3J80D

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
223
Chain Sequence
AIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRATKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHSGQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKALPDAVTIIEPKEEEPVLEPSVKDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 44
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
D PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3j80D01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3j80D02
4OX9C 4DCTA 4MTNA 4LF8C 3T1YC 4X62C 1VLAA 2OPLA 3IEVA 4XX2A 2ASBA 4DUYC 3J81D 4DV6C 2E8CA 2JMPA 2UXBC 4GKKC 1HNZC 4MH4A 2HHHC 2UU9C 4JI7C 1N33C 2E7GA 4JI4C 4NOZA 2OPLB 4DV7C 3T1HC 2ONFA 4LFCC 1ZB8A 3LUSA 5A2QD 3AF5A 2XR1A 1UKKA 1USPA 4X66C 1HH2P 2E5LC 2D7VA 4GKJC 2CY1A 5LMNC 2YCBA 4B3SC 2HJGA 2QL8A 1MKYA 5IT9D 2BJOA 1IBMC 3OTOC 1NYEA 1N34C 4DCVA 4B3MC 3I07A 4LFBC 2ATWA 1L2FA 2KZFA 4JI2C 4K0KC 4JI6C 4B3TC 1KKGA 2E8EA 4DR3C 2E8FA 4LF6C 5BR8C 4NXNC 4BSZA 4LF7C 4JI8C 1XMQC 4LF9C 1N32C 2UUBC 1EGAA 5IWAC 4LF4C 4DV0C 4YHHC 1ZB9A 1IBLC 2CXCA 4DCSA 4DV4C 1IBKC 4JI5C 3GKUA 5FLXD 4JYAC 1I94C 1XMOC 2UUAC 3CJEA 1FJGC 4KHPC 2DYJA 1LQLA 4X64C 1HR0C 4YY3C 4DR1C 2UXDC 5LMUC 4NXMC 4DV3C 1XNRC 4DR5C 4X65C 4DR6C 4DR7C 4B3RC 3J80D 3AF6A 1J5EC 1HNWC 4DCUA 3IEUA 2PN2A 4JI3C 4DV1C 3R9WA 1WF3A 1N2FA 1HNXC 2F4VC 3R9XA 2UXCC 4DUZC 4DR2C 1N36C 4DV5C 4JI1C 1JOSA 4AQYC 4LF5C 4DR4C 1PA4A 1USPB 1ML8A 3JAMD 2UUCC 4LFAC 4JV5C 4DV2C 3J7AD 2VQEC 1K0RA 1WH9A 1QWIA 2PT7G 3EERA 2EGTA 1XNQC 2ZM6C 2VQFC 4JI0C
chains in the Genus database with same CATH superfamily
3PROC 4MTNA 4LF8C 4G1IA 2JNVA 4X62C 1VLAA 1XDXA 2P2MA 1P4EA 2UXBC 1HNZC 3TR3A 3UZ0A 4JI7C 1T5HX 4DV7C 3R44A 3TQIA 2ONFA 4L2ZA 3LAXA 3AY0A 5A2QD 2XR1A 3A9UA 3LGXA 1USPA 2AYAA 2MCQA 1FUGA 1HH2P 2D1RA 2E5LC 2Y27A 5LMNC 2HJGA 4PUHA 1V25A 1MXBA 5KYVA 4DG9A 1YJ7A 2OO4A 5KYTA 3ETOA 4K0KC 3DAYA 4DG8A 3FM7A 4DR3C 3H2TA 4LF6C 5BR8C 3LNVA 4RMNA 1M6XA 3C5EA 4LF7C 3KXWA 2WD9A 1XMQC 4RLQA 1N32C 3IPLA 4WV3A 5CZVA 5A1IA 4DV0C 4YHHC 4G37A 5FLXD 4JYAC 2P2JA 1AMUA 2YWBA 4HPVA 4KHPC 4YY3C 3DHVA 1NY8A 2UXDC 3FCEA 4DV3C 3NI2A 2MMAB 3RV2A 1VEHA 3UX2A 4D4IA 1MXAA 2MM9A 5LCIA 1QM4A 1HNXC 4DUZC 5K85A 2D1TA 1XRAA 1ML8A 4GXQA 5BURA 2CU6A 4JM1A 2P2FA 2D1SA 2VQEC 1WH9A 3EERA 4JI0C 1O90A 4OX9C 3T1YC 3IMLA 3GR0A 3J81D 4L7IA 2KZ0A 4DUYC 4GKKC 4NOZA 3LUSA 4PUGA 4KTVA 2DPLA 2D27A 3AF5A 1O93A 4X66C 2D1QA 1XHJA 2ZZNA 2QL8A 3K6RA 2QVXX 4K0BA 1NYEA 3O2EA 2QVYX 2ATWA 1RY2A 2QVZX 3A4IA 4GXRA 3N2QA 2E8FA 3NYQA 3VNSA 3TDEA 3CW9A 3GPCA 5E7QA 5DV9A 5A1GA 5CZXA 4LF9C 1XS3A 5BSTA 2M5OA 4LF4C 5T8TA 4BCAA 2CXCA 4DCSA 4DV4C 3UX3A 4JI5C 4ZJZA 2P20A 2YWCA 1YGTA 4I9GA 4PUIA 3CJEA 5AE3A 1PU1A 1FJGC 4RVOA 2ZZMA 4R0MA 2VSQA 5LMUC 3ETCA 1XNRC 4DR6C 1XRBA 3VNQA 4DCUA 4DV1C 5A19A 4TPSB 1ULTA 4PHTA 4DV5C 3UEBA 4JI1C 2OBVA 1USPB 2UUCC 4LFAC 3I08A 4G36A 1UWDA 4I9FA 5AE1A 2V7BA 1QWIA 4R1MA 2ZM6C 3TUFA 3EQ6A 1MDFA 1O92A 4OXIA 3B7WA 2E0GA 3IEVA 5IFIA 5BSVA 1PG3A 2JMPA 3UOWA 3VNRA 3S82A 4BC9A 4JI4C 5JRHA 5K8FA 4U5YD 1MDBA 5AE2A 3LNOA 1UKKA 4LE5A 2P2BA 4FTFA 1MD9A 4GKJC 2CY1A 2YCBA 4L4QA 1MKYA 5H9UA 1IB8A 1IBMC 4BBYA 1BA3A 3OTOC 4DCVA 4ISBA 3I07A 4LFBC 5T8SA 2KZFA 2Z51A 3DLPX 4FUQA 4JI2C 3RG2A 4JI6C 1M6XC 4IR7A 2E8EA 4B3TC 1WCJA 1KKGA 2Y4NA 4BSZA 3G7SA 2UUBC 1IBKC 1I94C 3E7WA 2UUAC 5BSUA 2DYJA 1LQLA 1HR0C 1T5DX 4NXMC 4DR5C 4X65C 4B3RC 2NCLA 3J80D 1J5EC 5GTDA 2PROA 3E7XA 1HNWC 3IEUA 3R9WA 3A25A 3L95X 1P4EC 5BSWA 4PROC 4DR2C 5BSMA 4LF5C 2QW0X 1PA4A 4DV2C 5BSRA 3J7AD 3L8CA 2PT7G 1XNQC 2EGTA 1RG9A 4PZPA 4WS9A 3NYRA 4DCTA 3N54B 3NPDA 3A26A 2OPLA 4GS5A 4XX2A 2ASBA 4D4GA 4DV6C 2E8CA 4NDNA 4RM2A 4MH4A 3CQ3A 2HHHC 2UU9C 1N33C 2E7GA 3SO4A 4ODJA 2OPLB 2P2QA 3T1HC 4LFCC 1ZB8A 1FLOA 3CW8X 2YX1A 2Y4OA 2D7VA 3A9VA 4B3SC 2P02A 5IT9D 2BJOA 2WP0C 1N34C 4B3MC 2PG1E 4R1LA 5KEIA 1XRCA 5BUQA 1MXCA 1L2FA 3GR1A 4OYCA 1P7LA 2VZEA 4RM3A 2D28C 4NXNC 1V60A 4RLFA 4JI8C 1TH5A 3FCCA 4ZLPA 4BC7A 5IWAC 1EGAA 3CQ2A 5ADZA 1GPMA 1IBLC 1ZB9A 4IZ6A 4D56A 3GKUA 1XMOC 4KTTA 4X64C 4DR1C 3CQ1A 1O9TA 2DHMA 4RVNA 4DR7C 3AF6A 2PN2A 4JI3C 1N2FA 1WF3A 3PBKA 2BH1X 2F4VC 3R9XA 2UXCC 1N36C 1JOSA 4AQYC 4DR4C 4JV5C 3JAMD 1V26A 2M5HA 4D57A 4FUTA 4EATA 2ZTBA 1PG4A 1LCIA 1K0RA 2KDNA 2VQFC 3PESA 5BUSA
chains in the Genus database with same CATH topology
3PROC 4MTNA 4LF8C 4G1IA 4X62C 1VLAA 2P2MA 2UXBC 1HNZC 3UZ0A 4JI7C 1T5HX 4DV7C 3R44A 3TQIA 2ONFA 4L2ZA 3LAXA 5A2QD 2XR1A 3A9UA 3LGXA 1USPA 2AYAA 1FUGA 1HH2P 2D1RA 2E5LC 2Y27A 5LMNC 2HJGA 1V25A 1MXBA 5KYVA 4DG9A 1YJ7A 2OO4A 5KYTA 3ETOA 4K0KC 3DAYA 4DG8A 4DR3C 3H2TA 4LF6C 5BR8C 3LNVA 4RMNA 3C5EA 4LF7C 3KXWA 2WD9A 1XMQC 4RLQA 1N32C 3IPLA 4WV3A 5CZVA 5A1IA 4DV0C 4YHHC 4G37A 5FLXD 4JYAC 2P2JA 1AMUA 2YWBA 4HPVA 4KHPC 4YY3C 3DHVA 2UXDC 3FCEA 4DV3C 3NI2A 3RV2A 4D4IA 1MXAA 1QM4A 1HNXC 4DUZC 5K85A 2D1TA 1XRAA 1ML8A 4GXQA 5BURA 4JM1A 2P2FA 2D1SA 1WH9A 2VQEC 3EERA 4JI0C 1O90A 4OX9C 3T1YC 3IMLA 3GR0A 3J81D 4L7IA 4DUYC 4GKKC 4NOZA 3LUSA 4KTVA 2DPLA 2D27A 3AF5A 1O93A 4X66C 2D1QA 2QL8A 2QVXX 4K0BA 1NYEA 2QVYX 2ATWA 1RY2A 2QVZX 3A4IA 4GXRA 3N2QA 2E8FA 3NYQA 3VNSA 3TDEA 3CW9A 3GPCA 5E7QA 5DV9A 5A1GA 5CZXA 4LF9C 5BSTA 4LF4C 5T8TA 4BCAA 2CXCA 4DCSA 4DV4C 4JI5C 4ZJZA 2P20A 2YWCA 4I9GA 3CJEA 5AE3A 1FJGC 4RVOA 4R0MA 2VSQA 5LMUC 3ETCA 1XNRC 4DR6C 1XRBA 3VNQA 4DCUA 4DV1C 5A19A 4TPSB 1ULTA 4PHTA 4DV5C 4JI1C 2OBVA 2UUCC 1USPB 4LFAC 3I08A 4G36A 4I9FA 5AE1A 2V7BA 1QWIA 4R1MA 2ZM6C 3TUFA 3EQ6A 1MDFA 1O92A 4OXIA 3B7WA 2E0GA 3IEVA 5IFIA 5BSVA 1PG3A 2JMPA 3UOWA 3VNRA 3S82A 4BC9A 4JI4C 5JRHA 5K8FA 4U5YD 1MDBA 5AE2A 1UKKA 4LE5A 2P2BA 4FTFA 1MD9A 4GKJC 2CY1A 2YCBA 4L4QA 1MKYA 5H9UA 1IBMC 4BBYA 1BA3A 3OTOC 4DCVA 4ISBA 3I07A 4LFBC 5T8SA 2KZFA 4FUQA 3DLPX 4JI2C 3RG2A 4JI6C 4B3TC 4IR7A 2E8EA 1KKGA 2Y4NA 4BSZA 3G7SA 2UUBC 1IBKC 1I94C 3E7WA 2UUAC 5BSUA 2DYJA 1LQLA 1HR0C 1T5DX 4NXMC 4DR5C 4X65C 4B3RC 3J80D 1J5EC 5GTDA 2PROA 3E7XA 1HNWC 3IEUA 3R9WA 3L95X 5BSWA 4PROC 4DR2C 5BSMA 4LF5C 2QW0X 1PA4A 4DV2C 5BSRA 3J7AD 3L8CA 2PT7G 1XNQC 2EGTA 1RG9A 4PZPA 4WS9A 3NYRA 4DCTA 3N54B 3NPDA 2OPLA 4GS5A 4XX2A 2ASBA 4D4GA 4DV6C 2E8CA 4NDNA 4RM2A 4MH4A 2HHHC 2UU9C 1N33C 2E7GA 3SO4A 4ODJA 2OPLB 2P2QA 3T1HC 4LFCC 1ZB8A 3CW8X 2Y4OA 2D7VA 3A9VA 4B3SC 2P02A 5IT9D 2BJOA 2WP0C 1N34C 4B3MC 4R1LA 5KEIA 1XRCA 5BUQA 1MXCA 1L2FA 3GR1A 4OYCA 1P7LA 2VZEA 4RM3A 2D28C 4NXNC 4RLFA 4JI8C 4ZLPA 3FCCA 4BC7A 1EGAA 5ADZA 5IWAC 1GPMA 1IBLC 1ZB9A 4IZ6A 4D56A 3GKUA 1XMOC 4KTTA 4X64C 4DR1C 1O9TA 4RVNA 4DR7C 3AF6A 2PN2A 4JI3C 1N2FA 1WF3A 3PBKA 2BH1X 2F4VC 3R9XA 2UXCC 1N36C 1JOSA 4AQYC 4DR4C 4JV5C 3JAMD 1V26A 4D57A 4FUTA 4EATA 1PG4A 1LCIA 1K0RA 2VQFC 3PESA 5BUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 C;  4DCT A;  4MTN A;  4LF8 C;  3T1Y C;  4X62 C;  1VLA A;  2OPL A;  3IEV A;  4XX2 A;  2ASB A;  4DUY C;  3J81 D;  4DV6 C;  2E8C A;  2JMP A;  2UXB C;  4GKK C;  1HNZ C;  4MH4 A;  2HHH C;  2UU9 C;  4JI7 C;  1N33 C;  2E7G A;  4JI4 C;  4NOZ A;  2OPL B;  4DV7 C;  3T1H C;  2ONF A;  4LFC C;  1ZB8 A;  3LUS A;  5A2Q D;  3AF5 A;  2XR1 A;  1UKK A;  1USP A;  4X66 C;  1HH2 P;  2E5L C;  2D7V A;  4GKJ C;  2CY1 A;  5LMN C;  2YCB A;  4B3S C;  2HJG A;  2QL8 A;  1MKY A;  5IT9 D;  2BJO A;  1IBM C;  3OTO C;  1NYE A;  1N34 C;  4DCV A;  4B3M C;  3I07 A;  4LFB C;  2ATW A;  1L2F A;  2KZF A;  4JI2 C;  4K0K C;  4JI6 C;  4B3T C;  1KKG A;  2E8E A;  4DR3 C;  2E8F A;  4LF6 C;  5BR8 C;  4NXN C;  4BSZ A;  4LF7 C;  4JI8 C;  1XMQ C;  4LF9 C;  1N32 C;  2UUB C;  1EGA A;  5IWA C;  4LF4 C;  4DV0 C;  4YHH C;  1ZB9 A;  1IBL C;  2CXC A;  4DCS A;  4DV4 C;  1IBK C;  4JI5 C;  3GKU A;  5FLX D;  4JYA C;  1I94 C;  1XMO C;  2UUA C;  3CJE A;  1FJG C;  4KHP C;  2DYJ A;  1LQL A;  4X64 C;  1HR0 C;  4YY3 C;  4DR1 C;  2UXD C;  5LMU C;  4NXM C;  4DV3 C;  1XNR C;  4DR5 C;  4X65 C;  4DR6 C;  4DR7 C;  4B3R C;  3J80 D;  3AF6 A;  1J5E C;  1HNW C;  4DCU A;  3IEU A;  2PN2 A;  4JI3 C;  4DV1 C;  3R9W A;  1WF3 A;  1N2F A;  1HNX C;  2F4V C;  3R9X A;  2UXC C;  4DUZ C;  4DR2 C;  1N36 C;  4DV5 C;  4JI1 C;  1JOS A;  4AQY C;  4LF5 C;  4DR4 C;  1PA4 A;  1USP B;  1ML8 A;  3JAM D;  2UUC C;  4LFA C;  4JV5 C;  4DV2 C;  3J7A D;  2VQE C;  1K0R A;  1WH9 A;  1QWI A;  2PT7 G;  3EER A;  2EGT A;  1XNQ C;  2ZM6 C;  2VQF C;  4JI0 C; 
#chains in the Genus database with same CATH topology
 3PRO C;  4MTN A;  4LF8 C;  4G1I A;  2JNV A;  4X62 C;  1VLA A;  1XDX A;  2P2M A;  1P4E A;  2UXB C;  1HNZ C;  3TR3 A;  3UZ0 A;  4JI7 C;  1T5H X;  4DV7 C;  3R44 A;  3TQI A;  2ONF A;  4L2Z A;  3LAX A;  3AY0 A;  5A2Q D;  2XR1 A;  3A9U A;  3LGX A;  1USP A;  2AYA A;  2MCQ A;  1FUG A;  1HH2 P;  2D1R A;  2E5L C;  2Y27 A;  5LMN C;  2HJG A;  4PUH A;  1V25 A;  1MXB A;  5KYV A;  4DG9 A;  1YJ7 A;  2OO4 A;  5KYT A;  3ETO A;  4K0K C;  3DAY A;  4DG8 A;  3FM7 A;  4DR3 C;  3H2T A;  4LF6 C;  5BR8 C;  3LNV A;  4RMN A;  1M6X A;  3C5E A;  4LF7 C;  3KXW A;  2WD9 A;  1XMQ C;  4RLQ A;  1N32 C;  3IPL A;  4WV3 A;  5CZV A;  5A1I A;  4DV0 C;  4YHH C;  4G37 A;  5FLX D;  4JYA C;  2P2J A;  1AMU A;  2YWB A;  4HPV A;  4KHP C;  4YY3 C;  3DHV A;  1NY8 A;  2UXD C;  3FCE A;  4DV3 C;  3NI2 A;  2MMA B;  3RV2 A;  1VEH A;  3UX2 A;  4D4I A;  1MXA A;  2MM9 A;  5LCI A;  1QM4 A;  1HNX C;  4DUZ C;  5K85 A;  2D1T A;  1XRA A;  1ML8 A;  4GXQ A;  5BUR A;  2CU6 A;  4JM1 A;  2P2F A;  2D1S A;  2VQE C;  1WH9 A;  3EER A;  4JI0 C;  1O90 A;  4OX9 C;  3T1Y C;  3IML A;  3GR0 A;  3J81 D;  4L7I A;  2KZ0 A;  4DUY C;  4GKK C;  4NOZ A;  3LUS A;  4PUG A;  4KTV A;  2DPL A;  2D27 A;  3AF5 A;  1O93 A;  4X66 C;  2D1Q A;  1XHJ A;  2ZZN A;  2QL8 A;  3K6R A;  2QVX X;  4K0B A;  1NYE A;  3O2E A;  2QVY X;  2ATW A;  1RY2 A;  2QVZ X;  3A4I A;  4GXR A;  3N2Q A;  2E8F A;  3NYQ A;  3VNS A;  3TDE A;  3CW9 A;  3GPC A;  5E7Q A;  5DV9 A;  5A1G A;  5CZX A;  4LF9 C;  1XS3 A;  5BST A;  2M5O A;  4LF4 C;  5T8T A;  4BCA A;  2CXC A;  4DCS A;  4DV4 C;  3UX3 A;  4JI5 C;  4ZJZ A;  2P20 A;  2YWC A;  1YGT A;  4I9G A;  4PUI A;  3CJE A;  5AE3 A;  1PU1 A;  1FJG C;  4RVO A;  2ZZM A;  4R0M A;  2VSQ A;  5LMU C;  3ETC A;  1XNR C;  4DR6 C;  1XRB A;  3VNQ A;  4DCU A;  4DV1 C;  5A19 A;  4TPS B;  1ULT A;  4PHT A;  4DV5 C;  3UEB A;  4JI1 C;  2OBV A;  1USP B;  2UUC C;  4LFA C;  3I08 A;  4G36 A;  1UWD A;  4I9F A;  5AE1 A;  2V7B A;  1QWI A;  4R1M A;  2ZM6 C;  3TUF A;  3EQ6 A;  1MDF A;  1O92 A;  4OXI A;  3B7W A;  2E0G A;  3IEV A;  5IFI A;  5BSV A;  1PG3 A;  2JMP A;  3UOW A;  3VNR A;  3S82 A;  4BC9 A;  4JI4 C;  5JRH A;  5K8F A;  4U5Y D;  1MDB A;  5AE2 A;  3LNO A;  1UKK A;  4LE5 A;  2P2B A;  4FTF A;  1MD9 A;  4GKJ C;  2CY1 A;  2YCB A;  4L4Q A;  1MKY A;  5H9U A;  1IB8 A;  1IBM C;  4BBY A;  1BA3 A;  3OTO C;  4DCV A;  4ISB A;  3I07 A;  4LFB C;  5T8S A;  2KZF A;  2Z51 A;  3DLP X;  4FUQ A;  4JI2 C;  3RG2 A;  4JI6 C;  1M6X C;  4IR7 A;  2E8E A;  4B3T C;  1WCJ A;  1KKG A;  2Y4N A;  4BSZ A;  3G7S A;  2UUB C;  1IBK C;  1I94 C;  3E7W A;  2UUA C;  5BSU A;  2DYJ A;  1LQL A;  1HR0 C;  1T5D X;  4NXM C;  4DR5 C;  4X65 C;  4B3R C;  2NCL A;  3J80 D;  1J5E C;  5GTD A;  2PRO A;  3E7X A;  1HNW C;  3IEU A;  3R9W A;  3A25 A;  3L95 X;  1P4E C;  5BSW A;  4PRO C;  4DR2 C;  5BSM A;  4LF5 C;  2QW0 X;  1PA4 A;  4DV2 C;  5BSR A;  3J7A D;  3L8C A;  2PT7 G;  1XNQ C;  2EGT A;  1RG9 A;  4PZP A;  4WS9 A;  3NYR A;  4DCT A;  3N54 B;  3NPD A;  3A26 A;  2OPL A;  4GS5 A;  4XX2 A;  2ASB A;  4D4G A;  4DV6 C;  2E8C A;  4NDN A;  4RM2 A;  4MH4 A;  3CQ3 A;  2HHH C;  2UU9 C;  1N33 C;  2E7G A;  3SO4 A;  4ODJ A;  2OPL B;  2P2Q A;  3T1H C;  4LFC C;  1ZB8 A;  1FLO A;  3CW8 X;  2YX1 A;  2Y4O A;  2D7V A;  3A9V A;  4B3S C;  2P02 A;  5IT9 D;  2BJO A;  2WP0 C;  1N34 C;  4B3M C;  2PG1 E;  4R1L A;  5KEI A;  1XRC A;  5BUQ A;  1MXC A;  1L2F A;  3GR1 A;  4OYC A;  1P7L A;  2VZE A;  4RM3 A;  2D28 C;  4NXN C;  1V60 A;  4RLF A;  4JI8 C;  1TH5 A;  3FCC A;  4ZLP A;  4BC7 A;  5IWA C;  1EGA A;  3CQ2 A;  5ADZ A;  1GPM A;  1IBL C;  1ZB9 A;  4IZ6 A;  4D56 A;  3GKU A;  1XMO C;  4KTT A;  4X64 C;  4DR1 C;  3CQ1 A;  1O9T A;  2DHM A;  4RVN A;  4DR7 C;  3AF6 A;  2PN2 A;  4JI3 C;  1N2F A;  1WF3 A;  3PBK A;  2BH1 X;  2F4V C;  3R9X A;  2UXC C;  1N36 C;  1JOS A;  4AQY C;  4DR4 C;  4JV5 C;  3JAM D;  1V26 A;  2M5H A;  4D57 A;  4FUT A;  4EAT A;  2ZTB A;  1PG4 A;  1LCI A;  1K0R A;  2KDN A;  2VQF C;  3PES A;  5BUS A; 
#chains in the Genus database with same CATH homology
 3PRO C;  4MTN A;  4LF8 C;  4G1I A;  4X62 C;  1VLA A;  2P2M A;  2UXB C;  1HNZ C;  3UZ0 A;  4JI7 C;  1T5H X;  4DV7 C;  3R44 A;  3TQI A;  2ONF A;  4L2Z A;  3LAX A;  5A2Q D;  2XR1 A;  3A9U A;  3LGX A;  1USP A;  2AYA A;  1FUG A;  1HH2 P;  2D1R A;  2E5L C;  2Y27 A;  5LMN C;  2HJG A;  1V25 A;  1MXB A;  5KYV A;  4DG9 A;  1YJ7 A;  2OO4 A;  5KYT A;  3ETO A;  4K0K C;  3DAY A;  4DG8 A;  4DR3 C;  3H2T A;  4LF6 C;  5BR8 C;  3LNV A;  4RMN A;  3C5E A;  4LF7 C;  3KXW A;  2WD9 A;  1XMQ C;  4RLQ A;  1N32 C;  3IPL A;  4WV3 A;  5CZV A;  5A1I A;  4DV0 C;  4YHH C;  4G37 A;  5FLX D;  4JYA C;  2P2J A;  1AMU A;  2YWB A;  4HPV A;  4KHP C;  4YY3 C;  3DHV A;  2UXD C;  3FCE A;  4DV3 C;  3NI2 A;  3RV2 A;  4D4I A;  1MXA A;  1QM4 A;  1HNX C;  4DUZ C;  5K85 A;  2D1T A;  1XRA A;  1ML8 A;  4GXQ A;  5BUR A;  4JM1 A;  2P2F A;  2D1S A;  1WH9 A;  2VQE C;  3EER A;  4JI0 C;  1O90 A;  4OX9 C;  3T1Y C;  3IML A;  3GR0 A;  3J81 D;  4L7I A;  4DUY C;  4GKK C;  4NOZ A;  3LUS A;  4KTV A;  2DPL A;  2D27 A;  3AF5 A;  1O93 A;  4X66 C;  2D1Q A;  2QL8 A;  2QVX X;  4K0B A;  1NYE A;  2QVY X;  2ATW A;  1RY2 A;  2QVZ X;  3A4I A;  4GXR A;  3N2Q A;  2E8F A;  3NYQ A;  3VNS A;  3TDE A;  3CW9 A;  3GPC A;  5E7Q A;  5DV9 A;  5A1G A;  5CZX A;  4LF9 C;  5BST A;  4LF4 C;  5T8T A;  4BCA A;  2CXC A;  4DCS A;  4DV4 C;  4JI5 C;  4ZJZ A;  2P20 A;  2YWC A;  4I9G A;  3CJE A;  5AE3 A;  1FJG C;  4RVO A;  4R0M A;  2VSQ A;  5LMU C;  3ETC A;  1XNR C;  4DR6 C;  1XRB A;  3VNQ A;  4DCU A;  4DV1 C;  5A19 A;  4TPS B;  1ULT A;  4PHT A;  4DV5 C;  4JI1 C;  2OBV A;  2UUC C;  1USP B;  4LFA C;  3I08 A;  4G36 A;  4I9F A;  5AE1 A;  2V7B A;  1QWI A;  4R1M A;  2ZM6 C;  3TUF A;  3EQ6 A;  1MDF A;  1O92 A;  4OXI A;  3B7W A;  2E0G A;  3IEV A;  5IFI A;  5BSV A;  1PG3 A;  2JMP A;  3UOW A;  3VNR A;  3S82 A;  4BC9 A;  4JI4 C;  5JRH A;  5K8F A;  4U5Y D;  1MDB A;  5AE2 A;  1UKK A;  4LE5 A;  2P2B A;  4FTF A;  1MD9 A;  4GKJ C;  2CY1 A;  2YCB A;  4L4Q A;  1MKY A;  5H9U A;  1IBM C;  4BBY A;  1BA3 A;  3OTO C;  4DCV A;  4ISB A;  3I07 A;  4LFB C;  5T8S A;  2KZF A;  4FUQ A;  3DLP X;  4JI2 C;  3RG2 A;  4JI6 C;  4B3T C;  4IR7 A;  2E8E A;  1KKG A;  2Y4N A;  4BSZ A;  3G7S A;  2UUB C;  1IBK C;  1I94 C;  3E7W A;  2UUA C;  5BSU A;  2DYJ A;  1LQL A;  1HR0 C;  1T5D X;  4NXM C;  4DR5 C;  4X65 C;  4B3R C;  3J80 D;  1J5E C;  5GTD A;  2PRO A;  3E7X A;  1HNW C;  3IEU A;  3R9W A;  3L95 X;  5BSW A;  4PRO C;  4DR2 C;  5BSM A;  4LF5 C;  2QW0 X;  1PA4 A;  4DV2 C;  5BSR A;  3J7A D;  3L8C A;  2PT7 G;  1XNQ C;  2EGT A;  1RG9 A;  4PZP A;  4WS9 A;  3NYR A;  4DCT A;  3N54 B;  3NPD A;  2OPL A;  4GS5 A;  4XX2 A;  2ASB A;  4D4G A;  4DV6 C;  2E8C A;  4NDN A;  4RM2 A;  4MH4 A;  2HHH C;  2UU9 C;  1N33 C;  2E7G A;  3SO4 A;  4ODJ A;  2OPL B;  2P2Q A;  3T1H C;  4LFC C;  1ZB8 A;  3CW8 X;  2Y4O A;  2D7V A;  3A9V A;  4B3S C;  2P02 A;  5IT9 D;  2BJO A;  2WP0 C;  1N34 C;  4B3M C;  4R1L A;  5KEI A;  1XRC A;  5BUQ A;  1MXC A;  1L2F A;  3GR1 A;  4OYC A;  1P7L A;  2VZE A;  4RM3 A;  2D28 C;  4NXN C;  4RLF A;  4JI8 C;  4ZLP A;  3FCC A;  4BC7 A;  1EGA A;  5ADZ A;  5IWA C;  1GPM A;  1IBL C;  1ZB9 A;  4IZ6 A;  4D56 A;  3GKU A;  1XMO C;  4KTT A;  4X64 C;  4DR1 C;  1O9T A;  4RVN A;  4DR7 C;  3AF6 A;  2PN2 A;  4JI3 C;  1N2F A;  1WF3 A;  3PBK A;  2BH1 X;  2F4V C;  3R9X A;  2UXC C;  1N36 C;  1JOS A;  4AQY C;  4DR4 C;  4JV5 C;  3JAM D;  1V26 A;  4D57 A;  4FUT A;  4EAT A;  1PG4 A;  1LCI A;  1K0R A;  2VQF C;  3PES A;  5BUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...