3J80D

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
223
Chain Sequence
AIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRATKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHSGQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKALPDAVTIIEPKEEEPVLEPSVKDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 44
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
D PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3j80D01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3j80D02
3J81D 4DCSA 4LFCC 3IEVA 2EGTA 1USPB 2ATWA 2E7GA 4YHHC 2D7VA 4LF8C 2E8CA 4DV6C 4DUYC 2BJOA 4LF6C 1KKGA 4YY3C 5IT9D 4X65C 4JI6C 2KZFA 5IWAC 5A2QD 1JOSA 1HNXC 4OX9C 4JI8C 4DCTA 2VQEC 4B3SC 4DV2C 4JI1C 1I94C 2ASBA 2UXDC 5FLXD 4DR5C 2UUCC 2ONFA 1XMQC 3IEUA 1L2FA 5LMUC 4JI5C 2UUBC 4DUZC 1ML8A 2UXCC 2F4VC 4JI3C 1UKKA 4NXMC 1HNWC 4DR2C 1XNQC 1IBMC 2PN2A 4NOZA 1N33C 3T1HC 2HHHC 1N2FA 3T1YC 2E8FA 4B3TC 1IBKC 3R9XA 4KHPC 1ZB9A 4JI7C 4LFBC 2ZM6C 3GKUA 4DR1C 2YCBA 2JMPA 2HJGA 4X66C 4DV1C 4GKJC 4DR6C 4X62C 2E8EA 1XNRC 4DCUA 5BR8C 1IBLC 2OPLA 4X64C 4DR3C 4DR4C 4BSZA 2DYJA 1K0RA 2UU9C 4DV4C 4MH4A 1PA4A 2CY1A 4DV7C 3LUSA 4DR7C 5LMNC 4LF5C 1VLAA 2QL8A 4MTNA 1USPA 1LQLA 4JV5C 4AQYC 1HR0C 4K0KC 4B3MC 2OPLB 4XX2A 3OTOC 3EERA 4DV3C 2UXBC 4LF4C 3AF6A 1WF3A 4B3RC 4JYAC 1MKYA 3CJEA 2VQFC 1EGAA 1NYEA 1N36C 1XMOC 4LFAC 1HNZC 4GKKC 1HH2P 3JAMD 4NXNC 3J7AD 2XR1A 1ZB8A 4LF9C 1N32C 2UUAC 4JI0C 4LF7C 4DV0C 1N34C 4DCVA 2E5LC 1WH9A 3I07A 4JI4C 3R9WA 1QWIA 2CXCA 2PT7G 3J80D 3AF5A 1J5EC 1FJGC 4JI2C 4DV5C
chains in the Genus database with same CATH superfamily
3GR0A 4DCSA 4LFCC 4NDNA 1USPB 2D7VA 3LNOA 4DV6C 2D1TA 1YJ7A 3PROC 2BJOA 2Z51A 2CU6A 4JI6C 4JI8C 3TQIA 4JI1C 3N2QA 3CW9A 4OYCA 2P2QA 2UUCC 3RG2A 4G37A 1XMQC 3IEUA 3A26A 5LMUC 4R1MA 2P2JA 4JI3C 2D1SA 4DR2C 1XNQC 2PN2A 4NOZA 4D57A 2HHHC 2E8FA 4B3TC 4BBYA 2ZM6C 3FM7A 1VEHA 4KTTA 3GKUA 5AE2A 4X66C 4GKJC 1MXAA 2P2MA 1MDBA 1XRAA 1IB8A 5T8TA 4DR3C 3VNRA 4DR4C 4BC7A 4JM1A 4DV4C 4LE5A 2CY1A 3UZ0A 4DR7C 5LMNC 2JNVA 5CZXA 5KEIA 4EATA 3UX3A 5T8SA 1USPA 1LQLA 3KXWA 2Y4OA 4B3MC 3B7WA 4HPVA 3OTOC 3EERA 3VNSA 3TUFA 2V7BA 1N36C 3LGXA 3VNQA 4GKKC 1O9TA 3JAMD 3FCCA 2WD9A 5JRHA 2VZEA 4RVOA 2PG1E 3ETCA 1N34C 4OXIA 2CXCA 3DLPX 2PT7G 3E7WA 4RLQA 4DV5C 1PG4A 3J81D 4G1IA 1P4EC 2ATWA 3H2TA 4FUQA 2M5HA 1MXCA 3N54B 1O93A 1KKGA 1V25A 4YY3C 4X65C 5A2QD 2VQEC 4B3SC 1AMUA 2D1RA 1RG9A 1I94C 3CQ2A 4PUIA 1MXBA 4DR5C 2ONFA 3PBKA 4JI5C 1MD9A 2UXCC 3SO4A 4NXMC 1HNWC 3IPLA 1IBMC 4RM3A 4KHPC 4KTVA 5A19A 2DHMA 2HJGA 4RMNA 2P02A 5ADZA 1QM4A 3RV2A 4GS5A 2QW0X 2QVYX 1M6XC 2DYJA 2QVXX 4DV7C 4D56A 1GPMA 2DPLA 2P20A 1V26A 3L8CA 5LCIA 3K6RA 2ZTBA 4PUGA 1ULTA 4R0MA 2MMAB 3AF6A 1WF3A 4B3RC 3CJEA 4PROC 1NYEA 2VSQA 1V60A 1PG3A 3NYQA 4LFAC 4NXNC 1ZB8A 1N32C 4K0BA 3S82A 4DG8A 5H9UA 3CQ3A 4DV0C 3I07A 4JI4C 4PHTA 2OBVA 3NI2A 3J80D 1J5EC 2E0GA 4JI2C 4FTFA 4IR7A 5BUQA 1BA3A 3CW8X 3IEVA 5BSTA 4RVNA 4YHHC 4LF8C 2YX1A 5IT9D 2ZZMA 2P2BA 4L7IA 1HNXC 4DCTA 2ASBA 1FLOA 5A1IA 5FLXD 5A1GA 5KYVA 5K85A 2UUBC 3FCEA 4DUZC 2WP0C 1UKKA 3CQ1A 1NY8A 1LCIA 3T1HC 2KDNA 1ZB9A 4JI7C 2YCBA 1MDFA 2JMPA 4D4GA 5KYTA 3PESA 2QVZX 1T5DX 3ETOA 4IZ6A 5BSVA 4X62C 4DR6C 3A9UA 2E8EA 5BSMA 5AE3A 5BSUA 5BR8C 1IBLC 4X64C 2PROA 2MCQA 5DV9A 4ZLPA 5GTDA 4MH4A 1XRBA 4D4IA 4I9FA 1T5HX 3UOWA 5IFIA 4MTNA 2P2FA 4JV5C 1M6XA 4ISBA 3E7XA 4G36A 3UEBA 2ZZNA 4L4QA 1HR0C 4PUHA 5BSRA 4K0KC 4ZJZA 2OPLB 2OO4A 4XX2A 4TPSB 4LF4C 4JYAC 1MKYA 1EGAA 1P4EA 2NCLA 5E7QA 2XR1A 2D27A 4LF7C 2D28C 3AY0A 1WH9A 3O2EA 4BCAA 1UWDA 3LNVA 3TDEA 3NYRA 1YGTA 3G7SA 2Y27A 4L2ZA 2MM9A 1WCJA 4WV3A 2YWCA 2EGTA 4I9GA 2E7GA 1RY2A 3NPDA 2E8CA 2YWBA 4DUYC 4LF6C 3GR1A 4RM2A 5CZVA 3TR3A 1O92A 2KZFA 5IWAC 4OX9C 1JOSA 5BURA 4DV2C 3UX2A 2UXDC 1O90A 4BC9A 1L2FA 5AE1A 2M5OA 3A25A 1ML8A 3GPCA 2F4VC 5K8FA 3A4IA 4U5YD 1N33C 1XS3A 1N2FA 3T1YC 4GXQA 1IBKC 3R9XA 4LFBC 4DR1C 3EQ6A 4R1LA 2AYAA 4GXRA 1FUGA 4DV1C 2KZ0A 1XNRC 4DCUA 2OPLA 3DAYA 4BSZA 5BUSA 1K0RA 2UU9C 1XHJA 5BSWA 1PA4A 3LUSA 2BH1X 4RLFA 3LAXA 4LF5C 3A9VA 1VLAA 3IMLA 1TH5A 3C5EA 1PU1A 2QL8A 4WS9A 1P7LA 4AQYC 2Y4NA 3R44A 1XRCA 4DV3C 2UXBC 4FUTA 4PZPA 3I08A 2VQFC 1XDXA 1XMOC 1HNZC 1HH2P 3J7AD 3DHVA 4ODJA 4LF9C 2UUAC 4JI0C 2D1QA 4DCVA 2E5LC 3R9WA 3L95X 1QWIA 3AF5A 1FJGC 4DG9A
chains in the Genus database with same CATH topology
3GR0A 4DCSA 4LFCC 4NDNA 1USPB 2D7VA 4DV6C 2D1TA 1YJ7A 3PROC 2BJOA 4JI6C 4JI8C 3TQIA 4JI1C 3N2QA 3CW9A 4OYCA 2P2QA 2UUCC 3RG2A 4G37A 1XMQC 3IEUA 5LMUC 4R1MA 2P2JA 4JI3C 2D1SA 4DR2C 1XNQC 2PN2A 4NOZA 4D57A 2HHHC 2E8FA 4B3TC 4BBYA 2ZM6C 4KTTA 5AE2A 3GKUA 4X66C 4GKJC 1MXAA 2P2MA 1MDBA 1XRAA 5T8TA 4DR3C 3VNRA 4DR4C 4BC7A 4JM1A 4DV4C 4LE5A 2CY1A 3UZ0A 4DR7C 5LMNC 5CZXA 5KEIA 4EATA 5T8SA 1USPA 1LQLA 3KXWA 2Y4OA 4B3MC 3B7WA 4HPVA 3OTOC 3EERA 3VNSA 3TUFA 2V7BA 1N36C 3LGXA 3VNQA 4GKKC 1O9TA 3JAMD 3FCCA 2WD9A 5JRHA 2VZEA 4RVOA 3ETCA 1N34C 4OXIA 2CXCA 3DLPX 2PT7G 3E7WA 4RLQA 4DV5C 1PG4A 3J81D 4G1IA 2ATWA 3H2TA 4FUQA 1MXCA 3N54B 1O93A 1KKGA 1V25A 4YY3C 4X65C 5A2QD 2VQEC 4B3SC 1AMUA 2D1RA 1RG9A 1I94C 1MXBA 4DR5C 2ONFA 3PBKA 4JI5C 1MD9A 2UXCC 3SO4A 4NXMC 1HNWC 3IPLA 1IBMC 4RM3A 4KHPC 4KTVA 5A19A 2HJGA 4RMNA 2P02A 5ADZA 1QM4A 3RV2A 4GS5A 2QW0X 2QVYX 2DYJA 2QVXX 4DV7C 4D56A 1GPMA 2DPLA 2P20A 1V26A 3L8CA 1ULTA 4R0MA 3AF6A 1WF3A 4B3RC 3CJEA 4PROC 1NYEA 2VSQA 1PG3A 3NYQA 4LFAC 4NXNC 1ZB8A 1N32C 4K0BA 3S82A 4DG8A 5H9UA 4DV0C 3I07A 4JI4C 4PHTA 2OBVA 3NI2A 3J80D 1J5EC 2E0GA 4JI2C 4FTFA 4IR7A 5BUQA 1BA3A 3CW8X 3IEVA 5BSTA 4RVNA 4YHHC 4LF8C 5IT9D 2P2BA 4L7IA 1HNXC 4DCTA 2ASBA 5A1IA 5FLXD 5A1GA 5KYVA 5K85A 2UUBC 3FCEA 4DUZC 2WP0C 1UKKA 1LCIA 3T1HC 1ZB9A 4JI7C 2YCBA 1MDFA 2JMPA 4D4GA 5KYTA 3PESA 2QVZX 1T5DX 3ETOA 4IZ6A 5BSVA 4X62C 4DR6C 3A9UA 2E8EA 5BSMA 5AE3A 5BSUA 5BR8C 1IBLC 4X64C 2PROA 5DV9A 4ZLPA 4MH4A 5GTDA 1XRBA 4D4IA 4I9FA 1T5HX 3UOWA 5IFIA 4MTNA 2P2FA 4JV5C 4ISBA 3E7XA 4G36A 4L4QA 1HR0C 5BSRA 4K0KC 4ZJZA 2OPLB 2OO4A 4XX2A 4TPSB 4LF4C 4JYAC 1MKYA 1EGAA 5E7QA 2XR1A 2D27A 4LF7C 2D28C 1WH9A 4BCAA 3LNVA 3TDEA 3NYRA 3G7SA 2Y27A 4L2ZA 4WV3A 2YWCA 2EGTA 4I9GA 2E7GA 1RY2A 3NPDA 2E8CA 2YWBA 4DUYC 4LF6C 3GR1A 4RM2A 5CZVA 1O92A 2KZFA 5IWAC 4OX9C 1JOSA 5BURA 4DV2C 2UXDC 1O90A 4BC9A 1L2FA 5AE1A 1ML8A 3GPCA 2F4VC 5K8FA 3A4IA 4U5YD 1N33C 1N2FA 3T1YC 4GXQA 1IBKC 3R9XA 4LFBC 4DR1C 3EQ6A 4R1LA 2AYAA 4GXRA 1FUGA 4DV1C 1XNRC 4DCUA 2OPLA 3DAYA 4BSZA 5BUSA 2UU9C 1K0RA 5BSWA 1PA4A 3LUSA 2BH1X 4RLFA 3LAXA 4LF5C 3A9VA 1VLAA 3IMLA 3C5EA 2QL8A 4WS9A 1P7LA 4AQYC 2Y4NA 3R44A 1XRCA 4DV3C 2UXBC 4FUTA 4PZPA 3I08A 2VQFC 1XMOC 1HNZC 1HH2P 3J7AD 3DHVA 4ODJA 4LF9C 2UUAC 4JI0C 2D1QA 4DCVA 2E5LC 3R9WA 3L95X 1QWIA 3AF5A 1FJGC 4DG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 D;  4DCS A;  4LFC C;  3IEV A;  2EGT A;  1USP B;  2ATW A;  2E7G A;  4YHH C;  2D7V A;  4LF8 C;  2E8C A;  4DV6 C;  4DUY C;  2BJO A;  4LF6 C;  1KKG A;  4YY3 C;  5IT9 D;  4X65 C;  4JI6 C;  2KZF A;  5IWA C;  5A2Q D;  1JOS A;  1HNX C;  4OX9 C;  4JI8 C;  4DCT A;  2VQE C;  4B3S C;  4DV2 C;  4JI1 C;  1I94 C;  2ASB A;  2UXD C;  5FLX D;  4DR5 C;  2UUC C;  2ONF A;  1XMQ C;  3IEU A;  1L2F A;  5LMU C;  4JI5 C;  2UUB C;  4DUZ C;  1ML8 A;  2UXC C;  2F4V C;  4JI3 C;  1UKK A;  4NXM C;  1HNW C;  4DR2 C;  1XNQ C;  1IBM C;  2PN2 A;  4NOZ A;  1N33 C;  3T1H C;  2HHH C;  1N2F A;  3T1Y C;  2E8F A;  4B3T C;  1IBK C;  3R9X A;  4KHP C;  1ZB9 A;  4JI7 C;  4LFB C;  2ZM6 C;  3GKU A;  4DR1 C;  2YCB A;  2JMP A;  2HJG A;  4X66 C;  4DV1 C;  4GKJ C;  4DR6 C;  4X62 C;  2E8E A;  1XNR C;  4DCU A;  5BR8 C;  1IBL C;  2OPL A;  4X64 C;  4DR3 C;  4DR4 C;  4BSZ A;  2DYJ A;  1K0R A;  2UU9 C;  4DV4 C;  4MH4 A;  1PA4 A;  2CY1 A;  4DV7 C;  3LUS A;  4DR7 C;  5LMN C;  4LF5 C;  1VLA A;  2QL8 A;  4MTN A;  1USP A;  1LQL A;  4JV5 C;  4AQY C;  1HR0 C;  4K0K C;  4B3M C;  2OPL B;  4XX2 A;  3OTO C;  3EER A;  4DV3 C;  2UXB C;  4LF4 C;  3AF6 A;  1WF3 A;  4B3R C;  4JYA C;  1MKY A;  3CJE A;  2VQF C;  1EGA A;  1NYE A;  1N36 C;  1XMO C;  4LFA C;  1HNZ C;  4GKK C;  1HH2 P;  3JAM D;  4NXN C;  3J7A D;  2XR1 A;  1ZB8 A;  4LF9 C;  1N32 C;  2UUA C;  4JI0 C;  4LF7 C;  4DV0 C;  1N34 C;  4DCV A;  2E5L C;  1WH9 A;  3I07 A;  4JI4 C;  3R9W A;  1QWI A;  2CXC A;  2PT7 G;  3J80 D;  3AF5 A;  1J5E C;  1FJG C;  4JI2 C;  4DV5 C; 
#chains in the Genus database with same CATH topology
 3GR0 A;  4DCS A;  4LFC C;  4NDN A;  1USP B;  2D7V A;  3LNO A;  4DV6 C;  2D1T A;  1YJ7 A;  3PRO C;  2BJO A;  2Z51 A;  2CU6 A;  4JI6 C;  4JI8 C;  3TQI A;  4JI1 C;  3N2Q A;  3CW9 A;  4OYC A;  2P2Q A;  2UUC C;  3RG2 A;  4G37 A;  1XMQ C;  3IEU A;  3A26 A;  5LMU C;  4R1M A;  2P2J A;  4JI3 C;  2D1S A;  4DR2 C;  1XNQ C;  2PN2 A;  4NOZ A;  4D57 A;  2HHH C;  2E8F A;  4B3T C;  4BBY A;  2ZM6 C;  3FM7 A;  1VEH A;  4KTT A;  3GKU A;  5AE2 A;  4X66 C;  4GKJ C;  1MXA A;  2P2M A;  1MDB A;  1XRA A;  1IB8 A;  5T8T A;  4DR3 C;  3VNR A;  4DR4 C;  4BC7 A;  4JM1 A;  4DV4 C;  4LE5 A;  2CY1 A;  3UZ0 A;  4DR7 C;  5LMN C;  2JNV A;  5CZX A;  5KEI A;  4EAT A;  3UX3 A;  5T8S A;  1USP A;  1LQL A;  3KXW A;  2Y4O A;  4B3M C;  3B7W A;  4HPV A;  3OTO C;  3EER A;  3VNS A;  3TUF A;  2V7B A;  1N36 C;  3LGX A;  3VNQ A;  4GKK C;  1O9T A;  3JAM D;  3FCC A;  2WD9 A;  5JRH A;  2VZE A;  4RVO A;  2PG1 E;  3ETC A;  1N34 C;  4OXI A;  2CXC A;  3DLP X;  2PT7 G;  3E7W A;  4RLQ A;  4DV5 C;  1PG4 A;  3J81 D;  4G1I A;  1P4E C;  2ATW A;  3H2T A;  4FUQ A;  2M5H A;  1MXC A;  3N54 B;  1O93 A;  1KKG A;  1V25 A;  4YY3 C;  4X65 C;  5A2Q D;  2VQE C;  4B3S C;  1AMU A;  2D1R A;  1RG9 A;  1I94 C;  3CQ2 A;  4PUI A;  1MXB A;  4DR5 C;  2ONF A;  3PBK A;  4JI5 C;  1MD9 A;  2UXC C;  3SO4 A;  4NXM C;  1HNW C;  3IPL A;  1IBM C;  4RM3 A;  4KHP C;  4KTV A;  5A19 A;  2DHM A;  2HJG A;  4RMN A;  2P02 A;  5ADZ A;  1QM4 A;  3RV2 A;  4GS5 A;  2QW0 X;  2QVY X;  1M6X C;  2DYJ A;  2QVX X;  4DV7 C;  4D56 A;  1GPM A;  2DPL A;  2P20 A;  1V26 A;  3L8C A;  5LCI A;  3K6R A;  2ZTB A;  4PUG A;  1ULT A;  4R0M A;  2MMA B;  3AF6 A;  1WF3 A;  4B3R C;  3CJE A;  4PRO C;  1NYE A;  2VSQ A;  1V60 A;  1PG3 A;  3NYQ A;  4LFA C;  4NXN C;  1ZB8 A;  1N32 C;  4K0B A;  3S82 A;  4DG8 A;  5H9U A;  3CQ3 A;  4DV0 C;  3I07 A;  4JI4 C;  4PHT A;  2OBV A;  3NI2 A;  3J80 D;  1J5E C;  2E0G A;  4JI2 C;  4FTF A;  4IR7 A;  5BUQ A;  1BA3 A;  3CW8 X;  3IEV A;  5BST A;  4RVN A;  4YHH C;  4LF8 C;  2YX1 A;  5IT9 D;  2ZZM A;  2P2B A;  4L7I A;  1HNX C;  4DCT A;  2ASB A;  1FLO A;  5A1I A;  5FLX D;  5A1G A;  5KYV A;  5K85 A;  2UUB C;  3FCE A;  4DUZ C;  2WP0 C;  1UKK A;  3CQ1 A;  1NY8 A;  1LCI A;  3T1H C;  2KDN A;  1ZB9 A;  4JI7 C;  2YCB A;  1MDF A;  2JMP A;  4D4G A;  5KYT A;  3PES A;  2QVZ X;  1T5D X;  3ETO A;  4IZ6 A;  5BSV A;  4X62 C;  4DR6 C;  3A9U A;  2E8E A;  5BSM A;  5AE3 A;  5BSU A;  5BR8 C;  1IBL C;  4X64 C;  2PRO A;  2MCQ A;  5DV9 A;  4ZLP A;  5GTD A;  4MH4 A;  1XRB A;  4D4I A;  4I9F A;  1T5H X;  3UOW A;  5IFI A;  4MTN A;  2P2F A;  4JV5 C;  1M6X A;  4ISB A;  3E7X A;  4G36 A;  3UEB A;  2ZZN A;  4L4Q A;  1HR0 C;  4PUH A;  5BSR A;  4K0K C;  4ZJZ A;  2OPL B;  2OO4 A;  4XX2 A;  4TPS B;  4LF4 C;  4JYA C;  1MKY A;  1EGA A;  1P4E A;  2NCL A;  5E7Q A;  2XR1 A;  2D27 A;  4LF7 C;  2D28 C;  3AY0 A;  1WH9 A;  3O2E A;  4BCA A;  1UWD A;  3LNV A;  3TDE A;  3NYR A;  1YGT A;  3G7S A;  2Y27 A;  4L2Z A;  2MM9 A;  1WCJ A;  4WV3 A;  2YWC A;  2EGT A;  4I9G A;  2E7G A;  1RY2 A;  3NPD A;  2E8C A;  2YWB A;  4DUY C;  4LF6 C;  3GR1 A;  4RM2 A;  5CZV A;  3TR3 A;  1O92 A;  2KZF A;  5IWA C;  4OX9 C;  1JOS A;  5BUR A;  4DV2 C;  3UX2 A;  2UXD C;  1O90 A;  4BC9 A;  1L2F A;  5AE1 A;  2M5O A;  3A25 A;  1ML8 A;  3GPC A;  2F4V C;  5K8F A;  3A4I A;  4U5Y D;  1N33 C;  1XS3 A;  1N2F A;  3T1Y C;  4GXQ A;  1IBK C;  3R9X A;  4LFB C;  4DR1 C;  3EQ6 A;  4R1L A;  2AYA A;  4GXR A;  1FUG A;  4DV1 C;  2KZ0 A;  1XNR C;  4DCU A;  2OPL A;  3DAY A;  4BSZ A;  5BUS A;  1K0R A;  2UU9 C;  1XHJ A;  5BSW A;  1PA4 A;  3LUS A;  2BH1 X;  4RLF A;  3LAX A;  4LF5 C;  3A9V A;  1VLA A;  3IML A;  1TH5 A;  3C5E A;  1PU1 A;  2QL8 A;  4WS9 A;  1P7L A;  4AQY C;  2Y4N A;  3R44 A;  1XRC A;  4DV3 C;  2UXB C;  4FUT A;  4PZP A;  3I08 A;  2VQF C;  1XDX A;  1XMO C;  1HNZ C;  1HH2 P;  3J7A D;  3DHV A;  4ODJ A;  4LF9 C;  2UUA C;  4JI0 C;  2D1Q A;  4DCV A;  2E5L C;  3R9W A;  3L95 X;  1QWI A;  3AF5 A;  1FJG C;  4DG9 A; 
#chains in the Genus database with same CATH homology
 3GR0 A;  4DCS A;  4LFC C;  4NDN A;  1USP B;  2D7V A;  4DV6 C;  2D1T A;  1YJ7 A;  3PRO C;  2BJO A;  4JI6 C;  4JI8 C;  3TQI A;  4JI1 C;  3N2Q A;  3CW9 A;  4OYC A;  2P2Q A;  2UUC C;  3RG2 A;  4G37 A;  1XMQ C;  3IEU A;  5LMU C;  4R1M A;  2P2J A;  4JI3 C;  2D1S A;  4DR2 C;  1XNQ C;  2PN2 A;  4NOZ A;  4D57 A;  2HHH C;  2E8F A;  4B3T C;  4BBY A;  2ZM6 C;  4KTT A;  5AE2 A;  3GKU A;  4X66 C;  4GKJ C;  1MXA A;  2P2M A;  1MDB A;  1XRA A;  5T8T A;  4DR3 C;  3VNR A;  4DR4 C;  4BC7 A;  4JM1 A;  4DV4 C;  4LE5 A;  2CY1 A;  3UZ0 A;  4DR7 C;  5LMN C;  5CZX A;  5KEI A;  4EAT A;  5T8S A;  1USP A;  1LQL A;  3KXW A;  2Y4O A;  4B3M C;  3B7W A;  4HPV A;  3OTO C;  3EER A;  3VNS A;  3TUF A;  2V7B A;  1N36 C;  3LGX A;  3VNQ A;  4GKK C;  1O9T A;  3JAM D;  3FCC A;  2WD9 A;  5JRH A;  2VZE A;  4RVO A;  3ETC A;  1N34 C;  4OXI A;  2CXC A;  3DLP X;  2PT7 G;  3E7W A;  4RLQ A;  4DV5 C;  1PG4 A;  3J81 D;  4G1I A;  2ATW A;  3H2T A;  4FUQ A;  1MXC A;  3N54 B;  1O93 A;  1KKG A;  1V25 A;  4YY3 C;  4X65 C;  5A2Q D;  2VQE C;  4B3S C;  1AMU A;  2D1R A;  1RG9 A;  1I94 C;  1MXB A;  4DR5 C;  2ONF A;  3PBK A;  4JI5 C;  1MD9 A;  2UXC C;  3SO4 A;  4NXM C;  1HNW C;  3IPL A;  1IBM C;  4RM3 A;  4KHP C;  4KTV A;  5A19 A;  2HJG A;  4RMN A;  2P02 A;  5ADZ A;  1QM4 A;  3RV2 A;  4GS5 A;  2QW0 X;  2QVY X;  2DYJ A;  2QVX X;  4DV7 C;  4D56 A;  1GPM A;  2DPL A;  2P20 A;  1V26 A;  3L8C A;  1ULT A;  4R0M A;  3AF6 A;  1WF3 A;  4B3R C;  3CJE A;  4PRO C;  1NYE A;  2VSQ A;  1PG3 A;  3NYQ A;  4LFA C;  4NXN C;  1ZB8 A;  1N32 C;  4K0B A;  3S82 A;  4DG8 A;  5H9U A;  4DV0 C;  3I07 A;  4JI4 C;  4PHT A;  2OBV A;  3NI2 A;  3J80 D;  1J5E C;  2E0G A;  4JI2 C;  4FTF A;  4IR7 A;  5BUQ A;  1BA3 A;  3CW8 X;  3IEV A;  5BST A;  4RVN A;  4YHH C;  4LF8 C;  5IT9 D;  2P2B A;  4L7I A;  1HNX C;  4DCT A;  2ASB A;  5A1I A;  5FLX D;  5A1G A;  5KYV A;  5K85 A;  2UUB C;  3FCE A;  4DUZ C;  2WP0 C;  1UKK A;  1LCI A;  3T1H C;  1ZB9 A;  4JI7 C;  2YCB A;  1MDF A;  2JMP A;  4D4G A;  5KYT A;  3PES A;  2QVZ X;  1T5D X;  3ETO A;  4IZ6 A;  5BSV A;  4X62 C;  4DR6 C;  3A9U A;  2E8E A;  5BSM A;  5AE3 A;  5BSU A;  5BR8 C;  1IBL C;  4X64 C;  2PRO A;  5DV9 A;  4ZLP A;  4MH4 A;  5GTD A;  1XRB A;  4D4I A;  4I9F A;  1T5H X;  3UOW A;  5IFI A;  4MTN A;  2P2F A;  4JV5 C;  4ISB A;  3E7X A;  4G36 A;  4L4Q A;  1HR0 C;  5BSR A;  4K0K C;  4ZJZ A;  2OPL B;  2OO4 A;  4XX2 A;  4TPS B;  4LF4 C;  4JYA C;  1MKY A;  1EGA A;  5E7Q A;  2XR1 A;  2D27 A;  4LF7 C;  2D28 C;  1WH9 A;  4BCA A;  3LNV A;  3TDE A;  3NYR A;  3G7S A;  2Y27 A;  4L2Z A;  4WV3 A;  2YWC A;  2EGT A;  4I9G A;  2E7G A;  1RY2 A;  3NPD A;  2E8C A;  2YWB A;  4DUY C;  4LF6 C;  3GR1 A;  4RM2 A;  5CZV A;  1O92 A;  2KZF A;  5IWA C;  4OX9 C;  1JOS A;  5BUR A;  4DV2 C;  2UXD C;  1O90 A;  4BC9 A;  1L2F A;  5AE1 A;  1ML8 A;  3GPC A;  2F4V C;  5K8F A;  3A4I A;  4U5Y D;  1N33 C;  1N2F A;  3T1Y C;  4GXQ A;  1IBK C;  3R9X A;  4LFB C;  4DR1 C;  3EQ6 A;  4R1L A;  2AYA A;  4GXR A;  1FUG A;  4DV1 C;  1XNR C;  4DCU A;  2OPL A;  3DAY A;  4BSZ A;  5BUS A;  2UU9 C;  1K0R A;  5BSW A;  1PA4 A;  3LUS A;  2BH1 X;  4RLF A;  3LAX A;  4LF5 C;  3A9V A;  1VLA A;  3IML A;  3C5E A;  2QL8 A;  4WS9 A;  1P7L A;  4AQY C;  2Y4N A;  3R44 A;  1XRC A;  4DV3 C;  2UXB C;  4FUT A;  4PZP A;  3I08 A;  2VQF C;  1XMO C;  1HNZ C;  1HH2 P;  3J7A D;  3DHV A;  4ODJ A;  4LF9 C;  2UUA C;  4JI0 C;  2D1Q A;  4DCV A;  2E5L C;  3R9W A;  3L95 X;  1QWI A;  3AF5 A;  1FJG C;  4DG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...