JI2 C;  3L95 X;  3EQ6 A;  3LGX A;  1USP B;  3FCE A;  3J7A D;  2ONF A;  2QVZ X;  1O93 A;  1WH9 A;  2D27 A;  2OBV A;  2Y4N A;  4DV6 C;  4JYA C;  1MDB A;  4DV5 C;  4FUQ A;  4L4Q A;  4RM2 A;  3IPL A;  4IR7 A;  4MTN A;  4DUY C;  5BSM A;  1RY2 A;  4RVO A;  2UUB C;  3R44 A;  4LF7 C;  4IZ6 A;  5IFI A;  4L7I A;  3N54 B;  3IML A;  2VQE C;  5LMU C;  2UXB C;  1VLA A;  2KZF A;  2Y27 A;  1XMQ C;  1FUG A;  4DV0 C;  5BR8 C;  2AYA A;  3CJE A;  4RM3 A;  5BSR A;  3KXW A;  2E8F A;  1IBK C;  1V26 A;  1O9T A;  4LF8 C;  3FCC A;  2VSQ A;  3ETC A;  3J80 D;  2P2B A;  2E8E A;  1MXA A;  3OTO C;  4AQY C;  3CW8 X;  1P7L A;  4TPS B;  3VNR A;  2DPL A;  3DAY A;  3R9X A;  2CY1 A;  1N33 C;  2EGT A;  4KTV A;  1IBL C;  2OO4 A;  1K0R A;  4NOZ A;  1XMO C;  3GKU A;  2P2F A;  4HPV A;  1N34 C;  1XNR C;  1MKY A;  2HJG A;  5BUQ A;  4L2Z A;  2YCB A;  2D28 C;  2PT7 G;  1USP A;  4XX2 A;  4LF6 C;  4JM1 A;  2D1S A;  2UXC C;  5CZX A;  4JI5 C;  5BUR A;  3E7W A;  2PN2 A;  4JI1 C;  5T8S A;  1LQL A;  1AMU A;  4JI7 C;  1IBM C;  3UZ0 A;  4OX9 C;  5A19 A;  2VQF C;  2YWC A;  5KYV A;  2D1T A;  4BCA A;  4JI0 C;  5A1G A;  4ZLP A;  5ADZ A;  4RLF A;  2VZE A;  4DG8 A;  5FLX D;  4PZP A;  4GXR A;  3E7X A;  1O90 A;  1NYE A;  3H2T A;  4DR3 C;  4RVN A;  4DCT A;  5H9U A;  4X65 C;  3I08 A;  3LAX A;  3RG2 A;  4YY3 C;  1YJ7 A;  4FTF A;  3PES A;  4EAT A;  1XRA A;  1MXB A;  1I94 C;  4NDN A;  4MH4 A;  2P02 A;  3VNS A;  1QWI A;  4OYC A;  4LE5 A;  4NXN C;  3AF6 A;  2E5L C;  4GKK C;  2P2Q A;  3IEV A;  4B3T C;  1XRC A;  4KHP C;  3I07 A;  5CZV A;  4I9F A;  4ODJ A;  1N32 C;  5E7Q A;  4FUT A;  1LCI A;  4BBY A;  4DR7 C;  4DR2 C;  1XRB A;  4WV3 A;  2E8C A;  4OXI A;  4ISB A;  4RMN A;  2HHH C;  2D1R A;  4G1I A;  2QVX X;  2BH1 X;  4BC7 A;  4DUZ C;  4DV1 C;  3PBK A;  4KTT A;  1XNQ C;  4JI6 C;  2F4V C;  3DLP X;  3A4I A;  5AE1 A;  5BUS A;  4DV7 C;  4PRO C;  4LFC C;  3CW9 A;  2WP0 C;  5DV9 A;  4G36 A;  3TQI A;  4LFB C;  1PG3 A;  3T1Y C;  4DR6 C;  4DV4 C;  1PG4 A;  3SO4 A;  5GTD A;  3TUF A;  3C5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...