5LMUC

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5lmuC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5lmuC02
4YHHC 1MKYA 4JI6C 3J81D 2DYJA 1WF3A 3OTOC 1J5EC 1WH9A 4DV4C 1JOSA 2OPLB 2E8FA 4JI1C 4LF5C 4LF8C 2CXCA 1KKGA 4DV3C 4JI5C 4DV5C 1HNWC 2UXDC 2JMPA 1ZB8A 5BR8C 4MTNA 3JAMD 3T1YC 4JI2C 2YCBA 2E8CA 4MH4A 4X65C 4B3MC 4X64C 1ML8A 4DCTA 3IEUA 2BJOA 3J80D 3AF5A 1VLAA 1XNQC 4GKJC 2UXCC 4DV2C 4LF4C 2ASBA 3R9WA 4JI8C 2UXBC 1N34C 4B3TC 2ONFA 2HJGA 1EGAA 4DV0C 4DR1C 4X66C 4JI3C 1I94C 1K0RA 5FLXD 4K0KC 5A2QD 1USPA 4JI0C 3GKUA 1N2FA 1XMOC 2PN2A 2ATWA 2UUBC 2F4VC 1L2FA 4DUZC 1LQLA 4B3RC 4LFBC 4DCSA 1FJGC 4KHPC 4NXMC 4JI4C 2PT7G 3I07A 1USPB 2EGTA 1N33C 4JV5C 4LF6C 4DR4C 4XX2A 5IT9D 4BSZA 4DCVA 4DV1C 3IEVA 1XNRC 4X62C 2UUAC 4GKKC 4DV6C 4NXNC 2UUCC 3CJEA 4DR2C 2VQEC 5IWAC 3AF6A 4B3SC 3J7AD 1UKKA 4DR6C 1QWIA 1NYEA 1IBMC 5LMNC 4NOZA 2VQFC 1IBKC 4AQYC 4LF7C 4OX9C 4DR3C 2XR1A 2D7VA 1XMQC 4LFCC 2E7GA 4LFAC 3EERA 2E5LC 1N36C 2CY1A 2HHHC 1HNXC 3T1HC 2UU9C 3R9XA 4YY3C 4DUYC 1HR0C 5LMUC 1HH2P 1ZB9A 1N32C 4DCUA 3LUSA 2ZM6C 2OPLA 4JYAC 2KZFA 4JI7C 4DR7C 1HNZC 1PA4A 4DV7C 4LF9C 2QL8A 2E8EA 4DR5C 1IBLC
chains in the Genus database with same CATH superfamily
4FUTA 4JI6C 3J81D 3TDEA 4R1LA 1ULTA 2E8FA 3NI2A 3KXWA 4DV3C 3NPDA 1XS3A 1YGTA 1T5HX 3JAMD 1T5DX 5ADZA 3LNOA 2E8CA 3VNSA 5GTDA 4X64C 4RVOA 1RY2A 3IEUA 4EATA 1XNQC 4OYCA 3SO4A 1NY8A 5JRHA 3A9UA 4LF4C 3R9WA 4JI8C 3E7WA 3FCEA 2ONFA 1K0RA 5FLXD 5A2QD 3CQ1A 1PG4A 5BSVA 3GKUA 2D1SA 1N2FA 4RM3A 2UUBC 2CU6A 5AE2A 4KTTA 3H2TA 2P02A 1P7LA 4JI4C 2EGTA 1YJ7A 4D56A 4IR7A 2NCLA 5BUSA 4DV1C 2QW0X 4BC9A 4X62C 2UUAC 5T8TA 4D4IA 3AY0A 5E7QA 5IWAC 3A9VA 1UKKA 4LE5A 4TPSB 4I9FA 1O90A 5AE3A 5LMNC 4DG9A 2XR1A 4G37A 3EERA 3UOWA 2AYAA 4PROC 2HHHC 4ISBA 4DUYC 4GXQA 4FTFA 3IPLA 2KZ0A 4G36A 2PG1E 4GS5A 1HH2P 5A19A 3TUFA 3LUSA 3L95X 2WP0C 2KZFA 2V7BA 1GPMA 1HNZC 4LF9C 4B3TC 2DYJA 3OTOC 1J5EC 1MXCA 1WH9A 1JOSA 4GXRA 4JI1C 4LF5C 4PZPA 2D1TA 4DV5C 1HNWC 4RM2A 5K85A 1UWDA 3T1YC 5AE1A 5K8FA 4PUHA 2Y4NA 4ODJA 2BJOA 2UXCC 3UX2A 4ZJZA 2P2QA 1MDBA 2JNVA 3IMLA 3UEBA 4RMNA 1XHJA 3GR0A 1TH5A 4JI3C 5BUQA 2P2BA 1V26A 3L8CA 5H9UA 4JI0C 2PN2A 1P4EC 1O9TA 1LQLA 4DG8A 4LFBC 1FJGC 4L2ZA 2VZEA 2MM9A 3G7SA 3I07A 3NYQA 3A26A 4DR4C 5IT9D 4BSZA 5CZXA 1M6XC 4BC7A 2UUCC 3C5EA 2OO4A 4NDNA 4D57A 2D28C 3VNQA 5KYTA 1NYEA 3CQ2A 1IBMC 3UZ0A 3N54B 4R1MA 3CQ3A 4LF7C 5BSMA 5BSRA 3PESA 4LFCC 2E7GA 3GR1A 4LFAC 2E5LC 1N36C 2CY1A 5BSTA 5BSWA 4YY3C 1XRCA 3FM7A 5LMUC 2Y4OA 2ZZMA 1ZB9A 1XDXA 3A25A 2MMAB 2OPLA 4PUIA 4RVNA 1LCIA 4DV7C 2E8EA 2M5HA 1MKYA 3I08A 1WF3A 3N2QA 4FUQA 4DV4C 2OPLB 4LF8C 2CXCA 2YX1A 1KKGA 2KDNA 3K6RA 3DHVA 4JI5C 2UXDC 2JMPA 1ZB8A 1WCJA 4WS9A 4JI2C 5KEIA 4MH4A 4X65C 4B3MC 2BH1X 4PUGA 1ML8A 4DCTA 2ZZNA 2D1RA 3AF5A 1VLAA 4DV2C 2ASBA 2VSQA 1N34C 3PBKA 2HJGA 2M5OA 4DV0C 4DR1C 2ZTBA 4RLFA 4K0KC 1XMOC 2F4VC 1L2FA 5A1GA 4DUZC 3TR3A 4DCSA 1IB8A 4KHPC 2WD9A 1P4EA 1N33C 4LF6C 4XX2A 3IEVA 2E0GA 1XRAA 1RG9A 4U5YD 1MXBA 1V60A 2QVYX 1MD9A 4DV6C 4KTVA 3CW8X 4DR2C 2VQEC 3ETOA 4HPVA 4DR6C 1QWIA 2MCQA 1O92A 4OXIA 3EQ6A 1PG3A 4NOZA 2VQFC 2DPLA 3FCCA 4OX9C 4DR3C 1MDFA 2P2FA 2D7VA 1XMQC 4BCAA 3UX3A 2UU9C 1QM4A 3LGXA 5LCIA 1HR0C 4K0BA 2P2MA 5BSUA 3A4IA 2ZM6C 4IZ6A 2D27A 4JI7C 3RV2A 2DHMA 1PA4A 3DLPX 2QL8A 5IFIA 3TQIA 2YWBA 4YHHC 5BURA 2P20A 1MXAA 5A1IA 2YWCA 2D1QA 1FUGA 5BR8C 2OBVA 4MTNA 3VNRA 5CZVA 2YCBA 3O2EA 2QVZX 4L7IA 4R0MA 3LAXA 3J80D 4RLQA 1O93A 3ETCA 4GKJC 2UXBC 3DAYA 3S82A 1EGAA 2Y27A 4X66C 1I94C 4WV3A 1USPA 4G1IA 4D4GA 2ATWA 4PHTA 2PROA 1PU1A 4ZLPA 4B3RC 4BBYA 4NXMC 2PT7G 1USPB 4JV5C 2P2JA 4DCVA 1XNRC 4GKKC 1AMUA 4NXNC 3CJEA 2QVXX 5T8SA 3PROC 3AF6A 4B3SC 3J7AD 4L4QA 5KYVA 1V25A 3LNVA 3NYRA 1IBKC 4AQYC 5DV9A 1FLOA 1BA3A 3RG2A 4JM1A 4I9GA 1HNXC 3T1HC 3R9XA 3GPCA 1XRBA 1VEHA 3E7XA 2Z51A 1N32C 4DCUA 3B7WA 4JYAC 1M6XA 4DR7C 3CW9A 3R44A 4DR5C 1IBLC
chains in the Genus database with same CATH topology
4FUTA 4JI6C 3J81D 3TDEA 4R1LA 1ULTA 2E8FA 3NI2A 3KXWA 4DV3C 3NPDA 1T5HX 3JAMD 1T5DX 5ADZA 2E8CA 3VNSA 5GTDA 4X64C 4RVOA 1RY2A 3IEUA 4EATA 1XNQC 4OYCA 3SO4A 5JRHA 3A9UA 4LF4C 3R9WA 4JI8C 3E7WA 3FCEA 2ONFA 1K0RA 5FLXD 5A2QD 1PG4A 5BSVA 3GKUA 2D1SA 1N2FA 4RM3A 2UUBC 5AE2A 4KTTA 3H2TA 2P02A 1P7LA 4JI4C 2EGTA 1YJ7A 4D56A 4IR7A 5BUSA 4DV1C 2QW0X 4BC9A 4X62C 2UUAC 5T8TA 4D4IA 5E7QA 5IWAC 3A9VA 1UKKA 4LE5A 4TPSB 4I9FA 1O90A 5AE3A 5LMNC 4DG9A 2XR1A 4G37A 3EERA 3UOWA 2AYAA 4PROC 2HHHC 4ISBA 4DUYC 4GXQA 4FTFA 3IPLA 4G36A 4GS5A 1HH2P 5A19A 3TUFA 3LUSA 3L95X 2WP0C 2KZFA 2V7BA 1GPMA 1HNZC 4LF9C 4B3TC 2DYJA 3OTOC 1J5EC 1MXCA 1WH9A 1JOSA 4GXRA 4JI1C 4LF5C 4PZPA 2D1TA 4DV5C 1HNWC 4RM2A 5K85A 3T1YC 5AE1A 5K8FA 2Y4NA 4ODJA 2BJOA 2UXCC 4ZJZA 2P2QA 1MDBA 3IMLA 4RMNA 3GR0A 4JI3C 5BUQA 2P2BA 1V26A 3L8CA 5H9UA 4JI0C 2PN2A 1O9TA 1LQLA 4DG8A 4LFBC 1FJGC 4L2ZA 2VZEA 3G7SA 3I07A 3NYQA 4DR4C 5IT9D 4BSZA 5CZXA 4BC7A 2UUCC 3C5EA 2OO4A 4NDNA 4D57A 2D28C 3VNQA 1NYEA 5KYTA 1IBMC 3UZ0A 3N54B 4R1MA 4LF7C 5BSMA 5BSRA 3PESA 4LFCC 2E7GA 3GR1A 4LFAC 2E5LC 1N36C 2CY1A 5BSTA 5BSWA 4YY3C 1XRCA 5LMUC 2Y4OA 1ZB9A 2OPLA 4RVNA 1LCIA 4DV7C 2E8EA 1MKYA 3I08A 1WF3A 3N2QA 4FUQA 4DV4C 2OPLB 4LF8C 2CXCA 1KKGA 3DHVA 4JI5C 2UXDC 2JMPA 1ZB8A 4WS9A 4JI2C 5KEIA 4MH4A 4X65C 4B3MC 2BH1X 1ML8A 4DCTA 2D1RA 3AF5A 1VLAA 4DV2C 2ASBA 2VSQA 1N34C 3PBKA 2HJGA 4DV0C 4DR1C 4RLFA 4K0KC 1XMOC 2F4VC 1L2FA 5A1GA 4DUZC 4DCSA 4KHPC 2WD9A 1N33C 4LF6C 4XX2A 3IEVA 2E0GA 1XRAA 1RG9A 4U5YD 1MXBA 2QVYX 1MD9A 4DV6C 4KTVA 3CW8X 4DR2C 2VQEC 3ETOA 4HPVA 4DR6C 1QWIA 1O92A 4OXIA 3EQ6A 1PG3A 4NOZA 2VQFC 2DPLA 3FCCA 4OX9C 4DR3C 1MDFA 2P2FA 2D7VA 1XMQC 4BCAA 2UU9C 1QM4A 3LGXA 1HR0C 4K0BA 2P2MA 5BSUA 3A4IA 2ZM6C 4IZ6A 2D27A 4JI7C 3RV2A 1PA4A 3DLPX 2QL8A 5IFIA 3TQIA 2YWBA 4YHHC 5BURA 2P20A 1MXAA 5A1IA 2YWCA 2D1QA 1FUGA 5BR8C 2OBVA 4MTNA 3VNRA 5CZVA 2YCBA 2QVZX 4L7IA 4R0MA 3LAXA 3J80D 4RLQA 1O93A 3ETCA 4GKJC 2UXBC 3DAYA 3S82A 1EGAA 2Y27A 4X66C 1I94C 4WV3A 1USPA 4G1IA 4D4GA 2ATWA 4PHTA 2PROA 4ZLPA 4B3RC 4BBYA 4NXMC 2PT7G 1USPB 4JV5C 2P2JA 4DCVA 1XNRC 4GKKC 1AMUA 4NXNC 3CJEA 2QVXX 5T8SA 3AF6A 3PROC 4B3SC 3J7AD 4L4QA 5KYVA 1V25A 3LNVA 3NYRA 1IBKC 4AQYC 5DV9A 1BA3A 3RG2A 4JM1A 4I9GA 1HNXC 3T1HC 3R9XA 3GPCA 1XRBA 3E7XA 1N32C 4DCUA 3B7WA 4JYAC 4DR7C 3CW9A 3R44A 4DR5C 1IBLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH C;  1MKY A;  4JI6 C;  3J81 D;  2DYJ A;  1WF3 A;  3OTO C;  1J5E C;  1WH9 A;  4DV4 C;  1JOS A;  2OPL B;  2E8F A;  4JI1 C;  4LF5 C;  4LF8 C;  2CXC A;  1KKG A;  4DV3 C;  4JI5 C;  4DV5 C;  1HNW C;  2UXD C;  2JMP A;  1ZB8 A;  5BR8 C;  4MTN A;  3JAM D;  3T1Y C;  4JI2 C;  2YCB A;  2E8C A;  4MH4 A;  4X65 C;  4B3M C;  4X64 C;  1ML8 A;  4DCT A;  3IEU A;  2BJO A;  3J80 D;  3AF5 A;  1VLA A;  1XNQ C;  4GKJ C;  2UXC C;  4DV2 C;  4LF4 C;  2ASB A;  3R9W A;  4JI8 C;  2UXB C;  1N34 C;  4B3T C;  2ONF A;  2HJG A;  1EGA A;  4DV0 C;  4DR1 C;  4X66 C;  4JI3 C;  1I94 C;  1K0R A;  5FLX D;  4K0K C;  5A2Q D;  1USP A;  4JI0 C;  3GKU A;  1N2F A;  1XMO C;  2PN2 A;  2ATW A;  2UUB C;  2F4V C;  1L2F A;  4DUZ C;  1LQL A;  4B3R C;  4LFB C;  4DCS A;  1FJG C;  4KHP C;  4NXM C;  4JI4 C;  2PT7 G;  3I07 A;  1USP B;  2EGT A;  1N33 C;  4JV5 C;  4LF6 C;  4DR4 C;  4XX2 A;  5IT9 D;  4BSZ A;  4DCV A;  4DV1 C;  3IEV A;  1XNR C;  4X62 C;  2UUA C;  4GKK C;  4DV6 C;  4NXN C;  2UUC C;  3CJE A;  4DR2 C;  2VQE C;  5IWA C;  3AF6 A;  4B3S C;  3J7A D;  1UKK A;  4DR6 C;  1QWI A;  1NYE A;  1IBM C;  5LMN C;  4NOZ A;  2VQF C;  1IBK C;  4AQY C;  4LF7 C;  4OX9 C;  4DR3 C;  2XR1 A;  2D7V A;  1XMQ C;  4LFC C;  2E7G A;  4LFA C;  3EER A;  2E5L C;  1N36 C;  2CY1 A;  2HHH C;  1HNX C;  3T1H C;  2UU9 C;  3R9X A;  4YY3 C;  4DUY C;  1HR0 C;  5LMU C;  1HH2 P;  1ZB9 A;  1N32 C;  4DCU A;  3LUS A;  2ZM6 C;  2OPL A;  4JYA C;  2KZF A;  4JI7 C;  4DR7 C;  1HNZ C;  1PA4 A;  4DV7 C;  4LF9 C;  2QL8 A;  2E8E A;  4DR5 C;  1IBL C; 
#chains in the Genus database with same CATH topology
 4FUT A;  4JI6 C;  3J81 D;  3TDE A;  4R1L A;  1ULT A;  2E8F A;  3NI2 A;  3KXW A;  4DV3 C;  3NPD A;  1XS3 A;  1YGT A;  1T5H X;  3JAM D;  1T5D X;  5ADZ A;  3LNO A;  2E8C A;  3VNS A;  5GTD A;  4X64 C;  4RVO A;  1RY2 A;  3IEU A;  4EAT A;  1XNQ C;  4OYC A;  3SO4 A;  1NY8 A;  5JRH A;  3A9U A;  4LF4 C;  3R9W A;  4JI8 C;  3E7W A;  3FCE A;  2ONF A;  1K0R A;  5FLX D;  5A2Q D;  3CQ1 A;  1PG4 A;  5BSV A;  3GKU A;  2D1S A;  1N2F A;  4RM3 A;  2UUB C;  2CU6 A;  5AE2 A;  4KTT A;  3H2T A;  2P02 A;  1P7L A;  4JI4 C;  2EGT A;  1YJ7 A;  4D56 A;  4IR7 A;  2NCL A;  5BUS A;  4DV1 C;  2QW0 X;  4BC9 A;  4X62 C;  2UUA C;  5T8T A;  4D4I A;  3AY0 A;  5E7Q A;  5IWA C;  3A9V A;  1UKK A;  4LE5 A;  4TPS B;  4I9F A;  1O90 A;  5AE3 A;  5LMN C;  4DG9 A;  2XR1 A;  4G37 A;  3EER A;  3UOW A;  2AYA A;  4PRO C;  2HHH C;  4ISB A;  4DUY C;  4GXQ A;  4FTF A;  3IPL A;  2KZ0 A;  4G36 A;  2PG1 E;  4GS5 A;  1HH2 P;  5A19 A;  3TUF A;  3LUS A;  3L95 X;  2WP0 C;  2KZF A;  2V7B A;  1GPM A;  1HNZ C;  4LF9 C;  4B3T C;  2DYJ A;  3OTO C;  1J5E C;  1MXC A;  1WH9 A;  1JOS A;  4GXR A;  4JI1 C;  4LF5 C;  4PZP A;  2D1T A;  4DV5 C;  1HNW C;  4RM2 A;  5K85 A;  1UWD A;  3T1Y C;  5AE1 A;  5K8F A;  4PUH A;  2Y4N A;  4ODJ A;  2BJO A;  2UXC C;  3UX2 A;  4ZJZ A;  2P2Q A;  1MDB A;  2JNV A;  3IML A;  3UEB A;  4RMN A;  1XHJ A;  3GR0 A;  1TH5 A;  4JI3 C;  5BUQ A;  2P2B A;  1V26 A;  3L8C A;  5H9U A;  4JI0 C;  2PN2 A;  1P4E C;  1O9T A;  1LQL A;  4DG8 A;  4LFB C;  1FJG C;  4L2Z A;  2VZE A;  2MM9 A;  3G7S A;  3I07 A;  3NYQ A;  3A26 A;  4DR4 C;  5IT9 D;  4BSZ A;  5CZX A;  1M6X C;  4BC7 A;  2UUC C;  3C5E A;  2OO4 A;  4NDN A;  4D57 A;  2D28 C;  3VNQ A;  5KYT A;  1NYE A;  3CQ2 A;  1IBM C;  3UZ0 A;  3N54 B;  4R1M A;  3CQ3 A;  4LF7 C;  5BSM A;  5BSR A;  3PES A;  4LFC C;  2E7G A;  3GR1 A;  4LFA C;  2E5L C;  1N36 C;  2CY1 A;  5BST A;  5BSW A;  4YY3 C;  1XRC A;  3FM7 A;  5LMU C;  2Y4O A;  2ZZM A;  1ZB9 A;  1XDX A;  3A25 A;  2MMA B;  2OPL A;  4PUI A;  4RVN A;  1LCI A;  4DV7 C;  2E8E A;  2M5H A;  1MKY A;  3I08 A;  1WF3 A;  3N2Q A;  4FUQ A;  4DV4 C;  2OPL B;  4LF8 C;  2CXC A;  2YX1 A;  1KKG A;  2KDN A;  3K6R A;  3DHV A;  4JI5 C;  2UXD C;  2JMP A;  1ZB8 A;  1WCJ A;  4WS9 A;  4JI2 C;  5KEI A;  4MH4 A;  4X65 C;  4B3M C;  2BH1 X;  4PUG A;  1ML8 A;  4DCT A;  2ZZN A;  2D1R A;  3AF5 A;  1VLA A;  4DV2 C;  2ASB A;  2VSQ A;  1N34 C;  3PBK A;  2HJG A;  2M5O A;  4DV0 C;  4DR1 C;  2ZTB A;  4RLF A;  4K0K C;  1XMO C;  2F4V C;  1L2F A;  5A1G A;  4DUZ C;  3TR3 A;  4DCS A;  1IB8 A;  4KHP C;  2WD9 A;  1P4E A;  1N33 C;  4LF6 C;  4XX2 A;  3IEV A;  2E0G A;  1XRA A;  1RG9 A;  4U5Y D;  1MXB A;  1V60 A;  2QVY X;  1MD9 A;  4DV6 C;  4KTV A;  3CW8 X;  4DR2 C;  2VQE C;  3ETO A;  4HPV A;  4DR6 C;  1QWI A;  2MCQ A;  1O92 A;  4OXI A;  3EQ6 A;  1PG3 A;  4NOZ A;  2VQF C;  2DPL A;  3FCC A;  4OX9 C;  4DR3 C;  1MDF A;  2P2F A;  2D7V A;  1XMQ C;  4BCA A;  3UX3 A;  2UU9 C;  1QM4 A;  3LGX A;  5LCI A;  1HR0 C;  4K0B A;  2P2M A;  5BSU A;  3A4I A;  2ZM6 C;  4IZ6 A;  2D27 A;  4JI7 C;  3RV2 A;  2DHM A;  1PA4 A;  3DLP X;  2QL8 A;  5IFI A;  3TQI A;  2YWB A;  4YHH C;  5BUR A;  2P20 A;  1MXA A;  5A1I A;  2YWC A;  2D1Q A;  1FUG A;  5BR8 C;  2OBV A;  4MTN A;  3VNR A;  5CZV A;  2YCB A;  3O2E A;  2QVZ X;  4L7I A;  4R0M A;  3LAX A;  3J80 D;  4RLQ A;  1O93 A;  3ETC A;  4GKJ C;  2UXB C;  3DAY A;  3S82 A;  1EGA A;  2Y27 A;  4X66 C;  1I94 C;  4WV3 A;  1USP A;  4G1I A;  4D4G A;  2ATW A;  4PHT A;  2PRO A;  1PU1 A;  4ZLP A;  4B3R C;  4BBY A;  4NXM C;  2PT7 G;  1USP B;  4JV5 C;  2P2J A;  4DCV A;  1XNR C;  4GKK C;  1AMU A;  4NXN C;  3CJE A;  2QVX X;  5T8S A;  3PRO C;  3AF6 A;  4B3S C;  3J7A D;  4L4Q A;  5KYV A;  1V25 A;  3LNV A;  3NYR A;  1IBK C;  4AQY C;  5DV9 A;  1FLO A;  1BA3 A;  3RG2 A;  4JM1 A;  4I9G A;  1HNX C;  3T1H C;  3R9X A;  3GPC A;  1XRB A;  1VEH A;  3E7X A;  2Z51 A;  1N32 C;  4DCU A;  3B7W A;  4JYA C;  1M6X A;  4DR7 C;  3CW9 A;  3R44 A;  4DR5 C;  1IBL C; 
#chains in the Genus database with same CATH homology
 4FUT A;  4JI6 C;  3J81 D;  3TDE A;  4R1L A;  1ULT A;  2E8F A;  3NI2 A;  3KXW A;  4DV3 C;  3NPD A;  1T5H X;  3JAM D;  1T5D X;  5ADZ A;  2E8C A;  3VNS A;  5GTD A;  4X64 C;  4RVO A;  1RY2 A;  3IEU A;  4EAT A;  1XNQ C;  4OYC A;  3SO4 A;  5JRH A;  3A9U A;  4LF4 C;  3R9W A;  4JI8 C;  3E7W A;  3FCE A;  2ONF A;  1K0R A;  5FLX D;  5A2Q D;  1PG4 A;  5BSV A;  3GKU A;  2D1S A;  1N2F A;  4RM3 A;  2UUB C;  5AE2 A;  4KTT A;  3H2T A;  2P02 A;  1P7L A;  4JI4 C;  2EGT A;  1YJ7 A;  4D56 A;  4IR7 A;  5BUS A;  4DV1 C;  2QW0 X;  4BC9 A;  4X62 C;  2UUA C;  5T8T A;  4D4I A;  5E7Q A;  5IWA C;  3A9V A;  1UKK A;  4LE5 A;  4TPS B;  4I9F A;  1O90 A;  5AE3 A;  5LMN C;  4DG9 A;  2XR1 A;  4G37 A;  3EER A;  3UOW A;  2AYA A;  4PRO C;  2HHH C;  4ISB A;  4DUY C;  4GXQ A;  4FTF A;  3IPL A;  4G36 A;  4GS5 A;  1HH2 P;  5A19 A;  3TUF A;  3LUS A;  3L95 X;  2WP0 C;  2KZF A;  2V7B A;  1GPM A;  1HNZ C;  4LF9 C;  4B3T C;  2DYJ A;  3OTO C;  1J5E C;  1MXC A;  1WH9 A;  1JOS A;  4GXR A;  4JI1 C;  4LF5 C;  4PZP A;  2D1T A;  4DV5 C;  1HNW C;  4RM2 A;  5K85 A;  3T1Y C;  5AE1 A;  5K8F A;  2Y4N A;  4ODJ A;  2BJO A;  2UXC C;  4ZJZ A;  2P2Q A;  1MDB A;  3IML A;  4RMN A;  3GR0 A;  4JI3 C;  5BUQ A;  2P2B A;  1V26 A;  3L8C A;  5H9U A;  4JI0 C;  2PN2 A;  1O9T A;  1LQL A;  4DG8 A;  4LFB C;  1FJG C;  4L2Z A;  2VZE A;  3G7S A;  3I07 A;  3NYQ A;  4DR4 C;  5IT9 D;  4BSZ A;  5CZX A;  4BC7 A;  2UUC C;  3C5E A;  2OO4 A;  4NDN A;  4D57 A;  2D28 C;  3VNQ A;  1NYE A;  5KYT A;  1IBM C;  3UZ0 A;  3N54 B;  4R1M A;  4LF7 C;  5BSM A;  5BSR A;  3PES A;  4LFC C;  2E7G A;  3GR1 A;  4LFA C;  2E5L C;  1N36 C;  2CY1 A;  5BST A;  5BSW A;  4YY3 C;  1XRC A;  5LMU C;  2Y4O A;  1ZB9 A;  2OPL A;  4RVN A;  1LCI A;  4DV7 C;  2E8E A;  1MKY A;  3I08 A;  1WF3 A;  3N2Q A;  4FUQ A;  4DV4 C;  2OPL B;  4LF8 C;  2CXC A;  1KKG A;  3DHV A;  4JI5 C;  2UXD C;  2JMP A;  1ZB8 A;  4WS9 A;  4JI2 C;  5KEI A;  4MH4 A;  4X65 C;  4B3M C;  2BH1 X;  1ML8 A;  4DCT A;  2D1R A;  3AF5 A;  1VLA A;  4DV2 C;  2ASB A;  2VSQ A;  1N34 C;  3PBK A;  2HJG A;  4DV0 C;  4DR1 C;  4RLF A;  4K0K C;  1XMO C;  2F4V C;  1L2F A;  5A1G A;  4DUZ C;  4DCS A;  4KHP C;  2WD9 A;  1N33 C;  4LF6 C;  4XX2 A;  3IEV A;  2E0G A;  1XRA A;  1RG9 A;  4U5Y D;  1MXB A;  2QVY X;  1MD9 A;  4DV6 C;  4KTV A;  3CW8 X;  4DR2 C;  2VQE C;  3ETO A;  4HPV A;  4DR6 C;  1QWI A;  1O92 A;  4OXI A;  3EQ6 A;  1PG3 A;  4NOZ A;  2VQF C;  2DPL A;  3FCC A;  4OX9 C;  4DR3 C;  1MDF A;  2P2F A;  2D7V A;  1XMQ C;  4BCA A;  2UU9 C;  1QM4 A;  3LGX A;  1HR0 C;  4K0B A;  2P2M A;  5BSU A;  3A4I A;  2ZM6 C;  4IZ6 A;  2D27 A;  4JI7 C;  3RV2 A;  1PA4 A;  3DLP X;  2QL8 A;  5IFI A;  3TQI A;  2YWB A;  4YHH C;  5BUR A;  2P20 A;  1MXA A;  5A1I A;  2YWC A;  2D1Q A;  1FUG A;  5BR8 C;  2OBV A;  4MTN A;  3VNR A;  5CZV A;  2YCB A;  2QVZ X;  4L7I A;  4R0M A;  3LAX A;  3J80 D;  4RLQ A;  1O93 A;  3ETC A;  4GKJ C;  2UXB C;  3DAY A;  3S82 A;  1EGA A;  2Y27 A;  4X66 C;  1I94 C;  4WV3 A;  1USP A;  4G1I A;  4D4G A;  2ATW A;  4PHT A;  2PRO A;  4ZLP A;  4B3R C;  4BBY A;  4NXM C;  2PT7 G;  1USP B;  4JV5 C;  2P2J A;  4DCV A;  1XNR C;  4GKK C;  1AMU A;  4NXN C;  3CJE A;  2QVX X;  5T8S A;  3AF6 A;  3PRO C;  4B3S C;  3J7A D;  4L4Q A;  5KYV A;  1V25 A;  3LNV A;  3NYR A;  1IBK C;  4AQY C;  5DV9 A;  1BA3 A;  3RG2 A;  4JM1 A;  4I9G A;  1HNX C;  3T1H C;  3R9X A;  3GPC A;  1XRB A;  3E7X A;  1N32 C;  4DCU A;  3B7W A;  4JYA C;  4DR7 C;  3CW9 A;  3R44 A;  4DR5 C;  1IBL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...