3J80D

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
223
Chain Sequence
b'AIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRATKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHSGQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKALPDAVTIIEPKEEEPVLEPSVKDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 44
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
D PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3j80D01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3j80D02
2VQEC 4JI6C 4LFBC 3T1YC 1LQLA 1ZB9A 2XR1A 4DV0C 4DCUA 4JI0C 3LUSA 4DR1C 2VQFC 4B3MC 3OTOC 4DUYC 1N34C 2UXBC 2UXDC 2HHHC 4DR3C 1USPB 2UUCC 2E8CA 4GKKC 4LF7C 1HNWC 1ML8A 1WH9A 4LFAC 4OX9C 5FLXD 1MKYA 4YY3C 1FJGC 2DYJA 4DCTA 2E5LC 1XMQC 1USPA 1WF3A 2YCBA 2E8FA 1N2FA 1JOSA 1UKKA 3JAMD 4LF6C 3EERA 1IBKC 2CY1A 1J5EC 2BJOA 4JI8C 4DR6C 1XMOC 2PN2A 1HNXC 4DR5C 2UUAC 2OPLA 4JI4C 4MTNA 4AQYC 4B3SC 4DV2C 4X62C 4DV4C 1XNRC 1L2FA 4LF5C 1N33C 4NXNC 1N36C 4X64C 4JI7C 4GKJC 5A2QD 2UUBC 1HNZC 3T1HC 2ATWA 1HR0C 5BR8C 2JMPA 4LF9C 4JI3C 4KHPC 3AF6A 4LF4C 4X66C 5LMUC 1XNQC 2CXCA 2OPLB 4BSZA 4XX2A 1I94C 3IEUA 3J80D 1N32C 3R9WA 5IT9D 4DR4C 2ASBA 4JI2C 5IWAC 2PT7G 3I07A 2HJGA 3IEVA 4NXMC 2EGTA 4YHHC 4DR7C 4MH4A 4DCVA 4K0KC 2ONFA 4JV5C 1HH2P 2QL8A 2UXCC 1IBLC 2KZFA 4JI5C 4DR2C 4DV6C 4LF8C 4JYAC 3R9XA 3J7AD 3AF5A 2E8EA 4X65C 3CJEA 4DV3C 5LMNC 4LFCC 2D7VA 1IBMC 4DV1C 2ZM6C 3J81D 4DV7C 4DUZC 4DV5C 4B3TC 4NOZA 4B3RC 1K0RA 4JI1C 2E7GA 1EGAA 2UU9C 2F4VC 4DCSA 1ZB8A 3GKUA 1KKGA 1QWIA 1NYEA 1VLAA 1PA4A
chains in the Genus database with same CATH superfamily
3N2QA 4PHTA 4JI6C 3KXWA 2MCQA 1O92A 1LQLA 1GPMA 3GPCA 3LNVA 3PROC 4JI0C 5A1IA 4KTVA 2JNVA 4DG9A 5DV9A 4DR3C 4EATA 1USPB 2QW0X 1LCIA 4LF7C 3O2EA 3ETOA 3CQ3A 4PROC 5FLXD 1FJGC 2YCBA 2E8FA 1MDBA 1UWDA 1UKKA 3JAMD 2BJOA 4RLQA 1HNXC 2P2JA 4JI4C 3AY0A 1XRCA 1N33C 4JI7C 3NPDA 5AE1A 2UUBC 1HNZC 3T1HC 4KTTA 5BR8C 2PROA 4RMNA 4L4QA 3TDEA 3TQIA 3AF6A 5T8TA 3VNQA 4PUIA 1I94C 3G7SA 2ASBA 4JI2C 2PT7G 2ZZMA 3I07A 2V7BA 4NXMC 4YHHC 4DR7C 2ONFA 3FM7A 1BA3A 4FUQA 1ULTA 3UZ0A 3PESA 4DV6C 4G1IA 1MXCA 4PZPA 3J7AD 2M5OA 3CJEA 5LMNC 1IBMC 2Y4NA 2QVXX 4DUZC 3IPLA 4BBYA 3RV2A 1WCJA 2F4VC 3I08A 4G36A 4R1LA 1QWIA 1USPA 2VQEC 5KYTA 2CU6A 3DLPX 1TH5A 5BUQA 5AE2A 4RM3A 2QVZX 3OTOC 3UX3A 4I9FA 2YWCA 1VEHA 2HHHC 4LE5A 1T5DX 4BCAA 1ML8A 4ODJA 2P2BA 4DCTA 2E5LC 1XMQC 4BC9A 1JOSA 2M5HA 2DHMA 3L95X 1J5EC 3GR0A 4DR6C 1XMOC 4GS5A 4DR5C 4DV4C 5ADZA 4GKJC 3R44A 2ATWA 1HR0C 2JMPA 2D27A 4JI3C 3B7WA 5BSTA 1XHJA 5E7QA 4DR4C 2P2MA 4L2ZA 2KDNA 2OBVA 1V26A 2EGTA 2KZ0A 1NY8A 4MH4A 4DCVA 3S82A 4WV3A 4IR7A 4ISBA 2KZFA 3NI2A 4JI5C 4JYAC 3AF5A 4DV3C 1P4EC 2QVYX 5JRHA 1YGTA 1PU1A 1M6XA 4D4GA 4D56A 4DV1C 2VSQA 4DV5C 4B3RC 2P02A 4U5YD 1O93A 2Y4OA 4D4IA 2UU9C 5BUSA 2NCLA 3A4IA 5BSVA 1NYEA 2D1SA 3FCEA 3T1YC 5BSWA 4DG8A 1ZB9A 2XR1A 3CW8X 1MD9A 4DV0C 2WP0C 4DR1C 4B3MC 1IB8A 2WD9A 1P7LA 1N34C 2UXDC 5H9UA 1QM4A 2VZEA 3CQ1A 1T5HX 5K8FA 2DPLA 4R0MA 1HNWC 2MMAB 4LFAC 4OX9C 4YY3C 1MKYA 2D28C 1XS3A 1IBKC 2CY1A 2PN2A 2UUAC 4MTNA 2Y27A 4DV2C 4NXNC 5LCIA 4K0BA 3NYRA 3K6RA 4IZ6A 4ZLPA 3PBKA 4LF4C 1XNQC 2CXCA 2OPLB 4BSZA 4XX2A 3J80D 3A9VA 1N32C 5KYVA 2ZZNA 1XDXA 5IT9D 3GR1A 3VNRA 5IWAC 4WS9A 4RM2A 3CQ2A 3IEVA 4GXQA 3E7WA 4RVNA 4RLFA 3A26A 4K0KC 3E7XA 4JV5C 1XRBA 4G37A 2D1RA 3DHVA 1AMUA 3R9XA 2E8EA 4X65C 5BURA 2D7VA 3UOWA 2ZM6C 3UEBA 3J81D 1XRAA 3EQ6A 4NOZA 1M6XC 1K0RA 1V60A 4GXRA 2E7GA 4OXIA 3DAYA 3A25A 4DCSA 2PG1E 1KKGA 5A1GA 1PA4A 3SO4A 2P2FA 4LFBC 3L8CA 5K85A 5BSMA 2P20A 3LAXA 4DCUA 3LUSA 2VQFC 1RY2A 4L7IA 4DUYC 2D1QA 2UXBC 3TR3A 2UUCC 5T8SA 3UX2A 2BH1X 2E8CA 4GKKC 1PG4A 4RVOA 5BSUA 5CZXA 3IMLA 4I9GA 1WH9A 1FLOA 2DYJA 2YX1A 3LNOA 5CZVA 1WF3A 1N2FA 4LF6C 3EERA 5GTDA 5BSRA 3H2TA 4JI8C 2E0GA 2OPLA 5A19A 4B3SC 4AQYC 2YWBA 4OYCA 4X62C 1XNRC 1L2FA 4LF5C 4PUHA 3C5EA 3CW9A 1N36C 1YJ7A 4X64C 4BC7A 5A2QD 4LF9C 4R1MA 4KHPC 5IFIA 4X66C 5LMUC 3NYQA 1P4EA 4FTFA 4ZJZA 5AE3A 1RG9A 2Z51A 3IEUA 3ETCA 3R9WA 2ZTBA 3A9UA 5KEIA 2HJGA 3N54B 2P2QA 4FUTA 1FUGA 4D57A 1HH2P 2QL8A 2UXCC 1IBLC 2AYAA 1MXAA 1O90A 4DR2C 3VNSA 4LF8C 2OO4A 4HPVA 4NDNA 4LFCC 4DV7C 4JM1A 4B3TC 1MXBA 3TUFA 3FCCA 4JI1C 2MM9A 1V25A 1EGAA 1PG3A 3LGXA 1ZB8A 3RG2A 4PUGA 3GKUA 2D1TA 4TPSB 1O9TA 1VLAA 1MDFA
chains in the Genus database with same CATH topology
3N2QA 4PHTA 4JI6C 3KXWA 1O92A 1LQLA 1GPMA 3GPCA 3LNVA 3PROC 4JI0C 5A1IA 4KTVA 4DG9A 5DV9A 4DR3C 4EATA 1USPB 2QW0X 1LCIA 4LF7C 3ETOA 4PROC 5FLXD 1FJGC 2YCBA 2E8FA 1MDBA 1UKKA 3JAMD 2BJOA 4RLQA 1HNXC 2P2JA 4JI4C 1XRCA 1N33C 4JI7C 3NPDA 5AE1A 2UUBC 1HNZC 3T1HC 4KTTA 5BR8C 2PROA 4RMNA 4L4QA 3TDEA 3TQIA 3AF6A 5T8TA 3VNQA 1I94C 3G7SA 2ASBA 4JI2C 2PT7G 3I07A 2V7BA 4NXMC 4YHHC 4DR7C 2ONFA 1BA3A 4FUQA 1ULTA 3UZ0A 3PESA 4DV6C 4G1IA 1MXCA 4PZPA 3J7AD 3CJEA 5LMNC 1IBMC 2Y4NA 2QVXX 4DUZC 3IPLA 4BBYA 3RV2A 2F4VC 3I08A 4G36A 4R1LA 1QWIA 1USPA 2VQEC 5KYTA 3DLPX 5BUQA 5AE2A 4RM3A 2QVZX 3OTOC 4I9FA 2YWCA 2HHHC 4LE5A 1T5DX 4BCAA 1ML8A 4ODJA 2P2BA 4DCTA 2E5LC 1XMQC 4BC9A 1JOSA 3L95X 1J5EC 3GR0A 4DR6C 1XMOC 4GS5A 4DR5C 4DV4C 5ADZA 4GKJC 3R44A 2ATWA 1HR0C 2JMPA 2D27A 4JI3C 3B7WA 5BSTA 5E7QA 4DR4C 2P2MA 4L2ZA 2OBVA 1V26A 2EGTA 4MH4A 4DCVA 3S82A 4WV3A 4IR7A 4ISBA 2KZFA 3NI2A 4JI5C 4JYAC 3AF5A 4DV3C 2QVYX 5JRHA 4D4GA 4D56A 4DV1C 2VSQA 4DV5C 4B3RC 2P02A 4U5YD 1O93A 2Y4OA 4D4IA 2UU9C 5BUSA 5BSVA 3A4IA 1NYEA 2D1SA 3FCEA 3T1YC 5BSWA 4DG8A 1ZB9A 2XR1A 3CW8X 1MD9A 4DV0C 2WP0C 4DR1C 4B3MC 2WD9A 1P7LA 1N34C 2UXDC 5H9UA 1QM4A 2VZEA 1T5HX 4R0MA 2DPLA 5K8FA 1HNWC 4LFAC 4OX9C 4YY3C 1MKYA 2D28C 1IBKC 2CY1A 2PN2A 2UUAC 4MTNA 2Y27A 4DV2C 4NXNC 4K0BA 3NYRA 4IZ6A 4ZLPA 3PBKA 4LF4C 1XNQC 2OPLB 2CXCA 4BSZA 4XX2A 3J80D 3A9VA 1N32C 5KYVA 5IT9D 3GR1A 3VNRA 5IWAC 4WS9A 4RM2A 3IEVA 4GXQA 3E7WA 4RVNA 4RLFA 4K0KC 3E7XA 4JV5C 1XRBA 4G37A 2D1RA 3DHVA 1AMUA 3R9XA 2E8EA 4X65C 5BURA 2D7VA 3UOWA 2ZM6C 3J81D 1XRAA 3EQ6A 4NOZA 1K0RA 4GXRA 2E7GA 4OXIA 3DAYA 4DCSA 1KKGA 5A1GA 1PA4A 3SO4A 2P2FA 4LFBC 3L8CA 5K85A 5BSMA 2P20A 3LAXA 4DCUA 3LUSA 2VQFC 1RY2A 4L7IA 4DUYC 2D1QA 2UXBC 2UUCC 5T8SA 2BH1X 2E8CA 4GKKC 1PG4A 4RVOA 5BSUA 5CZXA 3IMLA 4I9GA 1WH9A 2DYJA 5CZVA 1WF3A 1N2FA 4LF6C 3EERA 5GTDA 5BSRA 3H2TA 4JI8C 2E0GA 2OPLA 5A19A 4B3SC 4AQYC 2YWBA 4OYCA 4X62C 1XNRC 1L2FA 4LF5C 3C5EA 3CW9A 1N36C 1YJ7A 4X64C 4BC7A 5A2QD 4LF9C 4R1MA 4KHPC 5IFIA 4X66C 5LMUC 3NYQA 4FTFA 4ZJZA 5AE3A 1RG9A 3IEUA 3ETCA 3R9WA 3A9UA 5KEIA 2HJGA 3N54B 2P2QA 4FUTA 1FUGA 4D57A 1HH2P 2QL8A 2UXCC 1IBLC 2AYAA 1MXAA 1O90A 4DR2C 3VNSA 4LF8C 2OO4A 4HPVA 4NDNA 4LFCC 4DV7C 4JM1A 4B3TC 1MXBA 3TUFA 3FCCA 4JI1C 1V25A 1EGAA 1PG3A 3LGXA 1ZB8A 3RG2A 3GKUA 2D1TA 4TPSB 1O9TA 1VLAA 1MDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE C;  4JI6 C;  4LFB C;  3T1Y C;  1LQL A;  1ZB9 A;  2XR1 A;  4DV0 C;  4DCU A;  4JI0 C;  3LUS A;  4DR1 C;  2VQF C;  4B3M C;  3OTO C;  4DUY C;  1N34 C;  2UXB C;  2UXD C;  2HHH C;  4DR3 C;  1USP B;  2UUC C;  2E8C A;  4GKK C;  4LF7 C;  1HNW C;  1ML8 A;  1WH9 A;  4LFA C;  4OX9 C;  5FLX D;  1MKY A;  4YY3 C;  1FJG C;  2DYJ A;  4DCT A;  2E5L C;  1XMQ C;  1USP A;  1WF3 A;  2YCB A;  2E8F A;  1N2F A;  1JOS A;  1UKK A;  3JAM D;  4LF6 C;  3EER A;  1IBK C;  2CY1 A;  1J5E C;  2BJO A;  4JI8 C;  4DR6 C;  1XMO C;  2PN2 A;  1HNX C;  4DR5 C;  2UUA C;  2OPL A;  4JI4 C;  4MTN A;  4AQY C;  4B3S C;  4DV2 C;  4X62 C;  4DV4 C;  1XNR C;  1L2F A;  4LF5 C;  1N33 C;  4NXN C;  1N36 C;  4X64 C;  4JI7 C;  4GKJ C;  5A2Q D;  2UUB C;  1HNZ C;  3T1H C;  2ATW A;  1HR0 C;  5BR8 C;  2JMP A;  4LF9 C;  4JI3 C;  4KHP C;  3AF6 A;  4LF4 C;  4X66 C;  5LMU C;  1XNQ C;  2CXC A;  2OPL B;  4BSZ A;  4XX2 A;  1I94 C;  3IEU A;  3J80 D;  1N32 C;  3R9W A;  5IT9 D;  4DR4 C;  2ASB A;  4JI2 C;  5IWA C;  2PT7 G;  3I07 A;  2HJG A;  3IEV A;  4NXM C;  2EGT A;  4YHH C;  4DR7 C;  4MH4 A;  4DCV A;  4K0K C;  2ONF A;  4JV5 C;  1HH2 P;  2QL8 A;  2UXC C;  1IBL C;  2KZF A;  4JI5 C;  4DR2 C;  4DV6 C;  4LF8 C;  4JYA C;  3R9X A;  3J7A D;  3AF5 A;  2E8E A;  4X65 C;  3CJE A;  4DV3 C;  5LMN C;  4LFC C;  2D7V A;  1IBM C;  4DV1 C;  2ZM6 C;  3J81 D;  4DV7 C;  4DUZ C;  4DV5 C;  4B3T C;  4NOZ A;  4B3R C;  1K0R A;  4JI1 C;  2E7G A;  1EGA A;  2UU9 C;  2F4V C;  4DCS A;  1ZB8 A;  3GKU A;  1KKG A;  1QWI A;  1NYE A;  1VLA A;  1PA4 A; 
#chains in the Genus database with same CATH topology
 3N2Q A;  4PHT A;  4JI6 C;  3KXW A;  2MCQ A;  1O92 A;  1LQL A;  1GPM A;  3GPC A;  3LNV A;  3PRO C;  4JI0 C;  5A1I A;  4KTV A;  2JNV A;  4DG9 A;  5DV9 A;  4DR3 C;  4EAT A;  1USP B;  2QW0 X;  1LCI A;  4LF7 C;  3O2E A;  3ETO A;  3CQ3 A;  4PRO C;  5FLX D;  1FJG C;  2YCB A;  2E8F A;  1MDB A;  1UWD A;  1UKK A;  3JAM D;  2BJO A;  4RLQ A;  1HNX C;  2P2J A;  4JI4 C;  3AY0 A;  1XRC A;  1N33 C;  4JI7 C;  3NPD A;  5AE1 A;  2UUB C;  1HNZ C;  3T1H C;  4KTT A;  5BR8 C;  2PRO A;  4RMN A;  4L4Q A;  3TDE A;  3TQI A;  3AF6 A;  5T8T A;  3VNQ A;  4PUI A;  1I94 C;  3G7S A;  2ASB A;  4JI2 C;  2PT7 G;  2ZZM A;  3I07 A;  2V7B A;  4NXM C;  4YHH C;  4DR7 C;  2ONF A;  3FM7 A;  1BA3 A;  4FUQ A;  1ULT A;  3UZ0 A;  3PES A;  4DV6 C;  4G1I A;  1MXC A;  4PZP A;  3J7A D;  2M5O A;  3CJE A;  5LMN C;  1IBM C;  2Y4N A;  2QVX X;  4DUZ C;  3IPL A;  4BBY A;  3RV2 A;  1WCJ A;  2F4V C;  3I08 A;  4G36 A;  4R1L A;  1QWI A;  1USP A;  2VQE C;  5KYT A;  2CU6 A;  3DLP X;  1TH5 A;  5BUQ A;  5AE2 A;  4RM3 A;  2QVZ X;  3OTO C;  3UX3 A;  4I9F A;  2YWC A;  1VEH A;  2HHH C;  4LE5 A;  1T5D X;  4BCA A;  1ML8 A;  4ODJ A;  2P2B A;  4DCT A;  2E5L C;  1XMQ C;  4BC9 A;  1JOS A;  2M5H A;  2DHM A;  3L95 X;  1J5E C;  3GR0 A;  4DR6 C;  1XMO C;  4GS5 A;  4DR5 C;  4DV4 C;  5ADZ A;  4GKJ C;  3R44 A;  2ATW A;  1HR0 C;  2JMP A;  2D27 A;  4JI3 C;  3B7W A;  5BST A;  1XHJ A;  5E7Q A;  4DR4 C;  2P2M A;  4L2Z A;  2KDN A;  2OBV A;  1V26 A;  2EGT A;  2KZ0 A;  1NY8 A;  4MH4 A;  4DCV A;  3S82 A;  4WV3 A;  4IR7 A;  4ISB A;  2KZF A;  3NI2 A;  4JI5 C;  4JYA C;  3AF5 A;  4DV3 C;  1P4E C;  2QVY X;  5JRH A;  1YGT A;  1PU1 A;  1M6X A;  4D4G A;  4D56 A;  4DV1 C;  2VSQ A;  4DV5 C;  4B3R C;  2P02 A;  4U5Y D;  1O93 A;  2Y4O A;  4D4I A;  2UU9 C;  5BUS A;  2NCL A;  3A4I A;  5BSV A;  1NYE A;  2D1S A;  3FCE A;  3T1Y C;  5BSW A;  4DG8 A;  1ZB9 A;  2XR1 A;  3CW8 X;  1MD9 A;  4DV0 C;  2WP0 C;  4DR1 C;  4B3M C;  1IB8 A;  2WD9 A;  1P7L A;  1N34 C;  2UXD C;  5H9U A;  1QM4 A;  2VZE A;  3CQ1 A;  1T5H X;  5K8F A;  2DPL A;  4R0M A;  1HNW C;  2MMA B;  4LFA C;  4OX9 C;  4YY3 C;  1MKY A;  2D28 C;  1XS3 A;  1IBK C;  2CY1 A;  2PN2 A;  2UUA C;  4MTN A;  2Y27 A;  4DV2 C;  4NXN C;  5LCI A;  4K0B A;  3NYR A;  3K6R A;  4IZ6 A;  4ZLP A;  3PBK A;  4LF4 C;  1XNQ C;  2CXC A;  2OPL B;  4BSZ A;  4XX2 A;  3J80 D;  3A9V A;  1N32 C;  5KYV A;  2ZZN A;  1XDX A;  5IT9 D;  3GR1 A;  3VNR A;  5IWA C;  4WS9 A;  4RM2 A;  3CQ2 A;  3IEV A;  4GXQ A;  3E7W A;  4RVN A;  4RLF A;  3A26 A;  4K0K C;  3E7X A;  4JV5 C;  1XRB A;  4G37 A;  2D1R A;  3DHV A;  1AMU A;  3R9X A;  2E8E A;  4X65 C;  5BUR A;  2D7V A;  3UOW A;  2ZM6 C;  3UEB A;  3J81 D;  1XRA A;  3EQ6 A;  4NOZ A;  1M6X C;  1K0R A;  1V60 A;  4GXR A;  2E7G A;  4OXI A;  3DAY A;  3A25 A;  4DCS A;  2PG1 E;  1KKG A;  5A1G A;  1PA4 A;  3SO4 A;  2P2F A;  4LFB C;  3L8C A;  5K85 A;  5BSM A;  2P20 A;  3LAX A;  4DCU A;  3LUS A;  2VQF C;  1RY2 A;  4L7I A;  4DUY C;  2D1Q A;  2UXB C;  3TR3 A;  2UUC C;  5T8S A;  3UX2 A;  2BH1 X;  2E8C A;  4GKK C;  1PG4 A;  4RVO A;  5BSU A;  5CZX A;  3IML A;  4I9G A;  1WH9 A;  1FLO A;  2DYJ A;  2YX1 A;  3LNO A;  5CZV A;  1WF3 A;  1N2F A;  4LF6 C;  3EER A;  5GTD A;  5BSR A;  3H2T A;  4JI8 C;  2E0G A;  2OPL A;  5A19 A;  4B3S C;  4AQY C;  2YWB A;  4OYC A;  4X62 C;  1XNR C;  1L2F A;  4LF5 C;  4PUH A;  3C5E A;  3CW9 A;  1N36 C;  1YJ7 A;  4X64 C;  4BC7 A;  5A2Q D;  4LF9 C;  4R1M A;  4KHP C;  5IFI A;  4X66 C;  5LMU C;  3NYQ A;  1P4E A;  4FTF A;  4ZJZ A;  5AE3 A;  1RG9 A;  2Z51 A;  3IEU A;  3ETC A;  3R9W A;  2ZTB A;  3A9U A;  5KEI A;  2HJG A;  3N54 B;  2P2Q A;  4FUT A;  1FUG A;  4D57 A;  1HH2 P;  2QL8 A;  2UXC C;  1IBL C;  2AYA A;  1MXA A;  1O90 A;  4DR2 C;  3VNS A;  4LF8 C;  2OO4 A;  4HPV A;  4NDN A;  4LFC C;  4DV7 C;  4JM1 A;  4B3T C;  1MXB A;  3TUF A;  3FCC A;  4JI1 C;  2MM9 A;  1V25 A;  1EGA A;  1PG3 A;  3LGX A;  1ZB8 A;  3RG2 A;  4PUG A;  3GKU A;  2D1T A;  4TPS B;  1O9T A;  1VLA A;  1MDF A; 
#chains in the Genus database with same CATH homology
 3N2Q A;  4PHT A;  4JI6 C;  3KXW A;  1O92 A;  1LQL A;  1GPM A;  3GPC A;  3LNV A;  3PRO C;  4JI0 C;  5A1I A;  4KTV A;  4DG9 A;  5DV9 A;  4DR3 C;  4EAT A;  1USP B;  2QW0 X;  1LCI A;  4LF7 C;  3ETO A;  4PRO C;  5FLX D;  1FJG C;  2YCB A;  2E8F A;  1MDB A;  1UKK A;  3JAM D;  2BJO A;  4RLQ A;  1HNX C;  2P2J A;  4JI4 C;  1XRC A;  1N33 C;  4JI7 C;  3NPD A;  5AE1 A;  2UUB C;  1HNZ C;  3T1H C;  4KTT A;  5BR8 C;  2PRO A;  4RMN A;  4L4Q A;  3TDE A;  3TQI A;  3AF6 A;  5T8T A;  3VNQ A;  1I94 C;  3G7S A;  2ASB A;  4JI2 C;  2PT7 G;  3I07 A;  2V7B A;  4NXM C;  4YHH C;  4DR7 C;  2ONF A;  1BA3 A;  4FUQ A;  1ULT A;  3UZ0 A;  3PES A;  4DV6 C;  4G1I A;  1MXC A;  4PZP A;  3J7A D;  3CJE A;  5LMN C;  1IBM C;  2Y4N A;  2QVX X;  4DUZ C;  3IPL A;  4BBY A;  3RV2 A;  2F4V C;  3I08 A;  4G36 A;  4R1L A;  1QWI A;  1USP A;  2VQE C;  5KYT A;  3DLP X;  5BUQ A;  5AE2 A;  4RM3 A;  2QVZ X;  3OTO C;  4I9F A;  2YWC A;  2HHH C;  4LE5 A;  1T5D X;  4BCA A;  1ML8 A;  4ODJ A;  2P2B A;  4DCT A;  2E5L C;  1XMQ C;  4BC9 A;  1JOS A;  3L95 X;  1J5E C;  3GR0 A;  4DR6 C;  1XMO C;  4GS5 A;  4DR5 C;  4DV4 C;  5ADZ A;  4GKJ C;  3R44 A;  2ATW A;  1HR0 C;  2JMP A;  2D27 A;  4JI3 C;  3B7W A;  5BST A;  5E7Q A;  4DR4 C;  2P2M A;  4L2Z A;  2OBV A;  1V26 A;  2EGT A;  4MH4 A;  4DCV A;  3S82 A;  4WV3 A;  4IR7 A;  4ISB A;  2KZF A;  3NI2 A;  4JI5 C;  4JYA C;  3AF5 A;  4DV3 C;  2QVY X;  5JRH A;  4D4G A;  4D56 A;  4DV1 C;  2VSQ A;  4DV5 C;  4B3R C;  2P02 A;  4U5Y D;  1O93 A;  2Y4O A;  4D4I A;  2UU9 C;  5BUS A;  5BSV A;  3A4I A;  1NYE A;  2D1S A;  3FCE A;  3T1Y C;  5BSW A;  4DG8 A;  1ZB9 A;  2XR1 A;  3CW8 X;  1MD9 A;  4DV0 C;  2WP0 C;  4DR1 C;  4B3M C;  2WD9 A;  1P7L A;  1N34 C;  2UXD C;  5H9U A;  1QM4 A;  2VZE A;  1T5H X;  4R0M A;  2DPL A;  5K8F A;  1HNW C;  4LFA C;  4OX9 C;  4YY3 C;  1MKY A;  2D28 C;  1IBK C;  2CY1 A;  2PN2 A;  2UUA C;  4MTN A;  2Y27 A;  4DV2 C;  4NXN C;  4K0B A;  3NYR A;  4IZ6 A;  4ZLP A;  3PBK A;  4LF4 C;  1XNQ C;  2OPL B;  2CXC A;  4BSZ A;  4XX2 A;  3J80 D;  3A9V A;  1N32 C;  5KYV A;  5IT9 D;  3GR1 A;  3VNR A;  5IWA C;  4WS9 A;  4RM2 A;  3IEV A;  4GXQ A;  3E7W A;  4RVN A;  4RLF A;  4K0K C;  3E7X A;  4JV5 C;  1XRB A;  4G37 A;  2D1R A;  3DHV A;  1AMU A;  3R9X A;  2E8E A;  4X65 C;  5BUR A;  2D7V A;  3UOW A;  2ZM6 C;  3J81 D;  1XRA A;  3EQ6 A;  4NOZ A;  1K0R A;  4GXR A;  2E7G A;  4OXI A;  3DAY A;  4DCS A;  1KKG A;  5A1G A;  1PA4 A;  3SO4 A;  2P2F A;  4LFB C;  3L8C A;  5K85 A;  5BSM A;  2P20 A;  3LAX A;  4DCU A;  3LUS A;  2VQF C;  1RY2 A;  4L7I A;  4DUY C;  2D1Q A;  2UXB C;  2UUC C;  5T8S A;  2BH1 X;  2E8C A;  4GKK C;  1PG4 A;  4RVO A;  5BSU A;  5CZX A;  3IML A;  4I9G A;  1WH9 A;  2DYJ A;  5CZV A;  1WF3 A;  1N2F A;  4LF6 C;  3EER A;  5GTD A;  5BSR A;  3H2T A;  4JI8 C;  2E0G A;  2OPL A;  5A19 A;  4B3S C;  4AQY C;  2YWB A;  4OYC A;  4X62 C;  1XNR C;  1L2F A;  4LF5 C;  3C5E A;  3CW9 A;  1N36 C;  1YJ7 A;  4X64 C;  4BC7 A;  5A2Q D;  4LF9 C;  4R1M A;  4KHP C;  5IFI A;  4X66 C;  5LMU C;  3NYQ A;  4FTF A;  4ZJZ A;  5AE3 A;  1RG9 A;  3IEU A;  3ETC A;  3R9W A;  3A9U A;  5KEI A;  2HJG A;  3N54 B;  2P2Q A;  4FUT A;  1FUG A;  4D57 A;  1HH2 P;  2QL8 A;  2UXC C;  1IBL C;  2AYA A;  1MXA A;  1O90 A;  4DR2 C;  3VNS A;  4LF8 C;  2OO4 A;  4HPV A;  4NDN A;  4LFC C;  4DV7 C;  4JM1 A;  4B3T C;  1MXB A;  3TUF A;  3FCC A;  4JI1 C;  1V25 A;  1EGA A;  1PG3 A;  3LGX A;  1ZB8 A;  3RG2 A;  3GKU A;  2D1T A;  4TPS B;  1O9T A;  1VLA A;  1MDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...