5LMUC

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5lmuC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5lmuC02
3J80D 1N36C 4AQYC 2JMPA 4YY3C 2YCBA 2PT7G 4DCUA 2HHHC 4LFCC 1N32C 4LF4C 4NXMC 4X65C 4B3SC 1XMOC 4JI6C 2OPLB 4DR3C 4LFAC 1IBLC 4DV3C 2UXDC 4LF6C 4DR7C 1LQLA 2ZM6C 4DV6C 1FJGC 4JI4C 2ONFA 1J5EC 4OX9C 4JI1C 1WH9A 1ZB9A 2QL8A 2UXBC 1VLAA 4DV0C 4JI3C 2CXCA 3JAMD 2XR1A 4JYAC 4DR6C 3R9XA 1IBMC 4LF8C 1WF3A 2PN2A 3R9WA 2CY1A 1QWIA 2EGTA 1L2FA 1USPA 2E8CA 4MH4A 2VQFC 4JI8C 4LF5C 4X66C 1HR0C 2BJOA 2HJGA 2E8FA 1HNXC 1UKKA 3AF6A 5LMNC 1HNWC 5IT9D 4LF9C 1HNZC 4X62C 1N33C 1HH2P 3EERA 5LMUC 4XX2A 4KHPC 4DR5C 2UUBC 2OPLA 4B3MC 4DV5C 4JI7C 2E7GA 1MKYA 1N2FA 1NYEA 3AF5A 2ASBA 5BR8C 4DUZC 1N34C 4LFBC 1XMQC 4K0KC 4DV4C 2UUAC 1K0RA 4JI5C 4DR4C 5FLXD 3T1HC 2D7VA 4DV2C 3I07A 4BSZA 3LUSA 2E5LC 2UUCC 4X64C 2VQEC 4DUYC 4NOZA 3CJEA 1ZB8A 2UXCC 1IBKC 3J7AD 2ATWA 1XNQC 3J81D 4LF7C 5A2QD 2UU9C 2DYJA 4DCVA 2E8EA 1USPB 4DR1C 4B3RC 4JV5C 3OTOC 4NXNC 3IEUA 4DV1C 4GKKC 2KZFA 4YHHC 4MTNA 4B3TC 1KKGA 1EGAA 1ML8A 4DCTA 1XNRC 2F4VC 4DCSA 3GKUA 5IWAC 3IEVA 4GKJC 4DR2C 4JI0C 3T1YC 4JI2C 1I94C 1JOSA 4DV7C 1PA4A
chains in the Genus database with same CATH superfamily
3J80D 1LCIA 3CQ3A 4BBYA 3IPLA 1MXAA 4WS9A 4LFCC 4PZPA 3ETCA 4G36A 4D4IA 1N32C 5BSWA 4JI6C 4LFAC 2ZM6C 3LNOA 4DV6C 4PROC 5A1IA 2QW0X 3UX3A 4ODJA 2NCLA 2QL8A 1VLAA 4WV3A 4JI3C 4R1LA 4RVNA 2VZEA 4DR6C 3R9XA 1IBMC 2Y4NA 1WF3A 2P02A 5BSTA 4FUQA 1QWIA 5GTDA 2E8CA 4JI8C 4I9GA 1MDBA 4PUHA 5ADZA 4X62C 3VNSA 5LMUC 2OO4A 2PG1E 3GPCA 5BURA 4XX2A 3S82A 3E7WA 2D1RA 2OPLA 4JI7C 3UEBA 2D1QA 2P2FA 3PBKA 4DUZC 4GXRA 5BUQA 4K0KC 4NDNA 1K0RA 4DR4C 5FLXD 4DG8A 1GPMA 3I07A 3IMLA 4GXQA 4BSZA 1QM4A 2MCQA 3KXWA 1YJ7A 1O92A 2YWBA 3J81D 4LF7C 1PG4A 4JV5C 3OTOC 4BCAA 1P7LA 2ZTBA 4GKKC 2KZFA 3UX2A 3RG2A 4DR2C 4KTVA 1I94C 1N36C 5T8TA 1RG9A 3EQ6A 4DR3C 3DLPX 2UXDC 1LQLA 3CW8X 3VNRA 1FJGC 5KEIA 1J5EC 3PESA 1ZB9A 4L7IA 3LGXA 2UXBC 5BSVA 2BH1X 1MDFA 5A19A 3N54B 4OYCA 3JAMD 4L2ZA 4FUTA 4GS5A 3UOWA 4D4GA 2OBVA 3PROC 2CY1A 1WCJA 1VEHA 4IZ6A 1MXCA 4LF5C 3B7WA 2BJOA 1NY8A 1XRBA 1HNXC 3G7SA 1UKKA 4LF9C 1XS3A 1P4EC 4TPSB 1N33C 1XRCA 4PUGA 3E7XA 4DR5C 2UUBC 4B3MC 4DV5C 1PU1A 1MKYA 3DHVA 5H9UA 3FCCA 1XHJA 1N2FA 3AF5A 5BR8C 1YGTA 2P2QA 2P2MA 2YX1A 4U5YD 3LUSA 2UUCC 3TR3A 4X64C 1PG3A 2CU6A 4DUYC 3CJEA 4BC9A 1ULTA 2UXCC 3J7AD 3L8CA 5KYTA 2ATWA 1XNQC 4JM1A 5A2QD 5JRHA 2DYJA 2E8EA 4B3RC 3A4IA 4NXNC 2VSQA 4YHHC 5AE1A 1KKGA 3TUFA 4DCTA 1O90A 1V26A 4DCSA 5IWAC 3IEVA 3CW9A 5E7QA 4RLFA 4AQYC 2JMPA 3C5EA 3A26A 2HHHC 2WD9A 4X65C 5IFIA 4LF6C 4DR7C 2Y27A 3RV2A 3VNQA 2YWCA 4RM2A 4JI4C 2ONFA 3A9VA 4OX9C 4K0BA 4IR7A 3CQ2A 1WH9A 4R1MA 3LAXA 4HPVA 3A9UA 2CXCA 2P20A 3SO4A 3O2EA 4JYAC 1XRAA 2QVYX 4LE5A 4LF8C 4DG9A 3NYQA 3R9WA 2EGTA 3GR1A 3NYRA 4X66C 2WP0C 2HJGA 1M6XC 3R44A 3TDEA 1M6XA 2E8FA 4D57A 3AF6A 1BA3A 4RLQA 3EERA 5CZVA 3A25A 4KHPC 4D56A 1AMUA 2E7GA 5K85A 2MMAB 4OXIA 1NYEA 2ASBA 4LFBC 1XMQC 4DV4C 2UUAC 1O9TA 4JI5C 1XDXA 3T1HC 4DV2C 2ZZMA 4RVOA 2E5LC 4R0MA 2D27A 2VQEC 3GR0A 3TQIA 4PHTA 5AE2A 2Y4OA 5KYVA 1IBKC 2DHMA 4EATA 2UU9C 1USPB 4DV1C 1T5HX 4B3TC 2F4VC 1MXBA 3L95X 2D28C 4JI0C 3T1YC 4ZLPA 4JI2C 4L4QA 4G1IA 4DV7C 1FLOA 2E0GA 4YY3C 2YCBA 1O93A 2PT7G 4DCUA 2ZZNA 4LF4C 4NXMC 4RMNA 4B3SC 1XMOC 2OPLB 2Z51A 5BUSA 4BC7A 1UWDA 4ZJZA 4DV3C 1IBLC 2QVXX 5DV9A 3DAYA 3FCEA 4JI1C 5K8FA 4DV0C 3H2TA 2V7BA 5BSMA 4I9FA 2XR1A 2M5OA 3UZ0A 1V25A 2MM9A 2PN2A 2KZ0A 4KTTA 1L2FA 1USPA 3N2QA 2D1SA 4MH4A 2VQFC 1TH5A 2QVZX 4FTFA 1P4EA 1T5DX 1HR0C 1MD9A 5BSRA 5LMNC 1HNWC 5IT9D 2D1TA 5A1GA 1HNZC 4RM3A 1RY2A 1IB8A 1HH2P 3NPDA 5LCIA 3NI2A 3FM7A 2DPLA 2AYAA 1N34C 3CQ1A 2PROA 3K6RA 5CZXA 2D7VA 3LNVA 1V60A 3I08A 2P2BA 4G37A 4NOZA 1ZB8A 2KDNA 2JNVA 4PUIA 3AY0A 4DCVA 4ISBA 4DR1C 5AE3A 3IEUA 2P2JA 2M5HA 4MTNA 1EGAA 1ML8A 5T8SA 1XNRC 3ETOA 1FUGA 3GKUA 4GKJC 1JOSA 5BSUA 1PA4A
chains in the Genus database with same CATH topology
3J80D 1LCIA 4BBYA 3IPLA 1MXAA 4WS9A 4LFCC 4PZPA 3ETCA 4G36A 4D4IA 1N32C 5BSWA 4JI6C 4LFAC 2ZM6C 4DV6C 4PROC 5A1IA 2QW0X 4ODJA 2QL8A 1VLAA 4WV3A 4JI3C 4R1LA 4RVNA 2VZEA 4DR6C 3R9XA 1IBMC 2Y4NA 1WF3A 2P02A 5BSTA 4FUQA 1QWIA 5GTDA 2E8CA 4JI8C 4I9GA 1MDBA 5ADZA 4X62C 3VNSA 5LMUC 2OO4A 3GPCA 5BURA 4XX2A 3S82A 3E7WA 2D1RA 2OPLA 4JI7C 2D1QA 2P2FA 3PBKA 4DUZC 4GXRA 5BUQA 4K0KC 4NDNA 1K0RA 4DR4C 5FLXD 4DG8A 1GPMA 3I07A 3IMLA 4GXQA 4BSZA 1QM4A 3KXWA 1YJ7A 1O92A 2YWBA 3J81D 4LF7C 1PG4A 4JV5C 3OTOC 4BCAA 1P7LA 4GKKC 2KZFA 3RG2A 4DR2C 4KTVA 1I94C 1N36C 5T8TA 1RG9A 3EQ6A 4DR3C 3DLPX 2UXDC 1LQLA 3CW8X 3VNRA 1FJGC 5KEIA 1J5EC 3PESA 1ZB9A 4L7IA 3LGXA 2UXBC 5BSVA 2BH1X 1MDFA 5A19A 3N54B 4OYCA 3JAMD 4L2ZA 4FUTA 4GS5A 3UOWA 4D4GA 2OBVA 3PROC 2CY1A 4IZ6A 1MXCA 4LF5C 3B7WA 2BJOA 1XRBA 1HNXC 3G7SA 1UKKA 4LF9C 4TPSB 1N33C 1XRCA 3E7XA 4DR5C 2UUBC 4B3MC 4DV5C 1MKYA 3DHVA 5H9UA 3FCCA 1N2FA 3AF5A 5BR8C 2P2QA 2P2MA 4U5YD 3LUSA 2UUCC 4X64C 1PG3A 4DUYC 3CJEA 4BC9A 1ULTA 2UXCC 3J7AD 3L8CA 5KYTA 2ATWA 1XNQC 4JM1A 5A2QD 5JRHA 2DYJA 2E8EA 4B3RC 3A4IA 4NXNC 2VSQA 4YHHC 5AE1A 1KKGA 3TUFA 4DCTA 1O90A 1V26A 4DCSA 5IWAC 3IEVA 3CW9A 5E7QA 4RLFA 4AQYC 2JMPA 3C5EA 2HHHC 2WD9A 4X65C 5IFIA 4LF6C 4DR7C 2Y27A 3RV2A 3VNQA 2YWCA 4RM2A 4JI4C 2ONFA 3A9VA 4OX9C 4K0BA 4IR7A 1WH9A 4R1MA 3LAXA 4HPVA 3A9UA 2CXCA 2P20A 3SO4A 4JYAC 1XRAA 2QVYX 4LE5A 4LF8C 4DG9A 3NYQA 3R9WA 2EGTA 3GR1A 3NYRA 4X66C 2WP0C 2HJGA 3R44A 3TDEA 2E8FA 4D57A 3AF6A 1BA3A 4RLQA 3EERA 5CZVA 4KHPC 4D56A 1AMUA 2E7GA 5K85A 4OXIA 1NYEA 2ASBA 4LFBC 1XMQC 4DV4C 2UUAC 1O9TA 4JI5C 3T1HC 4DV2C 4RVOA 2E5LC 4R0MA 2D27A 2VQEC 3GR0A 3TQIA 4PHTA 5AE2A 2Y4OA 5KYVA 1IBKC 4EATA 2UU9C 1USPB 4DV1C 1T5HX 4B3TC 2F4VC 1MXBA 3L95X 2D28C 4JI0C 3T1YC 4ZLPA 4JI2C 4L4QA 4G1IA 4DV7C 2E0GA 4YY3C 2YCBA 1O93A 2PT7G 4DCUA 4LF4C 4NXMC 4RMNA 4B3SC 1XMOC 2OPLB 5BUSA 4BC7A 4ZJZA 4DV3C 1IBLC 2QVXX 5DV9A 3DAYA 3FCEA 4JI1C 5K8FA 4DV0C 3H2TA 2V7BA 5BSMA 4I9FA 2XR1A 3UZ0A 1V25A 2PN2A 4KTTA 1L2FA 1USPA 3N2QA 2D1SA 4MH4A 2VQFC 2QVZX 4FTFA 1T5DX 1HR0C 1MD9A 5BSRA 5LMNC 1HNWC 5IT9D 2D1TA 5A1GA 1HNZC 4RM3A 1RY2A 1HH2P 3NPDA 3NI2A 2DPLA 2AYAA 1N34C 2PROA 5CZXA 2D7VA 3LNVA 3I08A 2P2BA 4G37A 4NOZA 1ZB8A 4DCVA 4ISBA 4DR1C 5AE3A 3IEUA 2P2JA 4MTNA 1EGAA 1ML8A 5T8SA 1XNRC 3ETOA 1FUGA 3GKUA 4GKJC 1JOSA 5BSUA 1PA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 D;  1N36 C;  4AQY C;  2JMP A;  4YY3 C;  2YCB A;  2PT7 G;  4DCU A;  2HHH C;  4LFC C;  1N32 C;  4LF4 C;  4NXM C;  4X65 C;  4B3S C;  1XMO C;  4JI6 C;  2OPL B;  4DR3 C;  4LFA C;  1IBL C;  4DV3 C;  2UXD C;  4LF6 C;  4DR7 C;  1LQL A;  2ZM6 C;  4DV6 C;  1FJG C;  4JI4 C;  2ONF A;  1J5E C;  4OX9 C;  4JI1 C;  1WH9 A;  1ZB9 A;  2QL8 A;  2UXB C;  1VLA A;  4DV0 C;  4JI3 C;  2CXC A;  3JAM D;  2XR1 A;  4JYA C;  4DR6 C;  3R9X A;  1IBM C;  4LF8 C;  1WF3 A;  2PN2 A;  3R9W A;  2CY1 A;  1QWI A;  2EGT A;  1L2F A;  1USP A;  2E8C A;  4MH4 A;  2VQF C;  4JI8 C;  4LF5 C;  4X66 C;  1HR0 C;  2BJO A;  2HJG A;  2E8F A;  1HNX C;  1UKK A;  3AF6 A;  5LMN C;  1HNW C;  5IT9 D;  4LF9 C;  1HNZ C;  4X62 C;  1N33 C;  1HH2 P;  3EER A;  5LMU C;  4XX2 A;  4KHP C;  4DR5 C;  2UUB C;  2OPL A;  4B3M C;  4DV5 C;  4JI7 C;  2E7G A;  1MKY A;  1N2F A;  1NYE A;  3AF5 A;  2ASB A;  5BR8 C;  4DUZ C;  1N34 C;  4LFB C;  1XMQ C;  4K0K C;  4DV4 C;  2UUA C;  1K0R A;  4JI5 C;  4DR4 C;  5FLX D;  3T1H C;  2D7V A;  4DV2 C;  3I07 A;  4BSZ A;  3LUS A;  2E5L C;  2UUC C;  4X64 C;  2VQE C;  4DUY C;  4NOZ A;  3CJE A;  1ZB8 A;  2UXC C;  1IBK C;  3J7A D;  2ATW A;  1XNQ C;  3J81 D;  4LF7 C;  5A2Q D;  2UU9 C;  2DYJ A;  4DCV A;  2E8E A;  1USP B;  4DR1 C;  4B3R C;  4JV5 C;  3OTO C;  4NXN C;  3IEU A;  4DV1 C;  4GKK C;  2KZF A;  4YHH C;  4MTN A;  4B3T C;  1KKG A;  1EGA A;  1ML8 A;  4DCT A;  1XNR C;  2F4V C;  4DCS A;  3GKU A;  5IWA C;  3IEV A;  4GKJ C;  4DR2 C;  4JI0 C;  3T1Y C;  4JI2 C;  1I94 C;  1JOS A;  4DV7 C;  1PA4 A; 
#chains in the Genus database with same CATH topology
 3J80 D;  1LCI A;  3CQ3 A;  4BBY A;  3IPL A;  1MXA A;  4WS9 A;  4LFC C;  4PZP A;  3ETC A;  4G36 A;  4D4I A;  1N32 C;  5BSW A;  4JI6 C;  4LFA C;  2ZM6 C;  3LNO A;  4DV6 C;  4PRO C;  5A1I A;  2QW0 X;  3UX3 A;  4ODJ A;  2NCL A;  2QL8 A;  1VLA A;  4WV3 A;  4JI3 C;  4R1L A;  4RVN A;  2VZE A;  4DR6 C;  3R9X A;  1IBM C;  2Y4N A;  1WF3 A;  2P02 A;  5BST A;  4FUQ A;  1QWI A;  5GTD A;  2E8C A;  4JI8 C;  4I9G A;  1MDB A;  4PUH A;  5ADZ A;  4X62 C;  3VNS A;  5LMU C;  2OO4 A;  2PG1 E;  3GPC A;  5BUR A;  4XX2 A;  3S82 A;  3E7W A;  2D1R A;  2OPL A;  4JI7 C;  3UEB A;  2D1Q A;  2P2F A;  3PBK A;  4DUZ C;  4GXR A;  5BUQ A;  4K0K C;  4NDN A;  1K0R A;  4DR4 C;  5FLX D;  4DG8 A;  1GPM A;  3I07 A;  3IML A;  4GXQ A;  4BSZ A;  1QM4 A;  2MCQ A;  3KXW A;  1YJ7 A;  1O92 A;  2YWB A;  3J81 D;  4LF7 C;  1PG4 A;  4JV5 C;  3OTO C;  4BCA A;  1P7L A;  2ZTB A;  4GKK C;  2KZF A;  3UX2 A;  3RG2 A;  4DR2 C;  4KTV A;  1I94 C;  1N36 C;  5T8T A;  1RG9 A;  3EQ6 A;  4DR3 C;  3DLP X;  2UXD C;  1LQL A;  3CW8 X;  3VNR A;  1FJG C;  5KEI A;  1J5E C;  3PES A;  1ZB9 A;  4L7I A;  3LGX A;  2UXB C;  5BSV A;  2BH1 X;  1MDF A;  5A19 A;  3N54 B;  4OYC A;  3JAM D;  4L2Z A;  4FUT A;  4GS5 A;  3UOW A;  4D4G A;  2OBV A;  3PRO C;  2CY1 A;  1WCJ A;  1VEH A;  4IZ6 A;  1MXC A;  4LF5 C;  3B7W A;  2BJO A;  1NY8 A;  1XRB A;  1HNX C;  3G7S A;  1UKK A;  4LF9 C;  1XS3 A;  1P4E C;  4TPS B;  1N33 C;  1XRC A;  4PUG A;  3E7X A;  4DR5 C;  2UUB C;  4B3M C;  4DV5 C;  1PU1 A;  1MKY A;  3DHV A;  5H9U A;  3FCC A;  1XHJ A;  1N2F A;  3AF5 A;  5BR8 C;  1YGT A;  2P2Q A;  2P2M A;  2YX1 A;  4U5Y D;  3LUS A;  2UUC C;  3TR3 A;  4X64 C;  1PG3 A;  2CU6 A;  4DUY C;  3CJE A;  4BC9 A;  1ULT A;  2UXC C;  3J7A D;  3L8C A;  5KYT A;  2ATW A;  1XNQ C;  4JM1 A;  5A2Q D;  5JRH A;  2DYJ A;  2E8E A;  4B3R C;  3A4I A;  4NXN C;  2VSQ A;  4YHH C;  5AE1 A;  1KKG A;  3TUF A;  4DCT A;  1O90 A;  1V26 A;  4DCS A;  5IWA C;  3IEV A;  3CW9 A;  5E7Q A;  4RLF A;  4AQY C;  2JMP A;  3C5E A;  3A26 A;  2HHH C;  2WD9 A;  4X65 C;  5IFI A;  4LF6 C;  4DR7 C;  2Y27 A;  3RV2 A;  3VNQ A;  2YWC A;  4RM2 A;  4JI4 C;  2ONF A;  3A9V A;  4OX9 C;  4K0B A;  4IR7 A;  3CQ2 A;  1WH9 A;  4R1M A;  3LAX A;  4HPV A;  3A9U A;  2CXC A;  2P20 A;  3SO4 A;  3O2E A;  4JYA C;  1XRA A;  2QVY X;  4LE5 A;  4LF8 C;  4DG9 A;  3NYQ A;  3R9W A;  2EGT A;  3GR1 A;  3NYR A;  4X66 C;  2WP0 C;  2HJG A;  1M6X C;  3R44 A;  3TDE A;  1M6X A;  2E8F A;  4D57 A;  3AF6 A;  1BA3 A;  4RLQ A;  3EER A;  5CZV A;  3A25 A;  4KHP C;  4D56 A;  1AMU A;  2E7G A;  5K85 A;  2MMA B;  4OXI A;  1NYE A;  2ASB A;  4LFB C;  1XMQ C;  4DV4 C;  2UUA C;  1O9T A;  4JI5 C;  1XDX A;  3T1H C;  4DV2 C;  2ZZM A;  4RVO A;  2E5L C;  4R0M A;  2D27 A;  2VQE C;  3GR0 A;  3TQI A;  4PHT A;  5AE2 A;  2Y4O A;  5KYV A;  1IBK C;  2DHM A;  4EAT A;  2UU9 C;  1USP B;  4DV1 C;  1T5H X;  4B3T C;  2F4V C;  1MXB A;  3L95 X;  2D28 C;  4JI0 C;  3T1Y C;  4ZLP A;  4JI2 C;  4L4Q A;  4G1I A;  4DV7 C;  1FLO A;  2E0G A;  4YY3 C;  2YCB A;  1O93 A;  2PT7 G;  4DCU A;  2ZZN A;  4LF4 C;  4NXM C;  4RMN A;  4B3S C;  1XMO C;  2OPL B;  2Z51 A;  5BUS A;  4BC7 A;  1UWD A;  4ZJZ A;  4DV3 C;  1IBL C;  2QVX X;  5DV9 A;  3DAY A;  3FCE A;  4JI1 C;  5K8F A;  4DV0 C;  3H2T A;  2V7B A;  5BSM A;  4I9F A;  2XR1 A;  2M5O A;  3UZ0 A;  1V25 A;  2MM9 A;  2PN2 A;  2KZ0 A;  4KTT A;  1L2F A;  1USP A;  3N2Q A;  2D1S A;  4MH4 A;  2VQF C;  1TH5 A;  2QVZ X;  4FTF A;  1P4E A;  1T5D X;  1HR0 C;  1MD9 A;  5BSR A;  5LMN C;  1HNW C;  5IT9 D;  2D1T A;  5A1G A;  1HNZ C;  4RM3 A;  1RY2 A;  1IB8 A;  1HH2 P;  3NPD A;  5LCI A;  3NI2 A;  3FM7 A;  2DPL A;  2AYA A;  1N34 C;  3CQ1 A;  2PRO A;  3K6R A;  5CZX A;  2D7V A;  3LNV A;  1V60 A;  3I08 A;  2P2B A;  4G37 A;  4NOZ A;  1ZB8 A;  2KDN A;  2JNV A;  4PUI A;  3AY0 A;  4DCV A;  4ISB A;  4DR1 C;  5AE3 A;  3IEU A;  2P2J A;  2M5H A;  4MTN A;  1EGA A;  1ML8 A;  5T8S A;  1XNR C;  3ETO A;  1FUG A;  3GKU A;  4GKJ C;  1JOS A;  5BSU A;  1PA4 A; 
#chains in the Genus database with same CATH homology
 3J80 D;  1LCI A;  4BBY A;  3IPL A;  1MXA A;  4WS9 A;  4LFC C;  4PZP A;  3ETC A;  4G36 A;  4D4I A;  1N32 C;  5BSW A;  4JI6 C;  4LFA C;  2ZM6 C;  4DV6 C;  4PRO C;  5A1I A;  2QW0 X;  4ODJ A;  2QL8 A;  1VLA A;  4WV3 A;  4JI3 C;  4R1L A;  4RVN A;  2VZE A;  4DR6 C;  3R9X A;  1IBM C;  2Y4N A;  1WF3 A;  2P02 A;  5BST A;  4FUQ A;  1QWI A;  5GTD A;  2E8C A;  4JI8 C;  4I9G A;  1MDB A;  5ADZ A;  4X62 C;  3VNS A;  5LMU C;  2OO4 A;  3GPC A;  5BUR A;  4XX2 A;  3S82 A;  3E7W A;  2D1R A;  2OPL A;  4JI7 C;  2D1Q A;  2P2F A;  3PBK A;  4DUZ C;  4GXR A;  5BUQ A;  4K0K C;  4NDN A;  1K0R A;  4DR4 C;  5FLX D;  4DG8 A;  1GPM A;  3I07 A;  3IML A;  4GXQ A;  4BSZ A;  1QM4 A;  3KXW A;  1YJ7 A;  1O92 A;  2YWB A;  3J81 D;  4LF7 C;  1PG4 A;  4JV5 C;  3OTO C;  4BCA A;  1P7L A;  4GKK C;  2KZF A;  3RG2 A;  4DR2 C;  4KTV A;  1I94 C;  1N36 C;  5T8T A;  1RG9 A;  3EQ6 A;  4DR3 C;  3DLP X;  2UXD C;  1LQL A;  3CW8 X;  3VNR A;  1FJG C;  5KEI A;  1J5E C;  3PES A;  1ZB9 A;  4L7I A;  3LGX A;  2UXB C;  5BSV A;  2BH1 X;  1MDF A;  5A19 A;  3N54 B;  4OYC A;  3JAM D;  4L2Z A;  4FUT A;  4GS5 A;  3UOW A;  4D4G A;  2OBV A;  3PRO C;  2CY1 A;  4IZ6 A;  1MXC A;  4LF5 C;  3B7W A;  2BJO A;  1XRB A;  1HNX C;  3G7S A;  1UKK A;  4LF9 C;  4TPS B;  1N33 C;  1XRC A;  3E7X A;  4DR5 C;  2UUB C;  4B3M C;  4DV5 C;  1MKY A;  3DHV A;  5H9U A;  3FCC A;  1N2F A;  3AF5 A;  5BR8 C;  2P2Q A;  2P2M A;  4U5Y D;  3LUS A;  2UUC C;  4X64 C;  1PG3 A;  4DUY C;  3CJE A;  4BC9 A;  1ULT A;  2UXC C;  3J7A D;  3L8C A;  5KYT A;  2ATW A;  1XNQ C;  4JM1 A;  5A2Q D;  5JRH A;  2DYJ A;  2E8E A;  4B3R C;  3A4I A;  4NXN C;  2VSQ A;  4YHH C;  5AE1 A;  1KKG A;  3TUF A;  4DCT A;  1O90 A;  1V26 A;  4DCS A;  5IWA C;  3IEV A;  3CW9 A;  5E7Q A;  4RLF A;  4AQY C;  2JMP A;  3C5E A;  2HHH C;  2WD9 A;  4X65 C;  5IFI A;  4LF6 C;  4DR7 C;  2Y27 A;  3RV2 A;  3VNQ A;  2YWC A;  4RM2 A;  4JI4 C;  2ONF A;  3A9V A;  4OX9 C;  4K0B A;  4IR7 A;  1WH9 A;  4R1M A;  3LAX A;  4HPV A;  3A9U A;  2CXC A;  2P20 A;  3SO4 A;  4JYA C;  1XRA A;  2QVY X;  4LE5 A;  4LF8 C;  4DG9 A;  3NYQ A;  3R9W A;  2EGT A;  3GR1 A;  3NYR A;  4X66 C;  2WP0 C;  2HJG A;  3R44 A;  3TDE A;  2E8F A;  4D57 A;  3AF6 A;  1BA3 A;  4RLQ A;  3EER A;  5CZV A;  4KHP C;  4D56 A;  1AMU A;  2E7G A;  5K85 A;  4OXI A;  1NYE A;  2ASB A;  4LFB C;  1XMQ C;  4DV4 C;  2UUA C;  1O9T A;  4JI5 C;  3T1H C;  4DV2 C;  4RVO A;  2E5L C;  4R0M A;  2D27 A;  2VQE C;  3GR0 A;  3TQI A;  4PHT A;  5AE2 A;  2Y4O A;  5KYV A;  1IBK C;  4EAT A;  2UU9 C;  1USP B;  4DV1 C;  1T5H X;  4B3T C;  2F4V C;  1MXB A;  3L95 X;  2D28 C;  4JI0 C;  3T1Y C;  4ZLP A;  4JI2 C;  4L4Q A;  4G1I A;  4DV7 C;  2E0G A;  4YY3 C;  2YCB A;  1O93 A;  2PT7 G;  4DCU A;  4LF4 C;  4NXM C;  4RMN A;  4B3S C;  1XMO C;  2OPL B;  5BUS A;  4BC7 A;  4ZJZ A;  4DV3 C;  1IBL C;  2QVX X;  5DV9 A;  3DAY A;  3FCE A;  4JI1 C;  5K8F A;  4DV0 C;  3H2T A;  2V7B A;  5BSM A;  4I9F A;  2XR1 A;  3UZ0 A;  1V25 A;  2PN2 A;  4KTT A;  1L2F A;  1USP A;  3N2Q A;  2D1S A;  4MH4 A;  2VQF C;  2QVZ X;  4FTF A;  1T5D X;  1HR0 C;  1MD9 A;  5BSR A;  5LMN C;  1HNW C;  5IT9 D;  2D1T A;  5A1G A;  1HNZ C;  4RM3 A;  1RY2 A;  1HH2 P;  3NPD A;  3NI2 A;  2DPL A;  2AYA A;  1N34 C;  2PRO A;  5CZX A;  2D7V A;  3LNV A;  3I08 A;  2P2B A;  4G37 A;  4NOZ A;  1ZB8 A;  4DCV A;  4ISB A;  4DR1 C;  5AE3 A;  3IEU A;  2P2J A;  4MTN A;  1EGA A;  1ML8 A;  5T8S A;  1XNR C;  3ETO A;  1FUG A;  3GKU A;  4GKJ C;  1JOS A;  5BSU A;  1PA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...