3J80D

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
223
Chain Sequence
AIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRATKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHSGQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKALPDAVTIIEPKEEEPVLEPSVKDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 44
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
D PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3j80D01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3j80D02
4LF5C 1L2FA 4DUZC 2VQFC 4BSZA 1WH9A 4DV4C 3J81D 2UU9C 4DR7C 4DCUA 4B3MC 2UUCC 1USPA 1PA4A 4LFBC 4DR3C 2EGTA 1XMQC 3GKUA 4X65C 2UUBC 4B3SC 4KHPC 5LMUC 4XX2A 4X62C 5BR8C 2OPLB 4GKJC 1USPB 3AF6A 3LUSA 4DV5C 1IBLC 4B3TC 1WF3A 4YY3C 4DR1C 5IWAC 1ZB8A 3JAMD 1XMOC 2OPLA 2YCBA 4DCTA 4LF6C 4JI4C 5A2QD 1QWIA 1N32C 3T1YC 4X64C 1XNQC 4YHHC 1I94C 4JI3C 4DV1C 4JI6C 5FLXD 4DV0C 1UKKA 4AQYC 5IT9D 1VLAA 4LF9C 4DV7C 4DV3C 2HHHC 4NOZA 3R9WA 4NXMC 1N2FA 2E8EA 4B3RC 4LFAC 4MH4A 2ASBA 4DV6C 1N36C 2ONFA 1NYEA 1MKYA 1EGAA 1XNRC 4DR4C 2ATWA 4GKKC 4JV5C 1HNWC 4MTNA 1IBKC 2F4VC 2UUAC 2E7GA 1ZB9A 1HNZC 4K0KC 2JMPA 3EERA 3AF5A 2QL8A 1HNXC 1JOSA 4LF4C 2CY1A 1HH2P 2ZM6C 1LQLA 4DCVA 2PT7G 3OTOC 4OX9C 4JYAC 4LF8C 1HR0C 2E8CA 4X66C 4DR5C 4NXNC 1N34C 1KKGA 4LFCC 4DCSA 2PN2A 4DUYC 2E5LC 4DR6C 4LF7C 2D7VA 4DR2C 4JI1C 2E8FA 2BJOA 2KZFA 3IEVA 2DYJA 3IEUA 3R9XA 5LMNC 2UXBC 2CXCA 4JI0C 1K0RA 4JI5C 3J80D 4JI2C 3I07A 2UXCC 3J7AD 2XR1A 2HJGA 3T1HC 4JI8C 1FJGC 2UXDC 1N33C 1J5EC 2VQEC 4DV2C 3CJEA 1IBMC 4JI7C 1ML8A
chains in the Genus database with same CATH superfamily
5BSUA 2VQFC 1O9TA 4BSZA 1IB8A 1PU1A 4FTFA 2V7BA 2UUCC 4G36A 3N2QA 5BSWA 5LCIA 2KZ0A 3O2EA 3R44A 2E0GA 4X65C 1MXBA 2UUBC 4IZ6A 5LMUC 3IMLA 1TH5A 2JNVA 3AF6A 2DHMA 2QVXX 1WF3A 3FCCA 5IWAC 1ZB8A 3JAMD 5BSMA 2YCBA 4DCTA 2MM9A 4D56A 3T1YC 4YHHC 4JI6C 5FLXD 5H9UA 4LF9C 3UOWA 3GR1A 2DPLA 4NOZA 3TQIA 4ZJZA 1V25A 2E8EA 1YJ7A 3DHVA 1RG9A 4PUHA 2ASBA 3N54B 5GTDA 4BCAA 2PROA 2OBVA 4GKKC 1IBKC 2F4VC 3RG2A 2E7GA 2P2BA 2QL8A 5KEIA 3VNRA 1XRCA 3PROC 2ZM6C 1LQLA 1HR0C 3PBKA 5A1IA 1KKGA 4LFCC 2PN2A 5AE3A 1V26A 4EATA 1XDXA 3NYQA 2KZFA 4L7IA 4I9FA 3IEUA 2CXCA 3S82A 2MMAB 3UEBA 1FUGA 2HJGA 3A25A 4JI8C 4RLQA 1J5EC 2VQEC 4RMNA 3DLPX 3ETOA 4LF5C 1L2FA 2M5OA 3VNSA 1WCJA 1MDFA 3L8CA 5KYVA 1P4EA 5AE2A 3J81D 3AY0A 2UU9C 4B3MC 4WV3A 1PA4A 4FUQA 4DR3C 1XMQC 3I08A 3LGXA 4XX2A 1P7LA 4IR7A 3CW9A 2ZZNA 4DR1C 4DG9A 2P2QA 4ISBA 4JI4C 1QWIA 4BC7A 1XNQC 2M5HA 4DV7C 4RM3A 2HHHC 5BSTA 1LCIA 4MH4A 1NY8A 2Y4NA 3TR3A 1MKYA 1NYEA 3B7WA 4JV5C 2QW0X 4BC9A 1MXCA 2PG1E 3NPDA 1XRBA 4HPVA 4L2ZA 1JOSA 1GPMA 2CY1A 3CQ1A 5CZXA 1M6XA 4NXNC 4DCSA 2NCLA 2D7VA 4KTVA 3IEVA 2DYJA 2UXBC 4JI0C 4RLFA 2XR1A 3T1HC 2UXDC 4G1IA 4DV2C 3E7XA 2KDNA 3NYRA 2P2MA 3A26A 1YGTA 4PROC 4JM1A 2Y4OA 4L4QA 5A1GA 4ODJA 1ULTA 5CZVA 4DCUA 1USPA 4WS9A 4LFBC 4D4GA 2EGTA 4PHTA 3ETCA 3E7WA 5A19A 2P20A 3LNOA 4X62C 5BR8C 4OYCA 1MDBA 4DV5C 1IBLC 3GPCA 4YY3C 4ZLPA 1XHJA 1XMOC 5BSVA 5DV9A 4LF6C 2ZZMA 2D1RA 4RM2A 5AE1A 4DV1C 3NI2A 4DV0C 4LE5A 2VZEA 4AQYC 1VLAA 3KXWA 3PESA 2P2JA 4D4IA 3IPLA 1AMUA 4B3RC 4LFAC 3GR0A 5JRHA 1XNRC 4PUIA 3FCEA 4NDNA 3G7SA 2UUAC 1ZB9A 2YX1A 4K0KC 2JMPA 1P4EC 4I9GA 4LF4C 2D1SA 5T8TA 4DCVA 2PT7G 3UX2A 2D1QA 3TUFA 4LF8C 2WP0C 4GXRA 4X66C 5K8FA 1O90A 1N34C 2MCQA 1FLOA 4DUYC 2E5LC 4DR6C 4LF7C 4DR2C 4JI1C 3RV2A 1BA3A 4FUTA 4U5YD 3SO4A 3A9VA 1T5HX 2D1TA 3UZ0A 4PUGA 5LMNC 4JI5C 1UWDA 3I07A 4JI2C 2UXCC 4OXIA 1N33C 1V60A 1IBMC 1ML8A 4R0MA 1XS3A 4DUZC 4R1MA 1WH9A 4DV4C 4DR7C 3C5EA 4PZPA 3GKUA 4GXQA 2BH1X 4B3SC 4KHPC 2OPLB 3VNQA 5T8SA 5BURA 2QVYX 4GKJC 1USPB 1PG3A 3LUSA 1T5DX 4B3TC 1MD9A 1RY2A 3A9UA 2P2FA 1M6XC 3DAYA 2OPLA 4G37A 3LNVA 1N32C 5A2QD 3K6RA 4RVNA 4X64C 5E7QA 1I94C 2CU6A 1MXAA 4JI3C 2P02A 1QM4A 2YWBA 1UKKA 5BUSA 5IT9D 4GS5A 5ADZA 4DV3C 2Y27A 3TDEA 3R9WA 4NXMC 1N2FA 5BSRA 4KTTA 5K85A 3A4IA 4DV6C 1N36C 2ONFA 4DR4C 1EGAA 3H2TA 2ATWA 1HNWC 3L95X 4MTNA 2D27A 4RVOA 1HNZC 4TPSB 2D28C 2ZTBA 3EERA 1XRAA 3AF5A 1HNXC 5BUQA 1HH2P 3OTOC 2QVZX 3CW8X 4OX9C 4JYAC 2YWCA 2E8CA 5KYTA 2OO4A 4DR5C 4R1LA 3LAXA 1VEHA 3CQ3A 2E8FA 2BJOA 2VSQA 4BBYA 2WD9A 3R9XA 2AYAA 1O92A 1K0RA 1O93A 4D57A 3J80D 3J7AD 4K0BA 1FJGC 3UX3A 2Z51A 4DG8A 5IFIA 3CJEA 1PG4A 4JI7C 3FM7A 3EQ6A 3CQ2A
chains in the Genus database with same CATH topology
5BSUA 2VQFC 1O9TA 4BSZA 4FTFA 2V7BA 2UUCC 4G36A 3N2QA 5BSWA 3R44A 2E0GA 4X65C 1MXBA 2UUBC 4IZ6A 5LMUC 3IMLA 3AF6A 2QVXX 1WF3A 3FCCA 5IWAC 1ZB8A 3JAMD 5BSMA 2YCBA 4DCTA 4D56A 3T1YC 4YHHC 4JI6C 5FLXD 5H9UA 4LF9C 3UOWA 3GR1A 2DPLA 4NOZA 3TQIA 4ZJZA 1V25A 2E8EA 1YJ7A 3DHVA 1RG9A 2ASBA 3N54B 5GTDA 4BCAA 2PROA 2OBVA 4GKKC 1IBKC 2F4VC 3RG2A 2E7GA 2P2BA 2QL8A 5KEIA 3VNRA 1XRCA 3PROC 2ZM6C 1LQLA 1HR0C 3PBKA 5A1IA 1KKGA 4LFCC 2PN2A 5AE3A 1V26A 4EATA 3NYQA 2KZFA 4L7IA 4I9FA 3IEUA 2CXCA 3S82A 1FUGA 2HJGA 4JI8C 4RLQA 1J5EC 2VQEC 4RMNA 3DLPX 3ETOA 4LF5C 1L2FA 3VNSA 1MDFA 3L8CA 5KYVA 5AE2A 3J81D 2UU9C 4B3MC 4WV3A 1PA4A 4FUQA 4DR3C 1XMQC 3I08A 3LGXA 4XX2A 1P7LA 4IR7A 3CW9A 4DR1C 4DG9A 2P2QA 4ISBA 4JI4C 1QWIA 4BC7A 1XNQC 4DV7C 4RM3A 2HHHC 5BSTA 1LCIA 4MH4A 2Y4NA 1MKYA 1NYEA 3B7WA 4JV5C 2QW0X 4BC9A 1MXCA 3NPDA 1XRBA 4HPVA 4L2ZA 1JOSA 1GPMA 2CY1A 5CZXA 4NXNC 4DCSA 2D7VA 4KTVA 3IEVA 2DYJA 2UXBC 4JI0C 4RLFA 2XR1A 3T1HC 2UXDC 4G1IA 4DV2C 3E7XA 3NYRA 2P2MA 4PROC 4JM1A 2Y4OA 4L4QA 5A1GA 4ODJA 1ULTA 5CZVA 4DCUA 1USPA 4WS9A 4LFBC 4D4GA 2EGTA 4PHTA 3ETCA 3E7WA 5A19A 2P20A 5BR8C 4X62C 4OYCA 1MDBA 4DV5C 1IBLC 3GPCA 4YY3C 4ZLPA 1XMOC 5BSVA 5DV9A 4LF6C 2D1RA 4RM2A 5AE1A 4DV1C 3NI2A 4DV0C 4LE5A 2VZEA 4AQYC 1VLAA 3KXWA 3PESA 2P2JA 4D4IA 3IPLA 1AMUA 4B3RC 4LFAC 3GR0A 5JRHA 1XNRC 3FCEA 4NDNA 3G7SA 2UUAC 1ZB9A 4K0KC 2JMPA 4I9GA 4LF4C 2D1SA 5T8TA 4DCVA 2PT7G 2D1QA 3TUFA 4LF8C 2WP0C 4GXRA 4X66C 5K8FA 1O90A 1N34C 4DUYC 2E5LC 4DR6C 4LF7C 4DR2C 4JI1C 3RV2A 1BA3A 4FUTA 4U5YD 3SO4A 3A9VA 1T5HX 2D1TA 3UZ0A 5LMNC 4JI5C 4JI2C 3I07A 2UXCC 4OXIA 1N33C 1IBMC 1ML8A 4R0MA 4DUZC 4R1MA 1WH9A 4DV4C 4DR7C 3C5EA 4PZPA 3GKUA 4GXQA 2BH1X 4B3SC 4KHPC 2OPLB 3VNQA 5T8SA 5BURA 2QVYX 4GKJC 1USPB 1PG3A 3LUSA 1T5DX 4B3TC 1MD9A 1RY2A 3A9UA 2P2FA 3DAYA 2OPLA 4G37A 3LNVA 1N32C 5A2QD 4RVNA 4X64C 5E7QA 1I94C 4JI3C 1MXAA 2P02A 1QM4A 2YWBA 1UKKA 5BUSA 5IT9D 4GS5A 5ADZA 4DV3C 2Y27A 3TDEA 3R9WA 4NXMC 1N2FA 5BSRA 4KTTA 5K85A 3A4IA 4DV6C 1N36C 2ONFA 4DR4C 1EGAA 3H2TA 2ATWA 1HNWC 3L95X 4MTNA 2D27A 4RVOA 1HNZC 4TPSB 2D28C 3EERA 1XRAA 3AF5A 1HNXC 5BUQA 1HH2P 3OTOC 2QVZX 3CW8X 4OX9C 4JYAC 2YWCA 2E8CA 5KYTA 2OO4A 4DR5C 4R1LA 3LAXA 2E8FA 2BJOA 2VSQA 4BBYA 2WD9A 3R9XA 2AYAA 1O92A 1K0RA 1O93A 4D57A 3J80D 3J7AD 4K0BA 1FJGC 4DG8A 5IFIA 3CJEA 1PG4A 4JI7C 3EQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 C;  1L2F A;  4DUZ C;  2VQF C;  4BSZ A;  1WH9 A;  4DV4 C;  3J81 D;  2UU9 C;  4DR7 C;  4DCU A;  4B3M C;  2UUC C;  1USP A;  1PA4 A;  4LFB C;  4DR3 C;  2EGT A;  1XMQ C;  3GKU A;  4X65 C;  2UUB C;  4B3S C;  4KHP C;  5LMU C;  4XX2 A;  4X62 C;  5BR8 C;  2OPL B;  4GKJ C;  1USP B;  3AF6 A;  3LUS A;  4DV5 C;  1IBL C;  4B3T C;  1WF3 A;  4YY3 C;  4DR1 C;  5IWA C;  1ZB8 A;  3JAM D;  1XMO C;  2OPL A;  2YCB A;  4DCT A;  4LF6 C;  4JI4 C;  5A2Q D;  1QWI A;  1N32 C;  3T1Y C;  4X64 C;  1XNQ C;  4YHH C;  1I94 C;  4JI3 C;  4DV1 C;  4JI6 C;  5FLX D;  4DV0 C;  1UKK A;  4AQY C;  5IT9 D;  1VLA A;  4LF9 C;  4DV7 C;  4DV3 C;  2HHH C;  4NOZ A;  3R9W A;  4NXM C;  1N2F A;  2E8E A;  4B3R C;  4LFA C;  4MH4 A;  2ASB A;  4DV6 C;  1N36 C;  2ONF A;  1NYE A;  1MKY A;  1EGA A;  1XNR C;  4DR4 C;  2ATW A;  4GKK C;  4JV5 C;  1HNW C;  4MTN A;  1IBK C;  2F4V C;  2UUA C;  2E7G A;  1ZB9 A;  1HNZ C;  4K0K C;  2JMP A;  3EER A;  3AF5 A;  2QL8 A;  1HNX C;  1JOS A;  4LF4 C;  2CY1 A;  1HH2 P;  2ZM6 C;  1LQL A;  4DCV A;  2PT7 G;  3OTO C;  4OX9 C;  4JYA C;  4LF8 C;  1HR0 C;  2E8C A;  4X66 C;  4DR5 C;  4NXN C;  1N34 C;  1KKG A;  4LFC C;  4DCS A;  2PN2 A;  4DUY C;  2E5L C;  4DR6 C;  4LF7 C;  2D7V A;  4DR2 C;  4JI1 C;  2E8F A;  2BJO A;  2KZF A;  3IEV A;  2DYJ A;  3IEU A;  3R9X A;  5LMN C;  2UXB C;  2CXC A;  4JI0 C;  1K0R A;  4JI5 C;  3J80 D;  4JI2 C;  3I07 A;  2UXC C;  3J7A D;  2XR1 A;  2HJG A;  3T1H C;  4JI8 C;  1FJG C;  2UXD C;  1N33 C;  1J5E C;  2VQE C;  4DV2 C;  3CJE A;  1IBM C;  4JI7 C;  1ML8 A; 
#chains in the Genus database with same CATH topology
 5BSU A;  2VQF C;  1O9T A;  4BSZ A;  1IB8 A;  1PU1 A;  4FTF A;  2V7B A;  2UUC C;  4G36 A;  3N2Q A;  5BSW A;  5LCI A;  2KZ0 A;  3O2E A;  3R44 A;  2E0G A;  4X65 C;  1MXB A;  2UUB C;  4IZ6 A;  5LMU C;  3IML A;  1TH5 A;  2JNV A;  3AF6 A;  2DHM A;  2QVX X;  1WF3 A;  3FCC A;  5IWA C;  1ZB8 A;  3JAM D;  5BSM A;  2YCB A;  4DCT A;  2MM9 A;  4D56 A;  3T1Y C;  4YHH C;  4JI6 C;  5FLX D;  5H9U A;  4LF9 C;  3UOW A;  3GR1 A;  2DPL A;  4NOZ A;  3TQI A;  4ZJZ A;  1V25 A;  2E8E A;  1YJ7 A;  3DHV A;  1RG9 A;  4PUH A;  2ASB A;  3N54 B;  5GTD A;  4BCA A;  2PRO A;  2OBV A;  4GKK C;  1IBK C;  2F4V C;  3RG2 A;  2E7G A;  2P2B A;  2QL8 A;  5KEI A;  3VNR A;  1XRC A;  3PRO C;  2ZM6 C;  1LQL A;  1HR0 C;  3PBK A;  5A1I A;  1KKG A;  4LFC C;  2PN2 A;  5AE3 A;  1V26 A;  4EAT A;  1XDX A;  3NYQ A;  2KZF A;  4L7I A;  4I9F A;  3IEU A;  2CXC A;  3S82 A;  2MMA B;  3UEB A;  1FUG A;  2HJG A;  3A25 A;  4JI8 C;  4RLQ A;  1J5E C;  2VQE C;  4RMN A;  3DLP X;  3ETO A;  4LF5 C;  1L2F A;  2M5O A;  3VNS A;  1WCJ A;  1MDF A;  3L8C A;  5KYV A;  1P4E A;  5AE2 A;  3J81 D;  3AY0 A;  2UU9 C;  4B3M C;  4WV3 A;  1PA4 A;  4FUQ A;  4DR3 C;  1XMQ C;  3I08 A;  3LGX A;  4XX2 A;  1P7L A;  4IR7 A;  3CW9 A;  2ZZN A;  4DR1 C;  4DG9 A;  2P2Q A;  4ISB A;  4JI4 C;  1QWI A;  4BC7 A;  1XNQ C;  2M5H A;  4DV7 C;  4RM3 A;  2HHH C;  5BST A;  1LCI A;  4MH4 A;  1NY8 A;  2Y4N A;  3TR3 A;  1MKY A;  1NYE A;  3B7W A;  4JV5 C;  2QW0 X;  4BC9 A;  1MXC A;  2PG1 E;  3NPD A;  1XRB A;  4HPV A;  4L2Z A;  1JOS A;  1GPM A;  2CY1 A;  3CQ1 A;  5CZX A;  1M6X A;  4NXN C;  4DCS A;  2NCL A;  2D7V A;  4KTV A;  3IEV A;  2DYJ A;  2UXB C;  4JI0 C;  4RLF A;  2XR1 A;  3T1H C;  2UXD C;  4G1I A;  4DV2 C;  3E7X A;  2KDN A;  3NYR A;  2P2M A;  3A26 A;  1YGT A;  4PRO C;  4JM1 A;  2Y4O A;  4L4Q A;  5A1G A;  4ODJ A;  1ULT A;  5CZV A;  4DCU A;  1USP A;  4WS9 A;  4LFB C;  4D4G A;  2EGT A;  4PHT A;  3ETC A;  3E7W A;  5A19 A;  2P20 A;  3LNO A;  4X62 C;  5BR8 C;  4OYC A;  1MDB A;  4DV5 C;  1IBL C;  3GPC A;  4YY3 C;  4ZLP A;  1XHJ A;  1XMO C;  5BSV A;  5DV9 A;  4LF6 C;  2ZZM A;  2D1R A;  4RM2 A;  5AE1 A;  4DV1 C;  3NI2 A;  4DV0 C;  4LE5 A;  2VZE A;  4AQY C;  1VLA A;  3KXW A;  3PES A;  2P2J A;  4D4I A;  3IPL A;  1AMU A;  4B3R C;  4LFA C;  3GR0 A;  5JRH A;  1XNR C;  4PUI A;  3FCE A;  4NDN A;  3G7S A;  2UUA C;  1ZB9 A;  2YX1 A;  4K0K C;  2JMP A;  1P4E C;  4I9G A;  4LF4 C;  2D1S A;  5T8T A;  4DCV A;  2PT7 G;  3UX2 A;  2D1Q A;  3TUF A;  4LF8 C;  2WP0 C;  4GXR A;  4X66 C;  5K8F A;  1O90 A;  1N34 C;  2MCQ A;  1FLO A;  4DUY C;  2E5L C;  4DR6 C;  4LF7 C;  4DR2 C;  4JI1 C;  3RV2 A;  1BA3 A;  4FUT A;  4U5Y D;  3SO4 A;  3A9V A;  1T5H X;  2D1T A;  3UZ0 A;  4PUG A;  5LMN C;  4JI5 C;  1UWD A;  3I07 A;  4JI2 C;  2UXC C;  4OXI A;  1N33 C;  1V60 A;  1IBM C;  1ML8 A;  4R0M A;  1XS3 A;  4DUZ C;  4R1M A;  1WH9 A;  4DV4 C;  4DR7 C;  3C5E A;  4PZP A;  3GKU A;  4GXQ A;  2BH1 X;  4B3S C;  4KHP C;  2OPL B;  3VNQ A;  5T8S A;  5BUR A;  2QVY X;  4GKJ C;  1USP B;  1PG3 A;  3LUS A;  1T5D X;  4B3T C;  1MD9 A;  1RY2 A;  3A9U A;  2P2F A;  1M6X C;  3DAY A;  2OPL A;  4G37 A;  3LNV A;  1N32 C;  5A2Q D;  3K6R A;  4RVN A;  4X64 C;  5E7Q A;  1I94 C;  2CU6 A;  1MXA A;  4JI3 C;  2P02 A;  1QM4 A;  2YWB A;  1UKK A;  5BUS A;  5IT9 D;  4GS5 A;  5ADZ A;  4DV3 C;  2Y27 A;  3TDE A;  3R9W A;  4NXM C;  1N2F A;  5BSR A;  4KTT A;  5K85 A;  3A4I A;  4DV6 C;  1N36 C;  2ONF A;  4DR4 C;  1EGA A;  3H2T A;  2ATW A;  1HNW C;  3L95 X;  4MTN A;  2D27 A;  4RVO A;  1HNZ C;  4TPS B;  2D28 C;  2ZTB A;  3EER A;  1XRA A;  3AF5 A;  1HNX C;  5BUQ A;  1HH2 P;  3OTO C;  2QVZ X;  3CW8 X;  4OX9 C;  4JYA C;  2YWC A;  2E8C A;  5KYT A;  2OO4 A;  4DR5 C;  4R1L A;  3LAX A;  1VEH A;  3CQ3 A;  2E8F A;  2BJO A;  2VSQ A;  4BBY A;  2WD9 A;  3R9X A;  2AYA A;  1O92 A;  1K0R A;  1O93 A;  4D57 A;  3J80 D;  3J7A D;  4K0B A;  1FJG C;  3UX3 A;  2Z51 A;  4DG8 A;  5IFI A;  3CJE A;  1PG4 A;  4JI7 C;  3FM7 A;  3EQ6 A;  3CQ2 A; 
#chains in the Genus database with same CATH homology
 5BSU A;  2VQF C;  1O9T A;  4BSZ A;  4FTF A;  2V7B A;  2UUC C;  4G36 A;  3N2Q A;  5BSW A;  3R44 A;  2E0G A;  4X65 C;  1MXB A;  2UUB C;  4IZ6 A;  5LMU C;  3IML A;  3AF6 A;  2QVX X;  1WF3 A;  3FCC A;  5IWA C;  1ZB8 A;  3JAM D;  5BSM A;  2YCB A;  4DCT A;  4D56 A;  3T1Y C;  4YHH C;  4JI6 C;  5FLX D;  5H9U A;  4LF9 C;  3UOW A;  3GR1 A;  2DPL A;  4NOZ A;  3TQI A;  4ZJZ A;  1V25 A;  2E8E A;  1YJ7 A;  3DHV A;  1RG9 A;  2ASB A;  3N54 B;  5GTD A;  4BCA A;  2PRO A;  2OBV A;  4GKK C;  1IBK C;  2F4V C;  3RG2 A;  2E7G A;  2P2B A;  2QL8 A;  5KEI A;  3VNR A;  1XRC A;  3PRO C;  2ZM6 C;  1LQL A;  1HR0 C;  3PBK A;  5A1I A;  1KKG A;  4LFC C;  2PN2 A;  5AE3 A;  1V26 A;  4EAT A;  3NYQ A;  2KZF A;  4L7I A;  4I9F A;  3IEU A;  2CXC A;  3S82 A;  1FUG A;  2HJG A;  4JI8 C;  4RLQ A;  1J5E C;  2VQE C;  4RMN A;  3DLP X;  3ETO A;  4LF5 C;  1L2F A;  3VNS A;  1MDF A;  3L8C A;  5KYV A;  5AE2 A;  3J81 D;  2UU9 C;  4B3M C;  4WV3 A;  1PA4 A;  4FUQ A;  4DR3 C;  1XMQ C;  3I08 A;  3LGX A;  4XX2 A;  1P7L A;  4IR7 A;  3CW9 A;  4DR1 C;  4DG9 A;  2P2Q A;  4ISB A;  4JI4 C;  1QWI A;  4BC7 A;  1XNQ C;  4DV7 C;  4RM3 A;  2HHH C;  5BST A;  1LCI A;  4MH4 A;  2Y4N A;  1MKY A;  1NYE A;  3B7W A;  4JV5 C;  2QW0 X;  4BC9 A;  1MXC A;  3NPD A;  1XRB A;  4HPV A;  4L2Z A;  1JOS A;  1GPM A;  2CY1 A;  5CZX A;  4NXN C;  4DCS A;  2D7V A;  4KTV A;  3IEV A;  2DYJ A;  2UXB C;  4JI0 C;  4RLF A;  2XR1 A;  3T1H C;  2UXD C;  4G1I A;  4DV2 C;  3E7X A;  3NYR A;  2P2M A;  4PRO C;  4JM1 A;  2Y4O A;  4L4Q A;  5A1G A;  4ODJ A;  1ULT A;  5CZV A;  4DCU A;  1USP A;  4WS9 A;  4LFB C;  4D4G A;  2EGT A;  4PHT A;  3ETC A;  3E7W A;  5A19 A;  2P20 A;  5BR8 C;  4X62 C;  4OYC A;  1MDB A;  4DV5 C;  1IBL C;  3GPC A;  4YY3 C;  4ZLP A;  1XMO C;  5BSV A;  5DV9 A;  4LF6 C;  2D1R A;  4RM2 A;  5AE1 A;  4DV1 C;  3NI2 A;  4DV0 C;  4LE5 A;  2VZE A;  4AQY C;  1VLA A;  3KXW A;  3PES A;  2P2J A;  4D4I A;  3IPL A;  1AMU A;  4B3R C;  4LFA C;  3GR0 A;  5JRH A;  1XNR C;  3FCE A;  4NDN A;  3G7S A;  2UUA C;  1ZB9 A;  4K0K C;  2JMP A;  4I9G A;  4LF4 C;  2D1S A;  5T8T A;  4DCV A;  2PT7 G;  2D1Q A;  3TUF A;  4LF8 C;  2WP0 C;  4GXR A;  4X66 C;  5K8F A;  1O90 A;  1N34 C;  4DUY C;  2E5L C;  4DR6 C;  4LF7 C;  4DR2 C;  4JI1 C;  3RV2 A;  1BA3 A;  4FUT A;  4U5Y D;  3SO4 A;  3A9V A;  1T5H X;  2D1T A;  3UZ0 A;  5LMN C;  4JI5 C;  4JI2 C;  3I07 A;  2UXC C;  4OXI A;  1N33 C;  1IBM C;  1ML8 A;  4R0M A;  4DUZ C;  4R1M A;  1WH9 A;  4DV4 C;  4DR7 C;  3C5E A;  4PZP A;  3GKU A;  4GXQ A;  2BH1 X;  4B3S C;  4KHP C;  2OPL B;  3VNQ A;  5T8S A;  5BUR A;  2QVY X;  4GKJ C;  1USP B;  1PG3 A;  3LUS A;  1T5D X;  4B3T C;  1MD9 A;  1RY2 A;  3A9U A;  2P2F A;  3DAY A;  2OPL A;  4G37 A;  3LNV A;  1N32 C;  5A2Q D;  4RVN A;  4X64 C;  5E7Q A;  1I94 C;  4JI3 C;  1MXA A;  2P02 A;  1QM4 A;  2YWB A;  1UKK A;  5BUS A;  5IT9 D;  4GS5 A;  5ADZ A;  4DV3 C;  2Y27 A;  3TDE A;  3R9W A;  4NXM C;  1N2F A;  5BSR A;  4KTT A;  5K85 A;  3A4I A;  4DV6 C;  1N36 C;  2ONF A;  4DR4 C;  1EGA A;  3H2T A;  2ATW A;  1HNW C;  3L95 X;  4MTN A;  2D27 A;  4RVO A;  1HNZ C;  4TPS B;  2D28 C;  3EER A;  1XRA A;  3AF5 A;  1HNX C;  5BUQ A;  1HH2 P;  3OTO C;  2QVZ X;  3CW8 X;  4OX9 C;  4JYA C;  2YWC A;  2E8C A;  5KYT A;  2OO4 A;  4DR5 C;  4R1L A;  3LAX A;  2E8F A;  2BJO A;  2VSQ A;  4BBY A;  2WD9 A;  3R9X A;  2AYA A;  1O92 A;  1K0R A;  1O93 A;  4D57 A;  3J80 D;  3J7A D;  4K0B A;  1FJG C;  4DG8 A;  5IFI A;  3CJE A;  1PG4 A;  4JI7 C;  3EQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...