3J80D

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
223
Chain Sequence
AIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRATKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHSGQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKALPDAVTIIEPKEEEPVLEPSVKDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 44
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
D PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3j80D01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3j80D02
4JI8C 1XNRC 4NXNC 3JAMD 3AF6A 4B3RC 4JYAC 2ONFA 4DCUA 2ASBA 1N36C 4DUYC 4DR4C 1UKKA 4X64C 4JV5C 2QL8A 3OTOC 1IBMC 4JI7C 2UXBC 2HHHC 5IWAC 2E8EA 2CXCA 1WH9A 4YHHC 1USPB 2VQEC 2ATWA 1ZB9A 4LFBC 4DV2C 3I07A 1WF3A 4X66C 1VLAA 4B3SC 4JI0C 4DR3C 3EERA 1N34C 1HH2P 4DV5C 5A2QD 4LF5C 4DV1C 2OPLB 4DCTA 3GKUA 1USPA 4K0KC 3IEVA 4BSZA 4X62C 1NYEA 2E7GA 4B3MC 4DR6C 2D7VA 2KZFA 4LF9C 1JOSA 4JI2C 1ML8A 1K0RA 4JI4C 4DR2C 1XNQC 4DV3C 3R9XA 1LQLA 3R9WA 2OPLA 4LF8C 2E8CA 4LFAC 4JI1C 1L2FA 4OX9C 3J80D 2HJGA 1ZB8A 5FLXD 4AQYC 1XMQC 4DCSA 4GKJC 4XX2A 4DV7C 1PA4A 5BR8C 1N33C 3AF5A 2UUAC 1HR0C 2VQFC 4NXMC 2E8FA 4DR1C 1XMOC 3LUSA 4X65C 3T1HC 1J5EC 1FJGC 4GKKC 2F4VC 1N32C 4DV6C 4B3TC 1N2FA 2UUCC 1HNXC 4DR5C 1IBLC 2UXCC 4MH4A 4DR7C 3J81D 3T1YC 2YCBA 2XR1A 4DUZC 2JMPA 2CY1A 2BJOA 4JI3C 1HNZC 3J7AD 4LFCC 5IT9D 4DV0C 4YY3C 2E5LC 5LMNC 4KHPC 2PT7G 5LMUC 1QWIA 4DV4C 3CJEA 4DCVA 2PN2A 1EGAA 2ZM6C 4LF4C 4LF6C 4JI6C 4JI5C 1IBKC 1KKGA 4MTNA 1HNWC 2UXDC 2DYJA 1MKYA 2UU9C 4LF7C 2UUBC 1I94C 3IEUA 2EGTA 4NOZA
chains in the Genus database with same CATH superfamily
3N2QA 4NXNC 1PG4A 1MDFA 4DCUA 2ASBA 1N36C 4DR4C 5BUQA 5JRHA 2QL8A 4JI7C 1IBMC 4RLQA 2HHHC 2VZEA 5IWAC 1WH9A 2CU6A 4YHHC 2ATWA 1ZB9A 2D1TA 3CW8X 1V60A 4D4IA 5BURA 3AY0A 2QW0X 3EERA 3LNVA 2MMAB 4DCTA 3A25A 2MCQA 2QVYX 4IZ6A 5BSRA 4BC7A 3IEVA 4PUGA 3TR3A 5K85A 2KZFA 4JI2C 1AMUA 4D4GA 4FUTA 1O92A 4DV3C 1LQLA 5KYVA 4LF8C 2NCLA 4L4QA 4OX9C 2HJGA 3A9VA 4BC9A 4DV7C 4PUIA 2D1RA 2YWCA 1XRBA 5BSUA 1M6XA 2AYAA 1T5HX 3RV2A 1J5EC 1FJGC 4ZLPA 1N2FA 2UUCC 3N54B 4RVNA 1IBLC 4MH4A 1XRAA 1YGTA 3T1YC 2YCBA 1RY2A 3K6RA 2BJOA 3UEBA 3FM7A 3J7AD 3FCCA 3L8CA 3TUFA 5LMUC 4U5YD 5A1IA 1ULTA 3CJEA 3UX3A 4HPVA 4DCVA 4R0MA 1EGAA 4LF4C 1BA3A 1XRCA 4G37A 2UXDC 2DYJA 3R44A 4LF7C 2Z51A 3GPCA 5AE2A 2UUBC 1YJ7A 4NOZA 1XHJA 2Y4OA 4B3RC 5CZVA 1UKKA 1QM4A 5H9UA 4JV5C 2E0GA 3OTOC 3ETCA 5CZXA 5GTDA 2DPLA 1FUGA 4PZPA 3DHVA 4LFBC 4GXRA 2YWBA 1VLAA 2OO4A 3TDEA 4DR3C 2DHMA 5A2QD 4DV1C 2OPLB 2PROA 4PROC 1P7LA 3VNSA 3LAXA 4OYCA 4GXQA 1JOSA 5K8FA 1K0RA 4DR2C 1O9TA 2OPLA 3ETOA 1L2FA 2D28C 1XMQC 1P4EC 3EQ6A 4GKJC 1PA4A 5BR8C 1O93A 5DV9A 2UUAC 3C5EA 3O2EA 4NXMC 2VQFC 4X65C 3T1HC 4RM2A 5LCIA 4GKKC 2F4VC 1N32C 4B3TC 4L2ZA 3A4IA 1MDBA 3RG2A 4DR5C 2UXCC 3J81D 2MM9A 4JM1A 2XR1A 5AE3A 2JMPA 1IB8A 5BSTA 2YX1A 4YY3C 2E5LC 2KZ0A 5BSWA 2PT7G 1T5DX 4DV4C 3SO4A 2PN2A 4LF6C 5A1GA 1IBKC 1MXAA 3DAYA 4BCAA 3VNRA 3IMLA 4JI8C 2JNVA 3PESA 3AF6A 4JYAC 2ONFA 1V26A 5BSMA 3B7WA 5ADZA 4DUYC 4R1MA 2UXBC 3I08A 1XS3A 2E8EA 3UOWA 2CXCA 3UZ0A 4RVOA 2WD9A 1WF3A 2P2JA 1N34C 3FCEA 1HH2P 4DV5C 2KDNA 2ZZMA 4LF5C 2P2MA 3S82A 4K0KC 4PHTA 4BSZA 4X62C 1NYEA 2E7GA 4B3MC 2ZTBA 2D7VA 2P20A 4LF9C 1XDXA 4K0BA 1MXBA 1ML8A 3E7WA 5T8TA 2E8CA 3J80D 1PG3A 1ZB8A 5FLXD 3GR1A 4AQYC 4DCSA 4G1IA 2OBVA 3CW9A 2ZZNA 4GS5A 1N33C 3AF5A 4L7IA 1M6XC 2E8FA 4D56A 4DR1C 3LUSA 3TQIA 4DV6C 1MXCA 3L95X 4RLFA 5KYTA 4DG9A 4JI3C 5IT9D 3UX2A 4RM3A 4LE5A 5LMNC 5IFIA 3E7XA 2D27A 1VEHA 1QWIA 3H2TA 5E7QA 5A19A 2ZM6C 3CQ1A 4JI5C 3IPLA 2UU9C 4BBYA 2D1SA 2M5HA 2EGTA 1XNRC 5BUSA 3JAMD 4PUHA 4X64C 2VSQA 4NDNA 5KEIA 4RMNA 1USPB 2VQEC 4FTFA 4DV2C 2BH1X 2P2QA 3I07A 2WP0C 4X66C 4B3SC 4JI0C 3G7SA 5AE1A 1UWDA 1RG9A 3CQ2A 1MD9A 4WV3A 4R1LA 1GPMA 3GKUA 1USPA 5T8SA 4KTTA 3A9UA 3KXWA 1V25A 4DR6C 4FUQA 2D1QA 4EATA 3DLPX 3LGXA 2PG1E 2P2BA 4G36A 4DG8A 4JI4C 5BSVA 1FLOA 1XNQC 3R9XA 2P02A 3A26A 3R9WA 4LFAC 4IR7A 4JI1C 3LNOA 3NYQA 4D57A 4ODJA 1P4EA 1O90A 2QVZX 3PROC 4XX2A 4WS9A 4I9FA 1LCIA 4ZJZA 2QVXX 1HR0C 3NPDA 3GR0A 4ISBA 1XMOC 1TH5A 2P2FA 1HNXC 4OXIA 4DR7C 1NY8A 4DUZC 3CQ3A 4I9GA 3PBKA 2CY1A 2V7BA 4KTVA 3NI2A 1HNZC 4LFCC 4DV0C 3VNQA 4KHPC 3NYRA 1PU1A 2Y27A 4TPSB 4JI6C 1WCJA 1KKGA 4MTNA 1HNWC 2Y4NA 1MKYA 2M5OA 1I94C 3IEUA
chains in the Genus database with same CATH topology
3N2QA 4NXNC 1PG4A 1MDFA 4DCUA 2ASBA 1N36C 4DR4C 5BUQA 5JRHA 2QL8A 4JI7C 1IBMC 4RLQA 2HHHC 2VZEA 5IWAC 1WH9A 4YHHC 2ATWA 1ZB9A 2D1TA 3CW8X 4D4IA 5BURA 2QW0X 3EERA 3LNVA 4DCTA 2QVYX 4IZ6A 5BSRA 4BC7A 3IEVA 5K85A 2KZFA 4JI2C 1AMUA 4D4GA 4FUTA 1O92A 4DV3C 1LQLA 5KYVA 4LF8C 4L4QA 4OX9C 2HJGA 3A9VA 4BC9A 4DV7C 5BSUA 2D1RA 2YWCA 1XRBA 2AYAA 1T5HX 3RV2A 1J5EC 1FJGC 4ZLPA 1N2FA 2UUCC 3N54B 4RVNA 1IBLC 4MH4A 1XRAA 3T1YC 2YCBA 1RY2A 2BJOA 3J7AD 3FCCA 3L8CA 3TUFA 5LMUC 4U5YD 5A1IA 1ULTA 3CJEA 4HPVA 4DCVA 4R0MA 1EGAA 4LF4C 1BA3A 1XRCA 4G37A 2UXDC 2DYJA 3R44A 4LF7C 3GPCA 5AE2A 2UUBC 1YJ7A 4NOZA 2Y4OA 4B3RC 5CZVA 1UKKA 1QM4A 5H9UA 4JV5C 2E0GA 3OTOC 3ETCA 5CZXA 5GTDA 2DPLA 1FUGA 4PZPA 3DHVA 4LFBC 4GXRA 2YWBA 1VLAA 2OO4A 3TDEA 4DR3C 5A2QD 4DV1C 2OPLB 2PROA 4PROC 1P7LA 3VNSA 3LAXA 4OYCA 4GXQA 1JOSA 5K8FA 1K0RA 4DR2C 1O9TA 2OPLA 3ETOA 1L2FA 2D28C 1XMQC 3EQ6A 4GKJC 1PA4A 5BR8C 1O93A 5DV9A 2UUAC 3C5EA 4NXMC 2VQFC 4X65C 3T1HC 4RM2A 4GKKC 2F4VC 1N32C 4B3TC 4L2ZA 3A4IA 1MDBA 3RG2A 4DR5C 2UXCC 3J81D 4JM1A 2XR1A 5AE3A 2JMPA 5BSTA 4YY3C 2E5LC 5BSWA 2PT7G 1T5DX 4DV4C 3SO4A 2PN2A 4LF6C 5A1GA 1IBKC 1MXAA 3DAYA 4BCAA 3VNRA 3IMLA 4JI8C 3PESA 3AF6A 4JYAC 2ONFA 1V26A 5BSMA 3B7WA 5ADZA 4DUYC 4R1MA 2UXBC 3I08A 2E8EA 3UOWA 2CXCA 3UZ0A 4RVOA 2WD9A 1WF3A 2P2JA 1N34C 3FCEA 1HH2P 4DV5C 4LF5C 2P2MA 3S82A 4K0KC 4PHTA 4BSZA 4X62C 1NYEA 2E7GA 4B3MC 2D7VA 2P20A 4LF9C 4K0BA 1MXBA 1ML8A 3E7WA 5T8TA 2E8CA 3J80D 1PG3A 1ZB8A 5FLXD 3GR1A 4AQYC 4DCSA 4G1IA 2OBVA 3CW9A 1N33C 4GS5A 3AF5A 4L7IA 2E8FA 4D56A 4DR1C 3LUSA 3TQIA 4DV6C 1MXCA 3L95X 4RLFA 5KYTA 4DG9A 4JI3C 5IT9D 4RM3A 4LE5A 5LMNC 5IFIA 3E7XA 2D27A 1QWIA 3H2TA 5E7QA 5A19A 2ZM6C 4JI5C 3IPLA 2UU9C 4BBYA 2D1SA 2EGTA 1XNRC 5BUSA 3JAMD 4X64C 2VSQA 4NDNA 5KEIA 4RMNA 1USPB 2VQEC 4FTFA 4DV2C 2BH1X 2P2QA 3I07A 2WP0C 4X66C 4B3SC 4JI0C 3G7SA 5AE1A 1RG9A 1MD9A 4WV3A 4R1LA 1GPMA 3GKUA 1USPA 5T8SA 4KTTA 3A9UA 3KXWA 1V25A 4DR6C 4FUQA 2D1QA 4EATA 3DLPX 3LGXA 2P2BA 4G36A 4DG8A 4JI4C 5BSVA 1XNQC 3R9XA 2P02A 3R9WA 4LFAC 4IR7A 4JI1C 3NYQA 4D57A 4ODJA 1O90A 2QVZX 3PROC 4XX2A 4WS9A 4I9FA 1LCIA 4ZJZA 2QVXX 1HR0C 3NPDA 3GR0A 4ISBA 1XMOC 2P2FA 1HNXC 4OXIA 4DR7C 4DUZC 4I9GA 3PBKA 2CY1A 2V7BA 4KTVA 3NI2A 1HNZC 4LFCC 4DV0C 3VNQA 4KHPC 3NYRA 2Y27A 4TPSB 4JI6C 1KKGA 4MTNA 1HNWC 2Y4NA 1MKYA 1I94C 3IEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 C;  1XNR C;  4NXN C;  3JAM D;  3AF6 A;  4B3R C;  4JYA C;  2ONF A;  4DCU A;  2ASB A;  1N36 C;  4DUY C;  4DR4 C;  1UKK A;  4X64 C;  4JV5 C;  2QL8 A;  3OTO C;  1IBM C;  4JI7 C;  2UXB C;  2HHH C;  5IWA C;  2E8E A;  2CXC A;  1WH9 A;  4YHH C;  1USP B;  2VQE C;  2ATW A;  1ZB9 A;  4LFB C;  4DV2 C;  3I07 A;  1WF3 A;  4X66 C;  1VLA A;  4B3S C;  4JI0 C;  4DR3 C;  3EER A;  1N34 C;  1HH2 P;  4DV5 C;  5A2Q D;  4LF5 C;  4DV1 C;  2OPL B;  4DCT A;  3GKU A;  1USP A;  4K0K C;  3IEV A;  4BSZ A;  4X62 C;  1NYE A;  2E7G A;  4B3M C;  4DR6 C;  2D7V A;  2KZF A;  4LF9 C;  1JOS A;  4JI2 C;  1ML8 A;  1K0R A;  4JI4 C;  4DR2 C;  1XNQ C;  4DV3 C;  3R9X A;  1LQL A;  3R9W A;  2OPL A;  4LF8 C;  2E8C A;  4LFA C;  4JI1 C;  1L2F A;  4OX9 C;  3J80 D;  2HJG A;  1ZB8 A;  5FLX D;  4AQY C;  1XMQ C;  4DCS A;  4GKJ C;  4XX2 A;  4DV7 C;  1PA4 A;  5BR8 C;  1N33 C;  3AF5 A;  2UUA C;  1HR0 C;  2VQF C;  4NXM C;  2E8F A;  4DR1 C;  1XMO C;  3LUS A;  4X65 C;  3T1H C;  1J5E C;  1FJG C;  4GKK C;  2F4V C;  1N32 C;  4DV6 C;  4B3T C;  1N2F A;  2UUC C;  1HNX C;  4DR5 C;  1IBL C;  2UXC C;  4MH4 A;  4DR7 C;  3J81 D;  3T1Y C;  2YCB A;  2XR1 A;  4DUZ C;  2JMP A;  2CY1 A;  2BJO A;  4JI3 C;  1HNZ C;  3J7A D;  4LFC C;  5IT9 D;  4DV0 C;  4YY3 C;  2E5L C;  5LMN C;  4KHP C;  2PT7 G;  5LMU C;  1QWI A;  4DV4 C;  3CJE A;  4DCV A;  2PN2 A;  1EGA A;  2ZM6 C;  4LF4 C;  4LF6 C;  4JI6 C;  4JI5 C;  1IBK C;  1KKG A;  4MTN A;  1HNW C;  2UXD C;  2DYJ A;  1MKY A;  2UU9 C;  4LF7 C;  2UUB C;  1I94 C;  3IEU A;  2EGT A;  4NOZ A; 
#chains in the Genus database with same CATH topology
 3N2Q A;  4NXN C;  1PG4 A;  1MDF A;  4DCU A;  2ASB A;  1N36 C;  4DR4 C;  5BUQ A;  5JRH A;  2QL8 A;  4JI7 C;  1IBM C;  4RLQ A;  2HHH C;  2VZE A;  5IWA C;  1WH9 A;  2CU6 A;  4YHH C;  2ATW A;  1ZB9 A;  2D1T A;  3CW8 X;  1V60 A;  4D4I A;  5BUR A;  3AY0 A;  2QW0 X;  3EER A;  3LNV A;  2MMA B;  4DCT A;  3A25 A;  2MCQ A;  2QVY X;  4IZ6 A;  5BSR A;  4BC7 A;  3IEV A;  4PUG A;  3TR3 A;  5K85 A;  2KZF A;  4JI2 C;  1AMU A;  4D4G A;  4FUT A;  1O92 A;  4DV3 C;  1LQL A;  5KYV A;  4LF8 C;  2NCL A;  4L4Q A;  4OX9 C;  2HJG A;  3A9V A;  4BC9 A;  4DV7 C;  4PUI A;  2D1R A;  2YWC A;  1XRB A;  5BSU A;  1M6X A;  2AYA A;  1T5H X;  3RV2 A;  1J5E C;  1FJG C;  4ZLP A;  1N2F A;  2UUC C;  3N54 B;  4RVN A;  1IBL C;  4MH4 A;  1XRA A;  1YGT A;  3T1Y C;  2YCB A;  1RY2 A;  3K6R A;  2BJO A;  3UEB A;  3FM7 A;  3J7A D;  3FCC A;  3L8C A;  3TUF A;  5LMU C;  4U5Y D;  5A1I A;  1ULT A;  3CJE A;  3UX3 A;  4HPV A;  4DCV A;  4R0M A;  1EGA A;  4LF4 C;  1BA3 A;  1XRC A;  4G37 A;  2UXD C;  2DYJ A;  3R44 A;  4LF7 C;  2Z51 A;  3GPC A;  5AE2 A;  2UUB C;  1YJ7 A;  4NOZ A;  1XHJ A;  2Y4O A;  4B3R C;  5CZV A;  1UKK A;  1QM4 A;  5H9U A;  4JV5 C;  2E0G A;  3OTO C;  3ETC A;  5CZX A;  5GTD A;  2DPL A;  1FUG A;  4PZP A;  3DHV A;  4LFB C;  4GXR A;  2YWB A;  1VLA A;  2OO4 A;  3TDE A;  4DR3 C;  2DHM A;  5A2Q D;  4DV1 C;  2OPL B;  2PRO A;  4PRO C;  1P7L A;  3VNS A;  3LAX A;  4OYC A;  4GXQ A;  1JOS A;  5K8F A;  1K0R A;  4DR2 C;  1O9T A;  2OPL A;  3ETO A;  1L2F A;  2D28 C;  1XMQ C;  1P4E C;  3EQ6 A;  4GKJ C;  1PA4 A;  5BR8 C;  1O93 A;  5DV9 A;  2UUA C;  3C5E A;  3O2E A;  4NXM C;  2VQF C;  4X65 C;  3T1H C;  4RM2 A;  5LCI A;  4GKK C;  2F4V C;  1N32 C;  4B3T C;  4L2Z A;  3A4I A;  1MDB A;  3RG2 A;  4DR5 C;  2UXC C;  3J81 D;  2MM9 A;  4JM1 A;  2XR1 A;  5AE3 A;  2JMP A;  1IB8 A;  5BST A;  2YX1 A;  4YY3 C;  2E5L C;  2KZ0 A;  5BSW A;  2PT7 G;  1T5D X;  4DV4 C;  3SO4 A;  2PN2 A;  4LF6 C;  5A1G A;  1IBK C;  1MXA A;  3DAY A;  4BCA A;  3VNR A;  3IML A;  4JI8 C;  2JNV A;  3PES A;  3AF6 A;  4JYA C;  2ONF A;  1V26 A;  5BSM A;  3B7W A;  5ADZ A;  4DUY C;  4R1M A;  2UXB C;  3I08 A;  1XS3 A;  2E8E A;  3UOW A;  2CXC A;  3UZ0 A;  4RVO A;  2WD9 A;  1WF3 A;  2P2J A;  1N34 C;  3FCE A;  1HH2 P;  4DV5 C;  2KDN A;  2ZZM A;  4LF5 C;  2P2M A;  3S82 A;  4K0K C;  4PHT A;  4BSZ A;  4X62 C;  1NYE A;  2E7G A;  4B3M C;  2ZTB A;  2D7V A;  2P20 A;  4LF9 C;  1XDX A;  4K0B A;  1MXB A;  1ML8 A;  3E7W A;  5T8T A;  2E8C A;  3J80 D;  1PG3 A;  1ZB8 A;  5FLX D;  3GR1 A;  4AQY C;  4DCS A;  4G1I A;  2OBV A;  3CW9 A;  2ZZN A;  4GS5 A;  1N33 C;  3AF5 A;  4L7I A;  1M6X C;  2E8F A;  4D56 A;  4DR1 C;  3LUS A;  3TQI A;  4DV6 C;  1MXC A;  3L95 X;  4RLF A;  5KYT A;  4DG9 A;  4JI3 C;  5IT9 D;  3UX2 A;  4RM3 A;  4LE5 A;  5LMN C;  5IFI A;  3E7X A;  2D27 A;  1VEH A;  1QWI A;  3H2T A;  5E7Q A;  5A19 A;  2ZM6 C;  3CQ1 A;  4JI5 C;  3IPL A;  2UU9 C;  4BBY A;  2D1S A;  2M5H A;  2EGT A;  1XNR C;  5BUS A;  3JAM D;  4PUH A;  4X64 C;  2VSQ A;  4NDN A;  5KEI A;  4RMN A;  1USP B;  2VQE C;  4FTF A;  4DV2 C;  2BH1 X;  2P2Q A;  3I07 A;  2WP0 C;  4X66 C;  4B3S C;  4JI0 C;  3G7S A;  5AE1 A;  1UWD A;  1RG9 A;  3CQ2 A;  1MD9 A;  4WV3 A;  4R1L A;  1GPM A;  3GKU A;  1USP A;  5T8S A;  4KTT A;  3A9U A;  3KXW A;  1V25 A;  4DR6 C;  4FUQ A;  2D1Q A;  4EAT A;  3DLP X;  3LGX A;  2PG1 E;  2P2B A;  4G36 A;  4DG8 A;  4JI4 C;  5BSV A;  1FLO A;  1XNQ C;  3R9X A;  2P02 A;  3A26 A;  3R9W A;  4LFA C;  4IR7 A;  4JI1 C;  3LNO A;  3NYQ A;  4D57 A;  4ODJ A;  1P4E A;  1O90 A;  2QVZ X;  3PRO C;  4XX2 A;  4WS9 A;  4I9F A;  1LCI A;  4ZJZ A;  2QVX X;  1HR0 C;  3NPD A;  3GR0 A;  4ISB A;  1XMO C;  1TH5 A;  2P2F A;  1HNX C;  4OXI A;  4DR7 C;  1NY8 A;  4DUZ C;  3CQ3 A;  4I9G A;  3PBK A;  2CY1 A;  2V7B A;  4KTV A;  3NI2 A;  1HNZ C;  4LFC C;  4DV0 C;  3VNQ A;  4KHP C;  3NYR A;  1PU1 A;  2Y27 A;  4TPS B;  4JI6 C;  1WCJ A;  1KKG A;  4MTN A;  1HNW C;  2Y4N A;  1MKY A;  2M5O A;  1I94 C;  3IEU A; 
#chains in the Genus database with same CATH homology
 3N2Q A;  4NXN C;  1PG4 A;  1MDF A;  4DCU A;  2ASB A;  1N36 C;  4DR4 C;  5BUQ A;  5JRH A;  2QL8 A;  4JI7 C;  1IBM C;  4RLQ A;  2HHH C;  2VZE A;  5IWA C;  1WH9 A;  4YHH C;  2ATW A;  1ZB9 A;  2D1T A;  3CW8 X;  4D4I A;  5BUR A;  2QW0 X;  3EER A;  3LNV A;  4DCT A;  2QVY X;  4IZ6 A;  5BSR A;  4BC7 A;  3IEV A;  5K85 A;  2KZF A;  4JI2 C;  1AMU A;  4D4G A;  4FUT A;  1O92 A;  4DV3 C;  1LQL A;  5KYV A;  4LF8 C;  4L4Q A;  4OX9 C;  2HJG A;  3A9V A;  4BC9 A;  4DV7 C;  5BSU A;  2D1R A;  2YWC A;  1XRB A;  2AYA A;  1T5H X;  3RV2 A;  1J5E C;  1FJG C;  4ZLP A;  1N2F A;  2UUC C;  3N54 B;  4RVN A;  1IBL C;  4MH4 A;  1XRA A;  3T1Y C;  2YCB A;  1RY2 A;  2BJO A;  3J7A D;  3FCC A;  3L8C A;  3TUF A;  5LMU C;  4U5Y D;  5A1I A;  1ULT A;  3CJE A;  4HPV A;  4DCV A;  4R0M A;  1EGA A;  4LF4 C;  1BA3 A;  1XRC A;  4G37 A;  2UXD C;  2DYJ A;  3R44 A;  4LF7 C;  3GPC A;  5AE2 A;  2UUB C;  1YJ7 A;  4NOZ A;  2Y4O A;  4B3R C;  5CZV A;  1UKK A;  1QM4 A;  5H9U A;  4JV5 C;  2E0G A;  3OTO C;  3ETC A;  5CZX A;  5GTD A;  2DPL A;  1FUG A;  4PZP A;  3DHV A;  4LFB C;  4GXR A;  2YWB A;  1VLA A;  2OO4 A;  3TDE A;  4DR3 C;  5A2Q D;  4DV1 C;  2OPL B;  2PRO A;  4PRO C;  1P7L A;  3VNS A;  3LAX A;  4OYC A;  4GXQ A;  1JOS A;  5K8F A;  1K0R A;  4DR2 C;  1O9T A;  2OPL A;  3ETO A;  1L2F A;  2D28 C;  1XMQ C;  3EQ6 A;  4GKJ C;  1PA4 A;  5BR8 C;  1O93 A;  5DV9 A;  2UUA C;  3C5E A;  4NXM C;  2VQF C;  4X65 C;  3T1H C;  4RM2 A;  4GKK C;  2F4V C;  1N32 C;  4B3T C;  4L2Z A;  3A4I A;  1MDB A;  3RG2 A;  4DR5 C;  2UXC C;  3J81 D;  4JM1 A;  2XR1 A;  5AE3 A;  2JMP A;  5BST A;  4YY3 C;  2E5L C;  5BSW A;  2PT7 G;  1T5D X;  4DV4 C;  3SO4 A;  2PN2 A;  4LF6 C;  5A1G A;  1IBK C;  1MXA A;  3DAY A;  4BCA A;  3VNR A;  3IML A;  4JI8 C;  3PES A;  3AF6 A;  4JYA C;  2ONF A;  1V26 A;  5BSM A;  3B7W A;  5ADZ A;  4DUY C;  4R1M A;  2UXB C;  3I08 A;  2E8E A;  3UOW A;  2CXC A;  3UZ0 A;  4RVO A;  2WD9 A;  1WF3 A;  2P2J A;  1N34 C;  3FCE A;  1HH2 P;  4DV5 C;  4LF5 C;  2P2M A;  3S82 A;  4K0K C;  4PHT A;  4BSZ A;  4X62 C;  1NYE A;  2E7G A;  4B3M C;  2D7V A;  2P20 A;  4LF9 C;  4K0B A;  1MXB A;  1ML8 A;  3E7W A;  5T8T A;  2E8C A;  3J80 D;  1PG3 A;  1ZB8 A;  5FLX D;  3GR1 A;  4AQY C;  4DCS A;  4G1I A;  2OBV A;  3CW9 A;  1N33 C;  4GS5 A;  3AF5 A;  4L7I A;  2E8F A;  4D56 A;  4DR1 C;  3LUS A;  3TQI A;  4DV6 C;  1MXC A;  3L95 X;  4RLF A;  5KYT A;  4DG9 A;  4JI3 C;  5IT9 D;  4RM3 A;  4LE5 A;  5LMN C;  5IFI A;  3E7X A;  2D27 A;  1QWI A;  3H2T A;  5E7Q A;  5A19 A;  2ZM6 C;  4JI5 C;  3IPL A;  2UU9 C;  4BBY A;  2D1S A;  2EGT A;  1XNR C;  5BUS A;  3JAM D;  4X64 C;  2VSQ A;  4NDN A;  5KEI A;  4RMN A;  1USP B;  2VQE C;  4FTF A;  4DV2 C;  2BH1 X;  2P2Q A;  3I07 A;  2WP0 C;  4X66 C;  4B3S C;  4JI0 C;  3G7S A;  5AE1 A;  1RG9 A;  1MD9 A;  4WV3 A;  4R1L A;  1GPM A;  3GKU A;  1USP A;  5T8S A;  4KTT A;  3A9U A;  3KXW A;  1V25 A;  4DR6 C;  4FUQ A;  2D1Q A;  4EAT A;  3DLP X;  3LGX A;  2P2B A;  4G36 A;  4DG8 A;  4JI4 C;  5BSV A;  1XNQ C;  3R9X A;  2P02 A;  3R9W A;  4LFA C;  4IR7 A;  4JI1 C;  3NYQ A;  4D57 A;  4ODJ A;  1O90 A;  2QVZ X;  3PRO C;  4XX2 A;  4WS9 A;  4I9F A;  1LCI A;  4ZJZ A;  2QVX X;  1HR0 C;  3NPD A;  3GR0 A;  4ISB A;  1XMO C;  2P2F A;  1HNX C;  4OXI A;  4DR7 C;  4DUZ C;  4I9G A;  3PBK A;  2CY1 A;  2V7B A;  4KTV A;  3NI2 A;  1HNZ C;  4LFC C;  4DV0 C;  3VNQ A;  4KHP C;  3NYR A;  2Y27 A;  4TPS B;  4JI6 C;  1KKG A;  4MTN A;  1HNW C;  2Y4N A;  1MKY A;  1I94 C;  3IEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...