5LMUC

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5lmuC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5lmuC02
4XX2A 2VQFC 4BSZA 4LFAC 4JI5C 2UXDC 1MKYA 2E5LC 4DR1C 4B3MC 4JI8C 2D7VA 2JMPA 1ZB9A 2DYJA 1I94C 2VQEC 2UXCC 4DUZC 4DV6C 2CY1A 2EGTA 1USPB 5LMUC 4DV1C 4LF4C 1XNRC 1UKKA 1N36C 5A2QD 3I07A 4JV5C 3T1HC 2E8FA 4DR5C 3AF5A 4MTNA 4NXNC 1IBLC 4B3TC 1N33C 5IT9D 1VLAA 3CJEA 2HJGA 5BR8C 4LF9C 4JYAC 2OPLA 4YHHC 4DV0C 1LQLA 4DUYC 1N2FA 1HNZC 1L2FA 4GKKC 1WH9A 3LUSA 1J5EC 2E7GA 4NXMC 1K0RA 4DR3C 1IBKC 1PA4A 4DCUA 4AQYC 2E8CA 4KHPC 4JI2C 4LFBC 1ML8A 2UUBC 4DR4C 3J7AD 1QWIA 5FLXD 4DV4C 4JI3C 1HNXC 1XNQC 1HH2P 1ZB8A 3J81D 2UU9C 4LF8C 1WF3A 4JI4C 2UUAC 2ASBA 4LF7C 1EGAA 5LMNC 4DCTA 4DV7C 4DR7C 4DR2C 4DV5C 4JI7C 3IEUA 2BJOA 1N34C 3R9WA 3AF6A 4DCVA 2ZM6C 4NOZA 4JI1C 4LFCC 2XR1A 2HHHC 1JOSA 4X66C 4B3RC 2OPLB 3IEVA 2PT7G 1FJGC 2CXCA 3R9XA 2UXBC 3EERA 4X62C 1USPA 3GKUA 4DV3C 1XMQC 4YY3C 4K0KC 4GKJC 1HNWC 2F4VC 1HR0C 2PN2A 4DV2C 2KZFA 4MH4A 2UUCC 2YCBA 4X65C 1NYEA 4JI6C 4OX9C 3OTOC 4DR6C 4JI0C 3J80D 4X64C 1IBMC 5IWAC 4LF5C 4B3SC 2ATWA 4LF6C 4DCSA 1KKGA 1N32C 3JAMD 2E8EA 3T1YC 1XMOC 2QL8A 2ONFA
chains in the Genus database with same CATH superfamily
2VQFC 4LFAC 2YWBA 1MKYA 3SO4A 4JI8C 1T5DX 4GS5A 3N2QA 4GXQA 1V60A 4DV6C 2CY1A 2EGTA 5BSTA 5K85A 3T1HC 2E0GA 4OXIA 1MXCA 1M6XA 1LCIA 3L95X 4DV0C 4G36A 2JNVA 1N2FA 4RVNA 1XS3A 4K0BA 1J5EC 3LNOA 4AQYC 1ML8A 2UUBC 2Y27A 3AY0A 1PU1A 5FLXD 4JI3C 1HNXC 1HH2P 1ZB8A 3RG2A 4RMNA 4LF8C 1YGTA 1WF3A 3UX3A 3E7WA 3DAYA 1QM4A 1O92A 2BJOA 1N34C 3AF6A 5K8FA 2YX1A 1M6XC 2DHMA 1XRAA 2MM9A 3A9UA 4IR7A 4X66C 4B3RC 2PG1E 4R1LA 3LAXA 4PROC 1USPA 1FUGA 3A26A 4WV3A 4ISBA 1HR0C 2PN2A 3I08A 4MH4A 4LE5A 1NYEA 4PZPA 5A1IA 4BC9A 2P2JA 4JI0C 3J80D 4X64C 1XHJA 2Y4NA 3T1YC 2E8EA 4ZLPA 2QL8A 4RM2A 3FCCA 3CQ3A 3TUFA 4BSZA 5BUSA 2E5LC 3NI2A 4DR1C 2D7VA 2M5HA 4RLQA 3ETCA 2MMAB 2QVYX 2DYJA 2D28C 1WCJA 2UXCC 2KZ0A 5LMUC 4BCAA 4DV1C 1XNRC 5A2QD 5H9UA 3UX2A 5BSWA 2D1QA 3H2TA 3O2EA 1N33C 1VLAA 3CJEA 1MXBA 2HJGA 5BR8C 4YHHC 3TQIA 1V26A 4KTVA 3ETOA 4GKKC 1HNZC 1L2FA 4KTTA 1WH9A 3L8CA 1K0RA 4DR3C 4L2ZA 3E7XA 4GXRA 4JI2C 4LFBC 1O9TA 5BURA 3J7AD 2NCLA 1QWIA 3UZ0A 3GPCA 4DV4C 5A1GA 3A25A 2QVXX 3TR3A 4JM1A 2UU9C 3NYRA 4IZ6A 2UUAC 3UOWA 1EGAA 2WD9A 2P2QA 4DR2C 5CZVA 1XDXA 4JI7C 5KYVA 3IEUA 5AE3A 3GR1A 2P2MA 3PBKA 2HHHC 4I9FA 1VEHA 4G1IA 3K6RA 4GKJC 1HNWC 2MCQA 4RLFA 2F4VC 4FUQA 3CQ2A 4DV2C 2UUCC 2YWCA 5AE1A 4OX9C 3OTOC 2WP0C 5IWAC 2VZEA 3VNRA 4PUIA 1BA3A 3A4IA 2V7BA 1KKGA 3LGXA 1AMUA 2AYAA 2P2FA 3IMLA 4B3MC 1MD9A 2JMPA 3S82A 3NYQA 1ZB9A 4WS9A 2D1RA 2VQEC 2KDNA 1O90A 1USPB 3KXWA 4D4GA 4LF4C 1MXAA 3I07A 2E8FA 1MDFA 4MTNA 1IBLC 4B3TC 5IT9D 3IPLA 1O93A 2OPLA 4L4QA 4BC7A 1FLOA 1LQLA 1XRBA 3LUSA 2Y4OA 2E7GA 4NXMC 1IBKC 1PA4A 2P2BA 2E8CA 2OBVA 4KHPC 4FUTA 5T8SA 5DV9A 1MDBA 5BSMA 4DR4C 2D1SA 4U5YD 3GR0A 3PESA 5E7QA 3J81D 4BBYA 3RV2A 4DR7C 4DV5C 3LNVA 2Z51A 1XRCA 3R9WA 4DCVA 5BUQA 2D1TA 3A9VA 4R0MA 2XR1A 3CW8X 1FJGC 2CXCA 3R9XA 3CQ1A 3EERA 3GKUA 4DV3C 4PUGA 5AE2A 4K0KC 2KZFA 3DLPX 2YCBA 1V25A 4X65C 3DHVA 1T5HX 4DR6C 2D27A 2ATWA 2CU6A 4PUHA 4LF6C 4PHTA 1PG3A 1IB8A 1N32C 2M5OA 3VNSA 2OO4A 2ONFA 3C5EA 4D4IA 4XX2A 4JI5C 2P20A 2UXDC 4D57A 5BSUA 4EATA 4D56A 3UEBA 4FTFA 3FM7A 1PG4A 1I94C 4I9GA 4DUZC 5ADZA 1NY8A 1UKKA 1N36C 5JRHA 1YJ7A 4JV5C 4DR5C 3AF5A 4NXNC 2P02A 4G37A 4LF9C 4JYAC 4DUYC 2BH1X 3CW9A 3VNQA 5KEIA 3G7SA 1P7LA 3B7WA 4DCUA 3PROC 3N54B 3TDEA 4TPSB 1XNQC 5IFIA 2VSQA 4RVOA 4JI4C 2ASBA 4LF7C 5LMNC 4DCTA 2ZTBA 4DV7C 1P4EA 3NPDA 1RY2A 2ZM6C 4NOZA 3FCEA 4JI1C 4LFCC 5KYTA 5BSRA 4R1MA 1JOSA 4HPVA 2OPLB 3IEVA 1UWDA 5LCIA 2PT7G 1ULTA 4ODJA 2UXBC 4X62C 4RM3A 1XMQC 4YY3C 4OYCA 5A19A 4NDNA 2ZZNA 2QW0X 3EQ6A 2QVZX 1RG9A 5CZXA 4JI6C 4L7IA 1IBMC 3R44A 2PROA 1GPMA 4LF5C 4B3SC 4DG8A 2DPLA 4DCSA 5GTDA 5BSVA 4ZJZA 1TH5A 1P4EC 4DG9A 3JAMD 2ZZMA 1XMOC 5T8TA
chains in the Genus database with same CATH topology
2VQFC 4LFAC 2YWBA 1MKYA 3SO4A 4JI8C 1T5DX 4GS5A 3N2QA 4GXQA 4DV6C 2CY1A 2EGTA 5BSTA 5K85A 3T1HC 2E0GA 4OXIA 1MXCA 1LCIA 3L95X 4DV0C 4G36A 1N2FA 4RVNA 4K0BA 1J5EC 4AQYC 1ML8A 2UUBC 2Y27A 5FLXD 4JI3C 1HNXC 1HH2P 1ZB8A 3RG2A 4RMNA 4LF8C 1WF3A 3E7WA 3DAYA 1QM4A 1O92A 2BJOA 1N34C 3AF6A 5K8FA 1XRAA 3A9UA 4IR7A 4X66C 4B3RC 4R1LA 3LAXA 4PROC 1USPA 1FUGA 4WV3A 4ISBA 1HR0C 2PN2A 3I08A 4MH4A 4LE5A 1NYEA 4PZPA 5A1IA 4BC9A 2P2JA 4JI0C 3J80D 4X64C 2Y4NA 3T1YC 2E8EA 4ZLPA 2QL8A 4RM2A 3FCCA 3TUFA 4BSZA 5BUSA 2E5LC 3NI2A 4DR1C 2D7VA 4RLQA 3ETCA 2QVYX 2DYJA 2D28C 2UXCC 5LMUC 4BCAA 4DV1C 1XNRC 5A2QD 5H9UA 5BSWA 2D1QA 3H2TA 1N33C 1VLAA 3CJEA 1MXBA 2HJGA 5BR8C 4YHHC 3TQIA 1V26A 4KTVA 3ETOA 4GKKC 1HNZC 1L2FA 4KTTA 1WH9A 3L8CA 1K0RA 4DR3C 4L2ZA 3E7XA 4GXRA 4JI2C 4LFBC 1O9TA 5BURA 3J7AD 1QWIA 3UZ0A 3GPCA 4DV4C 5A1GA 2QVXX 4JM1A 2UU9C 3NYRA 4IZ6A 2UUAC 3UOWA 1EGAA 2WD9A 2P2QA 4DR2C 5CZVA 4JI7C 5KYVA 3IEUA 5AE3A 3GR1A 2P2MA 3PBKA 2HHHC 4I9FA 4G1IA 4GKJC 1HNWC 4RLFA 2F4VC 4FUQA 4DV2C 2UUCC 2YWCA 5AE1A 4OX9C 3OTOC 2WP0C 5IWAC 2VZEA 3VNRA 1BA3A 3A4IA 2V7BA 1KKGA 3LGXA 1AMUA 2AYAA 2P2FA 3IMLA 4B3MC 1MD9A 2JMPA 3S82A 3NYQA 1ZB9A 4WS9A 2D1RA 2VQEC 1O90A 1USPB 3KXWA 4D4GA 4LF4C 1MXAA 3I07A 2E8FA 1MDFA 4MTNA 1IBLC 4B3TC 5IT9D 3IPLA 1O93A 2OPLA 4L4QA 4BC7A 1LQLA 1XRBA 3LUSA 2Y4OA 2E7GA 4NXMC 1IBKC 1PA4A 2P2BA 2E8CA 2OBVA 4KHPC 4FUTA 5T8SA 5DV9A 1MDBA 5BSMA 4DR4C 2D1SA 4U5YD 3GR0A 3PESA 5E7QA 3J81D 4BBYA 3RV2A 4DR7C 4DV5C 3LNVA 1XRCA 3R9WA 4DCVA 5BUQA 2D1TA 3A9VA 4R0MA 2XR1A 3CW8X 1FJGC 2CXCA 3R9XA 3EERA 3GKUA 4DV3C 5AE2A 4K0KC 2KZFA 3DLPX 2YCBA 1V25A 4X65C 3DHVA 1T5HX 4DR6C 2D27A 2ATWA 4LF6C 4PHTA 1PG3A 1N32C 3VNSA 2OO4A 2ONFA 3C5EA 4D4IA 4XX2A 4JI5C 2P20A 2UXDC 4D57A 5BSUA 4EATA 4D56A 4FTFA 1PG4A 1I94C 4I9GA 4DUZC 5ADZA 1UKKA 1N36C 5JRHA 1YJ7A 4JV5C 4DR5C 3AF5A 4NXNC 2P02A 4G37A 4LF9C 4JYAC 4DUYC 2BH1X 3CW9A 3VNQA 5KEIA 3G7SA 1P7LA 3B7WA 4DCUA 3PROC 3N54B 3TDEA 4TPSB 1XNQC 5IFIA 2VSQA 4RVOA 4JI4C 2ASBA 4LF7C 5LMNC 4DCTA 4DV7C 3NPDA 1RY2A 2ZM6C 4NOZA 3FCEA 4JI1C 4LFCC 5KYTA 5BSRA 4R1MA 1JOSA 4HPVA 2OPLB 3IEVA 2PT7G 1ULTA 4ODJA 2UXBC 4X62C 4RM3A 1XMQC 4YY3C 4OYCA 5A19A 4NDNA 2QW0X 3EQ6A 2QVZX 1RG9A 5CZXA 4JI6C 4L7IA 1IBMC 3R44A 2PROA 1GPMA 4LF5C 4B3SC 4DG8A 2DPLA 4DCSA 5GTDA 5BSVA 4ZJZA 4DG9A 3JAMD 1XMOC 5T8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XX2 A;  2VQF C;  4BSZ A;  4LFA C;  4JI5 C;  2UXD C;  1MKY A;  2E5L C;  4DR1 C;  4B3M C;  4JI8 C;  2D7V A;  2JMP A;  1ZB9 A;  2DYJ A;  1I94 C;  2VQE C;  2UXC C;  4DUZ C;  4DV6 C;  2CY1 A;  2EGT A;  1USP B;  5LMU C;  4DV1 C;  4LF4 C;  1XNR C;  1UKK A;  1N36 C;  5A2Q D;  3I07 A;  4JV5 C;  3T1H C;  2E8F A;  4DR5 C;  3AF5 A;  4MTN A;  4NXN C;  1IBL C;  4B3T C;  1N33 C;  5IT9 D;  1VLA A;  3CJE A;  2HJG A;  5BR8 C;  4LF9 C;  4JYA C;  2OPL A;  4YHH C;  4DV0 C;  1LQL A;  4DUY C;  1N2F A;  1HNZ C;  1L2F A;  4GKK C;  1WH9 A;  3LUS A;  1J5E C;  2E7G A;  4NXM C;  1K0R A;  4DR3 C;  1IBK C;  1PA4 A;  4DCU A;  4AQY C;  2E8C A;  4KHP C;  4JI2 C;  4LFB C;  1ML8 A;  2UUB C;  4DR4 C;  3J7A D;  1QWI A;  5FLX D;  4DV4 C;  4JI3 C;  1HNX C;  1XNQ C;  1HH2 P;  1ZB8 A;  3J81 D;  2UU9 C;  4LF8 C;  1WF3 A;  4JI4 C;  2UUA C;  2ASB A;  4LF7 C;  1EGA A;  5LMN C;  4DCT A;  4DV7 C;  4DR7 C;  4DR2 C;  4DV5 C;  4JI7 C;  3IEU A;  2BJO A;  1N34 C;  3R9W A;  3AF6 A;  4DCV A;  2ZM6 C;  4NOZ A;  4JI1 C;  4LFC C;  2XR1 A;  2HHH C;  1JOS A;  4X66 C;  4B3R C;  2OPL B;  3IEV A;  2PT7 G;  1FJG C;  2CXC A;  3R9X A;  2UXB C;  3EER A;  4X62 C;  1USP A;  3GKU A;  4DV3 C;  1XMQ C;  4YY3 C;  4K0K C;  4GKJ C;  1HNW C;  2F4V C;  1HR0 C;  2PN2 A;  4DV2 C;  2KZF A;  4MH4 A;  2UUC C;  2YCB A;  4X65 C;  1NYE A;  4JI6 C;  4OX9 C;  3OTO C;  4DR6 C;  4JI0 C;  3J80 D;  4X64 C;  1IBM C;  5IWA C;  4LF5 C;  4B3S C;  2ATW A;  4LF6 C;  4DCS A;  1KKG A;  1N32 C;  3JAM D;  2E8E A;  3T1Y C;  1XMO C;  2QL8 A;  2ONF A; 
#chains in the Genus database with same CATH topology
 2VQF C;  4LFA C;  2YWB A;  1MKY A;  3SO4 A;  4JI8 C;  1T5D X;  4GS5 A;  3N2Q A;  4GXQ A;  1V60 A;  4DV6 C;  2CY1 A;  2EGT A;  5BST A;  5K85 A;  3T1H C;  2E0G A;  4OXI A;  1MXC A;  1M6X A;  1LCI A;  3L95 X;  4DV0 C;  4G36 A;  2JNV A;  1N2F A;  4RVN A;  1XS3 A;  4K0B A;  1J5E C;  3LNO A;  4AQY C;  1ML8 A;  2UUB C;  2Y27 A;  3AY0 A;  1PU1 A;  5FLX D;  4JI3 C;  1HNX C;  1HH2 P;  1ZB8 A;  3RG2 A;  4RMN A;  4LF8 C;  1YGT A;  1WF3 A;  3UX3 A;  3E7W A;  3DAY A;  1QM4 A;  1O92 A;  2BJO A;  1N34 C;  3AF6 A;  5K8F A;  2YX1 A;  1M6X C;  2DHM A;  1XRA A;  2MM9 A;  3A9U A;  4IR7 A;  4X66 C;  4B3R C;  2PG1 E;  4R1L A;  3LAX A;  4PRO C;  1USP A;  1FUG A;  3A26 A;  4WV3 A;  4ISB A;  1HR0 C;  2PN2 A;  3I08 A;  4MH4 A;  4LE5 A;  1NYE A;  4PZP A;  5A1I A;  4BC9 A;  2P2J A;  4JI0 C;  3J80 D;  4X64 C;  1XHJ A;  2Y4N A;  3T1Y C;  2E8E A;  4ZLP A;  2QL8 A;  4RM2 A;  3FCC A;  3CQ3 A;  3TUF A;  4BSZ A;  5BUS A;  2E5L C;  3NI2 A;  4DR1 C;  2D7V A;  2M5H A;  4RLQ A;  3ETC A;  2MMA B;  2QVY X;  2DYJ A;  2D28 C;  1WCJ A;  2UXC C;  2KZ0 A;  5LMU C;  4BCA A;  4DV1 C;  1XNR C;  5A2Q D;  5H9U A;  3UX2 A;  5BSW A;  2D1Q A;  3H2T A;  3O2E A;  1N33 C;  1VLA A;  3CJE A;  1MXB A;  2HJG A;  5BR8 C;  4YHH C;  3TQI A;  1V26 A;  4KTV A;  3ETO A;  4GKK C;  1HNZ C;  1L2F A;  4KTT A;  1WH9 A;  3L8C A;  1K0R A;  4DR3 C;  4L2Z A;  3E7X A;  4GXR A;  4JI2 C;  4LFB C;  1O9T A;  5BUR A;  3J7A D;  2NCL A;  1QWI A;  3UZ0 A;  3GPC A;  4DV4 C;  5A1G A;  3A25 A;  2QVX X;  3TR3 A;  4JM1 A;  2UU9 C;  3NYR A;  4IZ6 A;  2UUA C;  3UOW A;  1EGA A;  2WD9 A;  2P2Q A;  4DR2 C;  5CZV A;  1XDX A;  4JI7 C;  5KYV A;  3IEU A;  5AE3 A;  3GR1 A;  2P2M A;  3PBK A;  2HHH C;  4I9F A;  1VEH A;  4G1I A;  3K6R A;  4GKJ C;  1HNW C;  2MCQ A;  4RLF A;  2F4V C;  4FUQ A;  3CQ2 A;  4DV2 C;  2UUC C;  2YWC A;  5AE1 A;  4OX9 C;  3OTO C;  2WP0 C;  5IWA C;  2VZE A;  3VNR A;  4PUI A;  1BA3 A;  3A4I A;  2V7B A;  1KKG A;  3LGX A;  1AMU A;  2AYA A;  2P2F A;  3IML A;  4B3M C;  1MD9 A;  2JMP A;  3S82 A;  3NYQ A;  1ZB9 A;  4WS9 A;  2D1R A;  2VQE C;  2KDN A;  1O90 A;  1USP B;  3KXW A;  4D4G A;  4LF4 C;  1MXA A;  3I07 A;  2E8F A;  1MDF A;  4MTN A;  1IBL C;  4B3T C;  5IT9 D;  3IPL A;  1O93 A;  2OPL A;  4L4Q A;  4BC7 A;  1FLO A;  1LQL A;  1XRB A;  3LUS A;  2Y4O A;  2E7G A;  4NXM C;  1IBK C;  1PA4 A;  2P2B A;  2E8C A;  2OBV A;  4KHP C;  4FUT A;  5T8S A;  5DV9 A;  1MDB A;  5BSM A;  4DR4 C;  2D1S A;  4U5Y D;  3GR0 A;  3PES A;  5E7Q A;  3J81 D;  4BBY A;  3RV2 A;  4DR7 C;  4DV5 C;  3LNV A;  2Z51 A;  1XRC A;  3R9W A;  4DCV A;  5BUQ A;  2D1T A;  3A9V A;  4R0M A;  2XR1 A;  3CW8 X;  1FJG C;  2CXC A;  3R9X A;  3CQ1 A;  3EER A;  3GKU A;  4DV3 C;  4PUG A;  5AE2 A;  4K0K C;  2KZF A;  3DLP X;  2YCB A;  1V25 A;  4X65 C;  3DHV A;  1T5H X;  4DR6 C;  2D27 A;  2ATW A;  2CU6 A;  4PUH A;  4LF6 C;  4PHT A;  1PG3 A;  1IB8 A;  1N32 C;  2M5O A;  3VNS A;  2OO4 A;  2ONF A;  3C5E A;  4D4I A;  4XX2 A;  4JI5 C;  2P20 A;  2UXD C;  4D57 A;  5BSU A;  4EAT A;  4D56 A;  3UEB A;  4FTF A;  3FM7 A;  1PG4 A;  1I94 C;  4I9G A;  4DUZ C;  5ADZ A;  1NY8 A;  1UKK A;  1N36 C;  5JRH A;  1YJ7 A;  4JV5 C;  4DR5 C;  3AF5 A;  4NXN C;  2P02 A;  4G37 A;  4LF9 C;  4JYA C;  4DUY C;  2BH1 X;  3CW9 A;  3VNQ A;  5KEI A;  3G7S A;  1P7L A;  3B7W A;  4DCU A;  3PRO C;  3N54 B;  3TDE A;  4TPS B;  1XNQ C;  5IFI A;  2VSQ A;  4RVO A;  4JI4 C;  2ASB A;  4LF7 C;  5LMN C;  4DCT A;  2ZTB A;  4DV7 C;  1P4E A;  3NPD A;  1RY2 A;  2ZM6 C;  4NOZ A;  3FCE A;  4JI1 C;  4LFC C;  5KYT A;  5BSR A;  4R1M A;  1JOS A;  4HPV A;  2OPL B;  3IEV A;  1UWD A;  5LCI A;  2PT7 G;  1ULT A;  4ODJ A;  2UXB C;  4X62 C;  4RM3 A;  1XMQ C;  4YY3 C;  4OYC A;  5A19 A;  4NDN A;  2ZZN A;  2QW0 X;  3EQ6 A;  2QVZ X;  1RG9 A;  5CZX A;  4JI6 C;  4L7I A;  1IBM C;  3R44 A;  2PRO A;  1GPM A;  4LF5 C;  4B3S C;  4DG8 A;  2DPL A;  4DCS A;  5GTD A;  5BSV A;  4ZJZ A;  1TH5 A;  1P4E C;  4DG9 A;  3JAM D;  2ZZM A;  1XMO C;  5T8T A; 
#chains in the Genus database with same CATH homology
 2VQF C;  4LFA C;  2YWB A;  1MKY A;  3SO4 A;  4JI8 C;  1T5D X;  4GS5 A;  3N2Q A;  4GXQ A;  4DV6 C;  2CY1 A;  2EGT A;  5BST A;  5K85 A;  3T1H C;  2E0G A;  4OXI A;  1MXC A;  1LCI A;  3L95 X;  4DV0 C;  4G36 A;  1N2F A;  4RVN A;  4K0B A;  1J5E C;  4AQY C;  1ML8 A;  2UUB C;  2Y27 A;  5FLX D;  4JI3 C;  1HNX C;  1HH2 P;  1ZB8 A;  3RG2 A;  4RMN A;  4LF8 C;  1WF3 A;  3E7W A;  3DAY A;  1QM4 A;  1O92 A;  2BJO A;  1N34 C;  3AF6 A;  5K8F A;  1XRA A;  3A9U A;  4IR7 A;  4X66 C;  4B3R C;  4R1L A;  3LAX A;  4PRO C;  1USP A;  1FUG A;  4WV3 A;  4ISB A;  1HR0 C;  2PN2 A;  3I08 A;  4MH4 A;  4LE5 A;  1NYE A;  4PZP A;  5A1I A;  4BC9 A;  2P2J A;  4JI0 C;  3J80 D;  4X64 C;  2Y4N A;  3T1Y C;  2E8E A;  4ZLP A;  2QL8 A;  4RM2 A;  3FCC A;  3TUF A;  4BSZ A;  5BUS A;  2E5L C;  3NI2 A;  4DR1 C;  2D7V A;  4RLQ A;  3ETC A;  2QVY X;  2DYJ A;  2D28 C;  2UXC C;  5LMU C;  4BCA A;  4DV1 C;  1XNR C;  5A2Q D;  5H9U A;  5BSW A;  2D1Q A;  3H2T A;  1N33 C;  1VLA A;  3CJE A;  1MXB A;  2HJG A;  5BR8 C;  4YHH C;  3TQI A;  1V26 A;  4KTV A;  3ETO A;  4GKK C;  1HNZ C;  1L2F A;  4KTT A;  1WH9 A;  3L8C A;  1K0R A;  4DR3 C;  4L2Z A;  3E7X A;  4GXR A;  4JI2 C;  4LFB C;  1O9T A;  5BUR A;  3J7A D;  1QWI A;  3UZ0 A;  3GPC A;  4DV4 C;  5A1G A;  2QVX X;  4JM1 A;  2UU9 C;  3NYR A;  4IZ6 A;  2UUA C;  3UOW A;  1EGA A;  2WD9 A;  2P2Q A;  4DR2 C;  5CZV A;  4JI7 C;  5KYV A;  3IEU A;  5AE3 A;  3GR1 A;  2P2M A;  3PBK A;  2HHH C;  4I9F A;  4G1I A;  4GKJ C;  1HNW C;  4RLF A;  2F4V C;  4FUQ A;  4DV2 C;  2UUC C;  2YWC A;  5AE1 A;  4OX9 C;  3OTO C;  2WP0 C;  5IWA C;  2VZE A;  3VNR A;  1BA3 A;  3A4I A;  2V7B A;  1KKG A;  3LGX A;  1AMU A;  2AYA A;  2P2F A;  3IML A;  4B3M C;  1MD9 A;  2JMP A;  3S82 A;  3NYQ A;  1ZB9 A;  4WS9 A;  2D1R A;  2VQE C;  1O90 A;  1USP B;  3KXW A;  4D4G A;  4LF4 C;  1MXA A;  3I07 A;  2E8F A;  1MDF A;  4MTN A;  1IBL C;  4B3T C;  5IT9 D;  3IPL A;  1O93 A;  2OPL A;  4L4Q A;  4BC7 A;  1LQL A;  1XRB A;  3LUS A;  2Y4O A;  2E7G A;  4NXM C;  1IBK C;  1PA4 A;  2P2B A;  2E8C A;  2OBV A;  4KHP C;  4FUT A;  5T8S A;  5DV9 A;  1MDB A;  5BSM A;  4DR4 C;  2D1S A;  4U5Y D;  3GR0 A;  3PES A;  5E7Q A;  3J81 D;  4BBY A;  3RV2 A;  4DR7 C;  4DV5 C;  3LNV A;  1XRC A;  3R9W A;  4DCV A;  5BUQ A;  2D1T A;  3A9V A;  4R0M A;  2XR1 A;  3CW8 X;  1FJG C;  2CXC A;  3R9X A;  3EER A;  3GKU A;  4DV3 C;  5AE2 A;  4K0K C;  2KZF A;  3DLP X;  2YCB A;  1V25 A;  4X65 C;  3DHV A;  1T5H X;  4DR6 C;  2D27 A;  2ATW A;  4LF6 C;  4PHT A;  1PG3 A;  1N32 C;  3VNS A;  2OO4 A;  2ONF A;  3C5E A;  4D4I A;  4XX2 A;  4JI5 C;  2P20 A;  2UXD C;  4D57 A;  5BSU A;  4EAT A;  4D56 A;  4FTF A;  1PG4 A;  1I94 C;  4I9G A;  4DUZ C;  5ADZ A;  1UKK A;  1N36 C;  5JRH A;  1YJ7 A;  4JV5 C;  4DR5 C;  3AF5 A;  4NXN C;  2P02 A;  4G37 A;  4LF9 C;  4JYA C;  4DUY C;  2BH1 X;  3CW9 A;  3VNQ A;  5KEI A;  3G7S A;  1P7L A;  3B7W A;  4DCU A;  3PRO C;  3N54 B;  3TDE A;  4TPS B;  1XNQ C;  5IFI A;  2VSQ A;  4RVO A;  4JI4 C;  2ASB A;  4LF7 C;  5LMN C;  4DCT A;  4DV7 C;  3NPD A;  1RY2 A;  2ZM6 C;  4NOZ A;  3FCE A;  4JI1 C;  4LFC C;  5KYT A;  5BSR A;  4R1M A;  1JOS A;  4HPV A;  2OPL B;  3IEV A;  2PT7 G;  1ULT A;  4ODJ A;  2UXB C;  4X62 C;  4RM3 A;  1XMQ C;  4YY3 C;  4OYC A;  5A19 A;  4NDN A;  2QW0 X;  3EQ6 A;  2QVZ X;  1RG9 A;  5CZX A;  4JI6 C;  4L7I A;  1IBM C;  3R44 A;  2PRO A;  1GPM A;  4LF5 C;  4B3S C;  4DG8 A;  2DPL A;  4DCS A;  5GTD A;  5BSV A;  4ZJZ A;  4DG9 A;  3JAM D;  1XMO C;  5T8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...