5LMUC

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5lmuC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5lmuC02
1ML8A 1ZB8A 1ZB9A 4B3SC 4DR1C 3T1YC 2BJOA 4DV6C 5LMNC 4YHHC 4B3MC 2UUAC 4JI5C 4DR3C 1PA4A 2EGTA 1I94C 1HR0C 4DCVA 4B3TC 1XMQC 2XR1A 2PT7G 4JV5C 4JI4C 4DR7C 2E7GA 2UXDC 1EGAA 5BR8C 2ZM6C 4XX2A 3AF6A 1XMOC 2YCBA 2QL8A 4BSZA 3GKUA 5A2QD 4DR2C 4X62C 2E8CA 4LF7C 4LF8C 2DYJA 4AQYC 5LMUC 4LF4C 2CXCA 1K0RA 2UUCC 4JI6C 2JMPA 2VQEC 2F4VC 1WH9A 2E5LC 4NXNC 4YY3C 3J80D 3IEUA 4DUYC 4DV0C 4DV1C 4DUZC 3J81D 4DV2C 5IT9D 4K0KC 4LF5C 1HNZC 1JOSA 4DV4C 1IBLC 3OTOC 4JI2C 3EERA 2HJGA 4JI3C 2UXCC 1WF3A 5IWAC 2E8FA 4B3RC 2HHHC 1N34C 2UXBC 2ATWA 2D7VA 1N2FA 3LUSA 4LFCC 5FLXD 1IBKC 1N32C 3J7AD 2ONFA 2KZFA 2E8EA 2CY1A 2OPLA 1VLAA 2OPLB 4JI0C 4MTNA 4DR4C 4GKKC 3R9XA 3IEVA 2UU9C 4DR6C 4JI8C 1USPB 1IBMC 2VQFC 3R9WA 4JI7C 1XNQC 1N33C 1HH2P 1N36C 4LF9C 4DCUA 1L2FA 1QWIA 4X64C 3I07A 4DCTA 4DV7C 4DR5C 4KHPC 3T1HC 1XNRC 3JAMD 4DV5C 1HNXC 4NOZA 2UUBC 4MH4A 4NXMC 3AF5A 2PN2A 4LFAC 1MKYA 4LFBC 4OX9C 4X66C 4GKJC 1J5EC 2ASBA 3CJEA 1LQLA 1UKKA 4LF6C 1FJGC 1HNWC 4DCSA 1KKGA 4X65C 1NYEA 4JI1C 4JYAC 4DV3C 1USPA
chains in the Genus database with same CATH superfamily
3DLPX 1ZB9A 3B7WA 5BSTA 5BUSA 1O9TA 1PU1A 4K0BA 4FUQA 1I94C 4DCVA 4B3TC 1IB8A 2XR1A 3A9UA 3IMLA 4JV5C 4JI4C 2QVZX 5BR8C 1O92A 3GKUA 5DV9A 4DR2C 2KDNA 5BSVA 4X62C 1LCIA 1M6XC 2DYJA 2P2FA 1GPMA 1XRBA 4L2ZA 2WP0C 4LE5A 1K0RA 2Y4NA 3RV2A 5K8FA 3G7SA 3SO4A 1XRCA 3AY0A 5KYVA 3J80D 2D1QA 4DUZC 3J81D 3N2QA 4DV2C 3PROC 3N54B 4LF5C 1IBLC 2HJGA 2UXCC 2E8FA 2ZTBA 1YGTA 3LUSA 4LFCC 1IBKC 3ETCA 2KZFA 2E8EA 2KZ0A 1VLAA 2OPLB 4DR4C 4MTNA 3NI2A 1XHJA 3IEVA 4JI7C 1HH2P 1YJ7A 1BA3A 4BC9A 3DAYA 1N36C 3LAXA 2MCQA 1L2FA 1QWIA 3FCCA 4DCTA 2BH1X 3LNVA 1XNRC 4NOZA 4NXMC 3AF5A 2PN2A 4LFBC 1MDBA 3UOWA 4KTVA 2ASBA 3A26A 1AMUA 4DCSA 1RY2A 1T5HX 1NYEA 3VNRA 5BSMA 1P4EA 4ODJA 2P2JA 1XRAA 1MDFA 4B3SC 4DR1C 4RVOA 5LMNC 1V60A 3E7XA 4PUIA 1PG3A 1O90A 2E7GA 2UXDC 4XX2A 3FM7A 1O93A 2YCBA 1XMOC 2QL8A 4IZ6A 5BSRA 3GR0A 3O2EA 4LF8C 2MM9A 5LMUC 5BURA 3CQ3A 4FUTA 1MXAA 2D1TA 3E7WA 1NY8A 2JMPA 3CW9A 5JRHA 4YY3C 1ULTA 5H9UA 5A1IA 4DUYC 5AE3A 4G37A 4DV1C 4KTTA 3A9VA 3KXWA 4I9GA 1PG4A 4RM3A 1P4EC 4U5YD 2P2QA 3EERA 1QM4A 5IWAC 2UXBC 2ONFA 2CY1A 4JI0C 3NYQA 2QW0X 4G1IA 2CU6A 3RG2A 3DHVA 1USPB 1IBMC 3R9WA 2DHMA 1XNQC 1N33C 4ZLPA 5KEIA 4NDNA 2V7BA 4DV7C 4KHPC 3I08A 3T1HC 1MXBA 3JAMD 4DV5C 3A25A 4MH4A 5K85A 4GKJC 5A1GA 2YWCA 5T8TA 4OYCA 1FJGC 1FLOA 3TQIA 1HNWC 4PUHA 4RMNA 4BBYA 4DG8A 4L7IA 1TH5A 1ML8A 1ZB8A 5AE2A 3GR1A 3T1YC 4PROC 4YHHC 2UUAC 4R1MA 4JI5C 2QVXX 2EGTA 2MMAB 4RLFA 2PT7G 4GXRA 4EATA 4R0MA 3K6RA 3UX2A 1FUGA 2YWBA 5A2QD 5AE1A 2E8CA 5LCIA 4PZPA 4ZJZA 4LF4C 2CXCA 2D1SA 3UX3A 2UUCC 4HPVA 4JI6C 3CQ1A 2P2MA 2QVYX 2VQEC 2VSQA 2DPLA 4R1LA 1MD9A 3IPLA 4L4QA 1WH9A 4JM1A 4NXNC 4DV0C 3IEUA 2PROA 4ISBA 5CZVA 4G36A 2P20A 4RM2A 5IT9D 4K0KC 3OTOC 1VEHA 4WV3A 1WF3A 1XS3A 2HHHC 1N34C 5FLXD 1N32C 3TUFA 3J7AD 2OPLA 5CZXA 4GKKC 1RG9A 3R9XA 2VZEA 4DR6C 4D57A 3LGXA 4PHTA 4DCUA 3I07A 2M5OA 4DR5C 5BSWA 3NPDA 4LFAC 1MKYA 4OX9C 2Y4OA 4X66C 4BCAA 3H2TA 3CJEA 2M5HA 1LQLA 1UKKA 3VNSA 1KKGA 2ZZMA 1UWDA 4X65C 3R44A 3TR3A 4JYAC 4DV3C 1M6XA 3L8CA 4FTFA 4RVNA 3FCEA 4D4IA 2BJOA 4DV6C 4B3MC 5ADZA 4RLQA 4PUGA 4IR7A 3GPCA 4DR3C 1PA4A 3TDEA 1HR0C 5E7QA 1XMQC 4I9FA 3S82A 3VNQA 4DR7C 1EGAA 2ZM6C 3AF6A 4BSZA 1V25A 2D28C 3NYRA 1MXCA 4LF7C 4AQYC 4D4GA 2NCLA 2ZZNA 3C5EA 2F4VC 5BSUA 3UEBA 1T5DX 2E5LC 2OBVA 3L95X 1WCJA 4TPSB 2D27A 5IFIA 4OXIA 2OO4A 2AYAA 3PESA 1HNZC 1JOSA 4DV4C 4JI2C 3ETOA 4JI3C 5GTDA 5A19A 3EQ6A 4B3RC 2P2BA 3UZ0A 2ATWA 2D7VA 1N2FA 2P02A 1XDXA 4WS9A 2D1RA 2UU9C 4JI8C 1V26A 2VQFC 1P7LA 4D56A 4LF9C 2PG1E 5T8SA 4X64C 5KYTA 1HNXC 2UUBC 2JNVA 2E0GA 2WD9A 2YX1A 3LNOA 1J5EC 3PBKA 3CW8X 4LF6C 4BC7A 5BUQA 4GS5A 4DG9A 3A4IA 3CQ2A 2Z51A 2Y27A 4GXQA 4JI1C 1USPA
chains in the Genus database with same CATH topology
3DLPX 1ZB9A 3B7WA 5BSTA 5BUSA 1O9TA 4K0BA 4FUQA 1I94C 4DCVA 4B3TC 2XR1A 3A9UA 3IMLA 4JV5C 4JI4C 2QVZX 5BR8C 1O92A 3GKUA 5DV9A 4DR2C 5BSVA 4X62C 1LCIA 2DYJA 2P2FA 1GPMA 1XRBA 4L2ZA 2WP0C 4LE5A 1K0RA 2Y4NA 3RV2A 5K8FA 3G7SA 3SO4A 1XRCA 5KYVA 3J80D 2D1QA 4DUZC 3J81D 3N2QA 4DV2C 3PROC 3N54B 4LF5C 1IBLC 2HJGA 2UXCC 2E8FA 3LUSA 4LFCC 1IBKC 3ETCA 2KZFA 2E8EA 4DR4C 1VLAA 2OPLB 4MTNA 3NI2A 3IEVA 4JI7C 1HH2P 1YJ7A 1BA3A 4BC9A 3DAYA 1N36C 3LAXA 1L2FA 1QWIA 3FCCA 4DCTA 2BH1X 3LNVA 1XNRC 4NOZA 4NXMC 3AF5A 2PN2A 4LFBC 1MDBA 3UOWA 4KTVA 2ASBA 1AMUA 4DCSA 1RY2A 1T5HX 1NYEA 3VNRA 5BSMA 4ODJA 2P2JA 1XRAA 1MDFA 4B3SC 4DR1C 4RVOA 5LMNC 3E7XA 1PG3A 1O90A 2E7GA 2UXDC 4XX2A 1O93A 2YCBA 1XMOC 2QL8A 4IZ6A 5BSRA 3GR0A 4LF8C 5LMUC 5BURA 4FUTA 1MXAA 2D1TA 3E7WA 3CW9A 2JMPA 5JRHA 4YY3C 1ULTA 5H9UA 5A1IA 4DUYC 5AE3A 4G37A 4DV1C 4KTTA 3A9VA 3KXWA 4I9GA 1PG4A 4RM3A 4U5YD 2P2QA 3EERA 1QM4A 5IWAC 2UXBC 2ONFA 2CY1A 4JI0C 3NYQA 2QW0X 4G1IA 3RG2A 3DHVA 1USPB 1IBMC 3R9WA 1XNQC 1N33C 4ZLPA 5KEIA 4NDNA 2V7BA 4DV7C 4KHPC 3I08A 3T1HC 1MXBA 3JAMD 4DV5C 4MH4A 5K85A 4GKJC 5A1GA 2YWCA 5T8TA 4OYCA 1FJGC 3TQIA 1HNWC 4RMNA 4BBYA 4DG8A 4L7IA 1ML8A 1ZB8A 5AE2A 3GR1A 3T1YC 4PROC 4YHHC 2UUAC 4R1MA 4JI5C 2QVXX 2EGTA 4RLFA 2PT7G 4GXRA 4EATA 4R0MA 1FUGA 2YWBA 5A2QD 5AE1A 2E8CA 4PZPA 4ZJZA 4LF4C 2CXCA 2D1SA 2UUCC 4HPVA 4JI6C 2P2MA 2QVYX 2VQEC 2VSQA 2DPLA 4R1LA 1MD9A 3IPLA 4L4QA 1WH9A 4JM1A 4NXNC 4DV0C 3IEUA 2PROA 4ISBA 5CZVA 4G36A 2P20A 4RM2A 5IT9D 4K0KC 3OTOC 4WV3A 1WF3A 2HHHC 1N34C 5FLXD 1N32C 3TUFA 3J7AD 2OPLA 5CZXA 4GKKC 1RG9A 3R9XA 2VZEA 4DR6C 4D57A 3LGXA 4PHTA 4DCUA 3I07A 4DR5C 5BSWA 3NPDA 4LFAC 1MKYA 4OX9C 2Y4OA 4X66C 4BCAA 3H2TA 3CJEA 1LQLA 1UKKA 3VNSA 1KKGA 4X65C 3R44A 4JYAC 4DV3C 3L8CA 4FTFA 4RVNA 3FCEA 4D4IA 2BJOA 4DV6C 4B3MC 5ADZA 4RLQA 4IR7A 3GPCA 4DR3C 1PA4A 3TDEA 1HR0C 5E7QA 1XMQC 4I9FA 3S82A 3VNQA 4DR7C 1EGAA 2ZM6C 3AF6A 4BSZA 1V25A 2D28C 3NYRA 1MXCA 4LF7C 4AQYC 4D4GA 3C5EA 2F4VC 5BSUA 1T5DX 2E5LC 2OBVA 3L95X 4TPSB 2D27A 5IFIA 4OXIA 2OO4A 2AYAA 3PESA 1HNZC 1JOSA 4DV4C 4JI2C 3ETOA 4JI3C 5GTDA 5A19A 3EQ6A 4B3RC 2P2BA 3UZ0A 2ATWA 2D7VA 1N2FA 2P02A 4WS9A 2D1RA 2UU9C 4JI8C 1V26A 2VQFC 1P7LA 4D56A 4LF9C 5T8SA 4X64C 5KYTA 1HNXC 2UUBC 2E0GA 2WD9A 1J5EC 3PBKA 3CW8X 4LF6C 4BC7A 5BUQA 4GS5A 4DG9A 3A4IA 2Y27A 4GXQA 4JI1C 1USPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML8 A;  1ZB8 A;  1ZB9 A;  4B3S C;  4DR1 C;  3T1Y C;  2BJO A;  4DV6 C;  5LMN C;  4YHH C;  4B3M C;  2UUA C;  4JI5 C;  4DR3 C;  1PA4 A;  2EGT A;  1I94 C;  1HR0 C;  4DCV A;  4B3T C;  1XMQ C;  2XR1 A;  2PT7 G;  4JV5 C;  4JI4 C;  4DR7 C;  2E7G A;  2UXD C;  1EGA A;  5BR8 C;  2ZM6 C;  4XX2 A;  3AF6 A;  1XMO C;  2YCB A;  2QL8 A;  4BSZ A;  3GKU A;  5A2Q D;  4DR2 C;  4X62 C;  2E8C A;  4LF7 C;  4LF8 C;  2DYJ A;  4AQY C;  5LMU C;  4LF4 C;  2CXC A;  1K0R A;  2UUC C;  4JI6 C;  2JMP A;  2VQE C;  2F4V C;  1WH9 A;  2E5L C;  4NXN C;  4YY3 C;  3J80 D;  3IEU A;  4DUY C;  4DV0 C;  4DV1 C;  4DUZ C;  3J81 D;  4DV2 C;  5IT9 D;  4K0K C;  4LF5 C;  1HNZ C;  1JOS A;  4DV4 C;  1IBL C;  3OTO C;  4JI2 C;  3EER A;  2HJG A;  4JI3 C;  2UXC C;  1WF3 A;  5IWA C;  2E8F A;  4B3R C;  2HHH C;  1N34 C;  2UXB C;  2ATW A;  2D7V A;  1N2F A;  3LUS A;  4LFC C;  5FLX D;  1IBK C;  1N32 C;  3J7A D;  2ONF A;  2KZF A;  2E8E A;  2CY1 A;  2OPL A;  1VLA A;  2OPL B;  4JI0 C;  4MTN A;  4DR4 C;  4GKK C;  3R9X A;  3IEV A;  2UU9 C;  4DR6 C;  4JI8 C;  1USP B;  1IBM C;  2VQF C;  3R9W A;  4JI7 C;  1XNQ C;  1N33 C;  1HH2 P;  1N36 C;  4LF9 C;  4DCU A;  1L2F A;  1QWI A;  4X64 C;  3I07 A;  4DCT A;  4DV7 C;  4DR5 C;  4KHP C;  3T1H C;  1XNR C;  3JAM D;  4DV5 C;  1HNX C;  4NOZ A;  2UUB C;  4MH4 A;  4NXM C;  3AF5 A;  2PN2 A;  4LFA C;  1MKY A;  4LFB C;  4OX9 C;  4X66 C;  4GKJ C;  1J5E C;  2ASB A;  3CJE A;  1LQL A;  1UKK A;  4LF6 C;  1FJG C;  1HNW C;  4DCS A;  1KKG A;  4X65 C;  1NYE A;  4JI1 C;  4JYA C;  4DV3 C;  1USP A; 
#chains in the Genus database with same CATH topology
 3DLP X;  1ZB9 A;  3B7W A;  5BST A;  5BUS A;  1O9T A;  1PU1 A;  4K0B A;  4FUQ A;  1I94 C;  4DCV A;  4B3T C;  1IB8 A;  2XR1 A;  3A9U A;  3IML A;  4JV5 C;  4JI4 C;  2QVZ X;  5BR8 C;  1O92 A;  3GKU A;  5DV9 A;  4DR2 C;  2KDN A;  5BSV A;  4X62 C;  1LCI A;  1M6X C;  2DYJ A;  2P2F A;  1GPM A;  1XRB A;  4L2Z A;  2WP0 C;  4LE5 A;  1K0R A;  2Y4N A;  3RV2 A;  5K8F A;  3G7S A;  3SO4 A;  1XRC A;  3AY0 A;  5KYV A;  3J80 D;  2D1Q A;  4DUZ C;  3J81 D;  3N2Q A;  4DV2 C;  3PRO C;  3N54 B;  4LF5 C;  1IBL C;  2HJG A;  2UXC C;  2E8F A;  2ZTB A;  1YGT A;  3LUS A;  4LFC C;  1IBK C;  3ETC A;  2KZF A;  2E8E A;  2KZ0 A;  1VLA A;  2OPL B;  4DR4 C;  4MTN A;  3NI2 A;  1XHJ A;  3IEV A;  4JI7 C;  1HH2 P;  1YJ7 A;  1BA3 A;  4BC9 A;  3DAY A;  1N36 C;  3LAX A;  2MCQ A;  1L2F A;  1QWI A;  3FCC A;  4DCT A;  2BH1 X;  3LNV A;  1XNR C;  4NOZ A;  4NXM C;  3AF5 A;  2PN2 A;  4LFB C;  1MDB A;  3UOW A;  4KTV A;  2ASB A;  3A26 A;  1AMU A;  4DCS A;  1RY2 A;  1T5H X;  1NYE A;  3VNR A;  5BSM A;  1P4E A;  4ODJ A;  2P2J A;  1XRA A;  1MDF A;  4B3S C;  4DR1 C;  4RVO A;  5LMN C;  1V60 A;  3E7X A;  4PUI A;  1PG3 A;  1O90 A;  2E7G A;  2UXD C;  4XX2 A;  3FM7 A;  1O93 A;  2YCB A;  1XMO C;  2QL8 A;  4IZ6 A;  5BSR A;  3GR0 A;  3O2E A;  4LF8 C;  2MM9 A;  5LMU C;  5BUR A;  3CQ3 A;  4FUT A;  1MXA A;  2D1T A;  3E7W A;  1NY8 A;  2JMP A;  3CW9 A;  5JRH A;  4YY3 C;  1ULT A;  5H9U A;  5A1I A;  4DUY C;  5AE3 A;  4G37 A;  4DV1 C;  4KTT A;  3A9V A;  3KXW A;  4I9G A;  1PG4 A;  4RM3 A;  1P4E C;  4U5Y D;  2P2Q A;  3EER A;  1QM4 A;  5IWA C;  2UXB C;  2ONF A;  2CY1 A;  4JI0 C;  3NYQ A;  2QW0 X;  4G1I A;  2CU6 A;  3RG2 A;  3DHV A;  1USP B;  1IBM C;  3R9W A;  2DHM A;  1XNQ C;  1N33 C;  4ZLP A;  5KEI A;  4NDN A;  2V7B A;  4DV7 C;  4KHP C;  3I08 A;  3T1H C;  1MXB A;  3JAM D;  4DV5 C;  3A25 A;  4MH4 A;  5K85 A;  4GKJ C;  5A1G A;  2YWC A;  5T8T A;  4OYC A;  1FJG C;  1FLO A;  3TQI A;  1HNW C;  4PUH A;  4RMN A;  4BBY A;  4DG8 A;  4L7I A;  1TH5 A;  1ML8 A;  1ZB8 A;  5AE2 A;  3GR1 A;  3T1Y C;  4PRO C;  4YHH C;  2UUA C;  4R1M A;  4JI5 C;  2QVX X;  2EGT A;  2MMA B;  4RLF A;  2PT7 G;  4GXR A;  4EAT A;  4R0M A;  3K6R A;  3UX2 A;  1FUG A;  2YWB A;  5A2Q D;  5AE1 A;  2E8C A;  5LCI A;  4PZP A;  4ZJZ A;  4LF4 C;  2CXC A;  2D1S A;  3UX3 A;  2UUC C;  4HPV A;  4JI6 C;  3CQ1 A;  2P2M A;  2QVY X;  2VQE C;  2VSQ A;  2DPL A;  4R1L A;  1MD9 A;  3IPL A;  4L4Q A;  1WH9 A;  4JM1 A;  4NXN C;  4DV0 C;  3IEU A;  2PRO A;  4ISB A;  5CZV A;  4G36 A;  2P20 A;  4RM2 A;  5IT9 D;  4K0K C;  3OTO C;  1VEH A;  4WV3 A;  1WF3 A;  1XS3 A;  2HHH C;  1N34 C;  5FLX D;  1N32 C;  3TUF A;  3J7A D;  2OPL A;  5CZX A;  4GKK C;  1RG9 A;  3R9X A;  2VZE A;  4DR6 C;  4D57 A;  3LGX A;  4PHT A;  4DCU A;  3I07 A;  2M5O A;  4DR5 C;  5BSW A;  3NPD A;  4LFA C;  1MKY A;  4OX9 C;  2Y4O A;  4X66 C;  4BCA A;  3H2T A;  3CJE A;  2M5H A;  1LQL A;  1UKK A;  3VNS A;  1KKG A;  2ZZM A;  1UWD A;  4X65 C;  3R44 A;  3TR3 A;  4JYA C;  4DV3 C;  1M6X A;  3L8C A;  4FTF A;  4RVN A;  3FCE A;  4D4I A;  2BJO A;  4DV6 C;  4B3M C;  5ADZ A;  4RLQ A;  4PUG A;  4IR7 A;  3GPC A;  4DR3 C;  1PA4 A;  3TDE A;  1HR0 C;  5E7Q A;  1XMQ C;  4I9F A;  3S82 A;  3VNQ A;  4DR7 C;  1EGA A;  2ZM6 C;  3AF6 A;  4BSZ A;  1V25 A;  2D28 C;  3NYR A;  1MXC A;  4LF7 C;  4AQY C;  4D4G A;  2NCL A;  2ZZN A;  3C5E A;  2F4V C;  5BSU A;  3UEB A;  1T5D X;  2E5L C;  2OBV A;  3L95 X;  1WCJ A;  4TPS B;  2D27 A;  5IFI A;  4OXI A;  2OO4 A;  2AYA A;  3PES A;  1HNZ C;  1JOS A;  4DV4 C;  4JI2 C;  3ETO A;  4JI3 C;  5GTD A;  5A19 A;  3EQ6 A;  4B3R C;  2P2B A;  3UZ0 A;  2ATW A;  2D7V A;  1N2F A;  2P02 A;  1XDX A;  4WS9 A;  2D1R A;  2UU9 C;  4JI8 C;  1V26 A;  2VQF C;  1P7L A;  4D56 A;  4LF9 C;  2PG1 E;  5T8S A;  4X64 C;  5KYT A;  1HNX C;  2UUB C;  2JNV A;  2E0G A;  2WD9 A;  2YX1 A;  3LNO A;  1J5E C;  3PBK A;  3CW8 X;  4LF6 C;  4BC7 A;  5BUQ A;  4GS5 A;  4DG9 A;  3A4I A;  3CQ2 A;  2Z51 A;  2Y27 A;  4GXQ A;  4JI1 C;  1USP A; 
#chains in the Genus database with same CATH homology
 3DLP X;  1ZB9 A;  3B7W A;  5BST A;  5BUS A;  1O9T A;  4K0B A;  4FUQ A;  1I94 C;  4DCV A;  4B3T C;  2XR1 A;  3A9U A;  3IML A;  4JV5 C;  4JI4 C;  2QVZ X;  5BR8 C;  1O92 A;  3GKU A;  5DV9 A;  4DR2 C;  5BSV A;  4X62 C;  1LCI A;  2DYJ A;  2P2F A;  1GPM A;  1XRB A;  4L2Z A;  2WP0 C;  4LE5 A;  1K0R A;  2Y4N A;  3RV2 A;  5K8F A;  3G7S A;  3SO4 A;  1XRC A;  5KYV A;  3J80 D;  2D1Q A;  4DUZ C;  3J81 D;  3N2Q A;  4DV2 C;  3PRO C;  3N54 B;  4LF5 C;  1IBL C;  2HJG A;  2UXC C;  2E8F A;  3LUS A;  4LFC C;  1IBK C;  3ETC A;  2KZF A;  2E8E A;  4DR4 C;  1VLA A;  2OPL B;  4MTN A;  3NI2 A;  3IEV A;  4JI7 C;  1HH2 P;  1YJ7 A;  1BA3 A;  4BC9 A;  3DAY A;  1N36 C;  3LAX A;  1L2F A;  1QWI A;  3FCC A;  4DCT A;  2BH1 X;  3LNV A;  1XNR C;  4NOZ A;  4NXM C;  3AF5 A;  2PN2 A;  4LFB C;  1MDB A;  3UOW A;  4KTV A;  2ASB A;  1AMU A;  4DCS A;  1RY2 A;  1T5H X;  1NYE A;  3VNR A;  5BSM A;  4ODJ A;  2P2J A;  1XRA A;  1MDF A;  4B3S C;  4DR1 C;  4RVO A;  5LMN C;  3E7X A;  1PG3 A;  1O90 A;  2E7G A;  2UXD C;  4XX2 A;  1O93 A;  2YCB A;  1XMO C;  2QL8 A;  4IZ6 A;  5BSR A;  3GR0 A;  4LF8 C;  5LMU C;  5BUR A;  4FUT A;  1MXA A;  2D1T A;  3E7W A;  3CW9 A;  2JMP A;  5JRH A;  4YY3 C;  1ULT A;  5H9U A;  5A1I A;  4DUY C;  5AE3 A;  4G37 A;  4DV1 C;  4KTT A;  3A9V A;  3KXW A;  4I9G A;  1PG4 A;  4RM3 A;  4U5Y D;  2P2Q A;  3EER A;  1QM4 A;  5IWA C;  2UXB C;  2ONF A;  2CY1 A;  4JI0 C;  3NYQ A;  2QW0 X;  4G1I A;  3RG2 A;  3DHV A;  1USP B;  1IBM C;  3R9W A;  1XNQ C;  1N33 C;  4ZLP A;  5KEI A;  4NDN A;  2V7B A;  4DV7 C;  4KHP C;  3I08 A;  3T1H C;  1MXB A;  3JAM D;  4DV5 C;  4MH4 A;  5K85 A;  4GKJ C;  5A1G A;  2YWC A;  5T8T A;  4OYC A;  1FJG C;  3TQI A;  1HNW C;  4RMN A;  4BBY A;  4DG8 A;  4L7I A;  1ML8 A;  1ZB8 A;  5AE2 A;  3GR1 A;  3T1Y C;  4PRO C;  4YHH C;  2UUA C;  4R1M A;  4JI5 C;  2QVX X;  2EGT A;  4RLF A;  2PT7 G;  4GXR A;  4EAT A;  4R0M A;  1FUG A;  2YWB A;  5A2Q D;  5AE1 A;  2E8C A;  4PZP A;  4ZJZ A;  4LF4 C;  2CXC A;  2D1S A;  2UUC C;  4HPV A;  4JI6 C;  2P2M A;  2QVY X;  2VQE C;  2VSQ A;  2DPL A;  4R1L A;  1MD9 A;  3IPL A;  4L4Q A;  1WH9 A;  4JM1 A;  4NXN C;  4DV0 C;  3IEU A;  2PRO A;  4ISB A;  5CZV A;  4G36 A;  2P20 A;  4RM2 A;  5IT9 D;  4K0K C;  3OTO C;  4WV3 A;  1WF3 A;  2HHH C;  1N34 C;  5FLX D;  1N32 C;  3TUF A;  3J7A D;  2OPL A;  5CZX A;  4GKK C;  1RG9 A;  3R9X A;  2VZE A;  4DR6 C;  4D57 A;  3LGX A;  4PHT A;  4DCU A;  3I07 A;  4DR5 C;  5BSW A;  3NPD A;  4LFA C;  1MKY A;  4OX9 C;  2Y4O A;  4X66 C;  4BCA A;  3H2T A;  3CJE A;  1LQL A;  1UKK A;  3VNS A;  1KKG A;  4X65 C;  3R44 A;  4JYA C;  4DV3 C;  3L8C A;  4FTF A;  4RVN A;  3FCE A;  4D4I A;  2BJO A;  4DV6 C;  4B3M C;  5ADZ A;  4RLQ A;  4IR7 A;  3GPC A;  4DR3 C;  1PA4 A;  3TDE A;  1HR0 C;  5E7Q A;  1XMQ C;  4I9F A;  3S82 A;  3VNQ A;  4DR7 C;  1EGA A;  2ZM6 C;  3AF6 A;  4BSZ A;  1V25 A;  2D28 C;  3NYR A;  1MXC A;  4LF7 C;  4AQY C;  4D4G A;  3C5E A;  2F4V C;  5BSU A;  1T5D X;  2E5L C;  2OBV A;  3L95 X;  4TPS B;  2D27 A;  5IFI A;  4OXI A;  2OO4 A;  2AYA A;  3PES A;  1HNZ C;  1JOS A;  4DV4 C;  4JI2 C;  3ETO A;  4JI3 C;  5GTD A;  5A19 A;  3EQ6 A;  4B3R C;  2P2B A;  3UZ0 A;  2ATW A;  2D7V A;  1N2F A;  2P02 A;  4WS9 A;  2D1R A;  2UU9 C;  4JI8 C;  1V26 A;  2VQF C;  1P7L A;  4D56 A;  4LF9 C;  5T8S A;  4X64 C;  5KYT A;  1HNX C;  2UUB C;  2E0G A;  2WD9 A;  1J5E C;  3PBK A;  3CW8 X;  4LF6 C;  4BC7 A;  5BUQ A;  4GS5 A;  4DG9 A;  3A4I A;  2Y27 A;  4GXQ A;  4JI1 C;  1USP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...