3J80D

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
223
Chain Sequence
AIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRATKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHSGQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKALPDAVTIIEPKEEEPVLEPSVKDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 44
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
D PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3j80D01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3j80D02
2UU9C 4JI2C 1WH9A 4MTNA 4JI7C 4DCTA 3J81D 3EERA 4JYAC 2D7VA 4X65C 4BSZA 4GKJC 1HH2P 4JI3C 3R9WA 2BJOA 1ML8A 2E8EA 2PN2A 4DV2C 4KHPC 1XNQC 2QL8A 5A2QD 1MKYA 1IBKC 2UUAC 4DV5C 3T1HC 2UXBC 3J7AD 2ZM6C 1QWIA 2XR1A 5FLXD 4DR7C 4DR3C 1ZB9A 3AF5A 1LQLA 2UUCC 4NOZA 2CY1A 3AF6A 1XNRC 4DR2C 2UXCC 5BR8C 1K0RA 1JOSA 2OPLB 4X66C 1FJGC 4YHHC 4JI1C 4JV5C 4DCVA 1N34C 4DCSA 3IEVA 4DR6C 1WF3A 2E8FA 4MH4A 4LF6C 4DUYC 2YCBA 4B3TC 3CJEA 1USPB 4LFAC 3J80D 1N2FA 2CXCA 2EGTA 4DV6C 4X62C 4JI0C 4DR4C 4LFCC 4GKKC 2HJGA 1J5EC 1NYEA 1L2FA 1KKGA 3GKUA 4B3MC 4NXNC 4DV1C 4DR1C 5IT9D 2VQEC 2ASBA 1N33C 2UUBC 2F4VC 2ATWA 4AQYC 4LF7C 4LF4C 4DV3C 4LF9C 3OTOC 2E5LC 1HNWC 4X64C 4JI4C 5IWAC 5LMUC 2PT7G 1N36C 1N32C 1VLAA 1IBMC 3R9XA 2KZFA 4LFBC 1PA4A 1UKKA 4JI8C 1EGAA 1USPA 4DR5C 4K0KC 2OPLA 1HNXC 4DCUA 4B3SC 4OX9C 2VQFC 1HR0C 2ONFA 3JAMD 2UXDC 4YY3C 1XMQC 2E8CA 5LMNC 1I94C 3T1YC 3LUSA 1IBLC 4DUZC 4XX2A 4JI6C 1XMOC 1HNZC 4LF8C 4LF5C 2DYJA 4DV7C 1ZB8A 2E7GA 2HHHC 4B3RC 3I07A 4JI5C 3IEUA 4NXMC 4DV0C 4DV4C 2JMPA
chains in the Genus database with same CATH superfamily
2UU9C 4ODJA 5AE2A 4IZ6A 2P2QA 4JI3C 4DG8A 1XRAA 2MM9A 2BJOA 1ML8A 2D1TA 2PN2A 5A2QD 1MKYA 3CQ3A 5DV9A 3T1HC 2ZM6C 5H9UA 4KTVA 4DR7C 3GPCA 4RLFA 5LCIA 3A9VA 1JOSA 2OPLB 4FUQA 4JI1C 4DR6C 2E8FA 4LF6C 3NYRA 5T8SA 4LFAC 1FLOA 1N2FA 1RG9A 4HPVA 1P4EA 4X62C 4GKKC 2WP0C 1J5EC 1O93A 3GKUA 4NXNC 5KYTA 2VQEC 3UX2A 2UUBC 3R44A 3LNVA 4AQYC 3KXWA 4U5YD 4PZPA 2P2FA 3N54B 2DPLA 5IWAC 2QW0X 5LMUC 2PT7G 1VLAA 2D27A 2KZFA 1UKKA 4JI8C 1EGAA 1USPA 3UEBA 4B3SC 4PUGA 2VQFC 4R0MA 1ULTA 2ONFA 1HR0C 2UXDC 5BSTA 4YY3C 3ETOA 2E8CA 3EQ6A 1P4EC 1I94C 3LUSA 3CW9A 1XDXA 1TH5A 4B3RC 1O92A 4JI5C 3VNQA 3TR3A 4GXRA 1NY8A 4JI2C 1WH9A 3IPLA 4JI7C 3J81D 4G37A 3EERA 4GKJC 4BSZA 3R9WA 1FUGA 2QVZX 2E8EA 4DV2C 4KHPC 2QL8A 2UXBC 4ZLPA 5BUSA 1PG4A 4D56A 5FLXD 4OXIA 1ZB9A 1LQLA 2OBVA 3NI2A 4NOZA 3AF6A 2QVYX 4BC9A 3G7SA 4DCVA 1USPB 3PBKA 3J80D 1V25A 2E0GA 3K6RA 2CXCA 4G36A 3ETCA 4JI0C 3VNSA 1T5HX 5A19A 4PUIA 5BSWA 1M6XC 1KKGA 3FCCA 4DV1C 4DR1C 3C5EA 1M6XA 2AYAA 2ATWA 3O2EA 1AMUA 3N2QA 1RY2A 4X64C 3A25A 1N36C 2JNVA 1N32C 1IBMC 5AE1A 4KTTA 1VEHA 4DR5C 4K0KC 2OO4A 3RV2A 4OX9C 3LGXA 1XMQC 3TQIA 5CZXA 1P7LA 4XX2A 2MCQA 1XMOC 4RM2A 2M5OA 1O90A 2DYJA 3CW8X 4DV7C 2HHHC 2D28C 1YJ7A 4NXMC 5BSUA 1MXCA 4DV4C 4MTNA 4DCTA 3LNOA 4PUHA 4X65C 1V60A 3NYQA 2Y27A 4FTFA 4EATA 4OYCA 2P2BA 4LE5A 1IBKC 1GPMA 2D1QA 4DV5C 4R1MA 2Y4OA 4ZJZA 2D1RA 1QWIA 2XR1A 2QVXX 4DR3C 3AF5A 2P20A 3LAXA 1XNRC 5A1IA 2UXCC 2P2JA 5BSVA 5IFIA 5A1GA 1LCIA 4DCSA 4L7IA 4DUYC 2YCBA 4B3TC 3CJEA 4RM3A 2P2MA 2WD9A 4G1IA 1PU1A 2D1SA 3PESA 5GTDA 4ISBA 4L2ZA 4LFCC 3E7WA 4DR4C 2BH1X 2HJGA 5KYVA 1NYEA 1L2FA 1BA3A 5T8TA 4FUTA 1UWDA 3B7WA 3L95X 2NCLA 2F4VC 5BURA 3A4IA 4LF9C 3GR1A 4RLQA 3OTOC 2E5LC 2VSQA 3UOWA 1V26A 2Z51A 4LFBC 4D4IA 4K0BA 2OPLA 3GR0A 2PROA 1MXBA 5K85A 3JAMD 2KZ0A 2P02A 3CQ2A 5K8FA 5E7QA 1IBLC 4DUZC 3FCEA 1PG3A 2DHMA 3A26A 5JRHA 4RMNA 3SO4A 1ZB8A 1IB8A 1XS3A 3I07A 4DV0C 2ZZNA 3TDEA 2YWBA 4GS5A 1YGTA 5BSMA 4JYAC 2D7VA 1HH2P 3A9UA 5BSRA 3DHVA 3TUFA 1QM4A 2V7BA 3AY0A 4PROC 1XNQC 2UUAC 5KEIA 5AE3A 1MDFA 4DG9A 5BUQA 3J7AD 4BCAA 1MXAA 3DAYA 3DLPX 2UUCC 2CY1A 3RG2A 4RVNA 4DR2C 4L4QA 1K0RA 4R1LA 3CQ1A 5BR8C 5CZVA 4X66C 1FJGC 4YHHC 1MD9A 4JV5C 1N34C 3IEVA 1WF3A 4MH4A 3L8CA 4D4GA 4BC7A 3S82A 4JM1A 3UZ0A 4NDNA 3IMLA 2YX1A 2EGTA 2KDNA 4DV6C 2PG1E 4BBYA 4IR7A 3PROC 2CU6A 4B3MC 3E7XA 5IT9D 2ASBA 1N33C 2ZZMA 4LF7C 4LF4C 4DV3C 1T5DX 2MMAB 4PHTA 2M5HA 1HNWC 1XRBA 1XRCA 3UX3A 4JI4C 4GXQA 2VZEA 3NPDA 3R9XA 1PA4A 1WCJA 1HNXC 4DCUA 4WV3A 2ZTBA 1O9TA 2Y4NA 4WS9A 5LMNC 1XHJA 5ADZA 4I9GA 3T1YC 4D57A 3I08A 4JI6C 4TPSB 1HNZC 2YWCA 4LF8C 4LF5C 3VNRA 3FM7A 1MDBA 2E7GA 4I9FA 4RVOA 3IEUA 3H2TA 2JMPA
chains in the Genus database with same CATH topology
2UU9C 4ODJA 5AE2A 4IZ6A 2P2QA 4JI3C 4DG8A 1XRAA 2BJOA 1ML8A 2D1TA 2PN2A 5A2QD 1MKYA 5DV9A 3T1HC 2ZM6C 5H9UA 4KTVA 4DR7C 3GPCA 4RLFA 3A9VA 1JOSA 2OPLB 4FUQA 4JI1C 4DR6C 2E8FA 4LF6C 3NYRA 5T8SA 4LFAC 1N2FA 1RG9A 4HPVA 4X62C 4GKKC 2WP0C 1J5EC 1O93A 3GKUA 4NXNC 5KYTA 2VQEC 2UUBC 3R44A 3LNVA 4AQYC 3KXWA 4U5YD 4PZPA 2P2FA 3N54B 2DPLA 5IWAC 2QW0X 5LMUC 2PT7G 1VLAA 2D27A 2KZFA 1UKKA 4JI8C 1EGAA 1USPA 4B3SC 2VQFC 4R0MA 1HR0C 1ULTA 2ONFA 2UXDC 5BSTA 4YY3C 3ETOA 2E8CA 3EQ6A 1I94C 3LUSA 3CW9A 4B3RC 1O92A 4JI5C 3VNQA 4GXRA 4JI2C 1WH9A 3IPLA 4JI7C 3J81D 4G37A 3EERA 4GKJC 4BSZA 3R9WA 1FUGA 2QVZX 2E8EA 4DV2C 4KHPC 2QL8A 2UXBC 4ZLPA 5BUSA 1PG4A 4D56A 5FLXD 4OXIA 1ZB9A 1LQLA 2OBVA 3NI2A 4NOZA 3AF6A 2QVYX 4BC9A 3G7SA 4DCVA 1USPB 3PBKA 3J80D 1V25A 2E0GA 2CXCA 4G36A 3ETCA 4JI0C 3VNSA 1T5HX 5A19A 5BSWA 1KKGA 3FCCA 4DV1C 4DR1C 3C5EA 2AYAA 2ATWA 1AMUA 3N2QA 1RY2A 4X64C 1N36C 1N32C 1IBMC 5AE1A 4KTTA 4DR5C 4K0KC 2OO4A 3RV2A 4OX9C 3LGXA 1XMQC 3TQIA 5CZXA 1P7LA 4XX2A 1XMOC 4RM2A 1O90A 2DYJA 3CW8X 4DV7C 2HHHC 2D28C 1YJ7A 4NXMC 5BSUA 1MXCA 4DV4C 4MTNA 4DCTA 4X65C 3NYQA 2Y27A 4FTFA 4EATA 4OYCA 2P2BA 4LE5A 1IBKC 1GPMA 2D1QA 4DV5C 4R1MA 2Y4OA 4ZJZA 2D1RA 1QWIA 2XR1A 2QVXX 4DR3C 3AF5A 2P20A 3LAXA 1XNRC 5A1IA 2UXCC 2P2JA 5BSVA 5IFIA 5A1GA 1LCIA 4DCSA 4L7IA 4DUYC 2YCBA 4B3TC 3CJEA 4RM3A 2P2MA 2WD9A 4G1IA 2D1SA 3PESA 5GTDA 4ISBA 4L2ZA 4LFCC 3E7WA 4DR4C 2BH1X 2HJGA 5KYVA 1NYEA 1L2FA 1BA3A 5T8TA 4FUTA 3B7WA 3L95X 2F4VC 5BURA 3A4IA 4LF9C 3GR1A 4RLQA 3OTOC 2E5LC 2VSQA 3UOWA 1V26A 4LFBC 4D4IA 4K0BA 2OPLA 3GR0A 2PROA 1MXBA 5K85A 3JAMD 2P02A 5K8FA 5E7QA 1IBLC 4DUZC 3FCEA 1PG3A 5JRHA 4RMNA 3SO4A 1ZB8A 3I07A 4DV0C 3TDEA 2YWBA 4GS5A 5BSMA 4JYAC 2D7VA 1HH2P 3A9UA 5BSRA 3DHVA 3TUFA 1QM4A 2V7BA 4PROC 1XNQC 2UUAC 5KEIA 5AE3A 1MDFA 4DG9A 5BUQA 3J7AD 4BCAA 1MXAA 3DAYA 3DLPX 2UUCC 2CY1A 3RG2A 4RVNA 4DR2C 4L4QA 1K0RA 4R1LA 5BR8C 5CZVA 4X66C 1FJGC 4YHHC 1MD9A 4JV5C 1N34C 3IEVA 1WF3A 4MH4A 3L8CA 4D4GA 4BC7A 3S82A 4JM1A 3UZ0A 4NDNA 3IMLA 2EGTA 4DV6C 4BBYA 4IR7A 3PROC 4B3MC 3E7XA 5IT9D 2ASBA 1N33C 4LF7C 4LF4C 4DV3C 1T5DX 4PHTA 1HNWC 1XRBA 1XRCA 4GXQA 4JI4C 2VZEA 3NPDA 3R9XA 1PA4A 1HNXC 4DCUA 4WV3A 1O9TA 2Y4NA 4WS9A 5LMNC 5ADZA 4I9GA 3T1YC 4D57A 3I08A 4JI6C 4TPSB 1HNZC 2YWCA 4LF8C 4LF5C 3VNRA 1MDBA 2E7GA 4I9FA 4RVOA 3IEUA 3H2TA 2JMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 C;  4JI2 C;  1WH9 A;  4MTN A;  4JI7 C;  4DCT A;  3J81 D;  3EER A;  4JYA C;  2D7V A;  4X65 C;  4BSZ A;  4GKJ C;  1HH2 P;  4JI3 C;  3R9W A;  2BJO A;  1ML8 A;  2E8E A;  2PN2 A;  4DV2 C;  4KHP C;  1XNQ C;  2QL8 A;  5A2Q D;  1MKY A;  1IBK C;  2UUA C;  4DV5 C;  3T1H C;  2UXB C;  3J7A D;  2ZM6 C;  1QWI A;  2XR1 A;  5FLX D;  4DR7 C;  4DR3 C;  1ZB9 A;  3AF5 A;  1LQL A;  2UUC C;  4NOZ A;  2CY1 A;  3AF6 A;  1XNR C;  4DR2 C;  2UXC C;  5BR8 C;  1K0R A;  1JOS A;  2OPL B;  4X66 C;  1FJG C;  4YHH C;  4JI1 C;  4JV5 C;  4DCV A;  1N34 C;  4DCS A;  3IEV A;  4DR6 C;  1WF3 A;  2E8F A;  4MH4 A;  4LF6 C;  4DUY C;  2YCB A;  4B3T C;  3CJE A;  1USP B;  4LFA C;  3J80 D;  1N2F A;  2CXC A;  2EGT A;  4DV6 C;  4X62 C;  4JI0 C;  4DR4 C;  4LFC C;  4GKK C;  2HJG A;  1J5E C;  1NYE A;  1L2F A;  1KKG A;  3GKU A;  4B3M C;  4NXN C;  4DV1 C;  4DR1 C;  5IT9 D;  2VQE C;  2ASB A;  1N33 C;  2UUB C;  2F4V C;  2ATW A;  4AQY C;  4LF7 C;  4LF4 C;  4DV3 C;  4LF9 C;  3OTO C;  2E5L C;  1HNW C;  4X64 C;  4JI4 C;  5IWA C;  5LMU C;  2PT7 G;  1N36 C;  1N32 C;  1VLA A;  1IBM C;  3R9X A;  2KZF A;  4LFB C;  1PA4 A;  1UKK A;  4JI8 C;  1EGA A;  1USP A;  4DR5 C;  4K0K C;  2OPL A;  1HNX C;  4DCU A;  4B3S C;  4OX9 C;  2VQF C;  1HR0 C;  2ONF A;  3JAM D;  2UXD C;  4YY3 C;  1XMQ C;  2E8C A;  5LMN C;  1I94 C;  3T1Y C;  3LUS A;  1IBL C;  4DUZ C;  4XX2 A;  4JI6 C;  1XMO C;  1HNZ C;  4LF8 C;  4LF5 C;  2DYJ A;  4DV7 C;  1ZB8 A;  2E7G A;  2HHH C;  4B3R C;  3I07 A;  4JI5 C;  3IEU A;  4NXM C;  4DV0 C;  4DV4 C;  2JMP A; 
#chains in the Genus database with same CATH topology
 2UU9 C;  4ODJ A;  5AE2 A;  4IZ6 A;  2P2Q A;  4JI3 C;  4DG8 A;  1XRA A;  2MM9 A;  2BJO A;  1ML8 A;  2D1T A;  2PN2 A;  5A2Q D;  1MKY A;  3CQ3 A;  5DV9 A;  3T1H C;  2ZM6 C;  5H9U A;  4KTV A;  4DR7 C;  3GPC A;  4RLF A;  5LCI A;  3A9V A;  1JOS A;  2OPL B;  4FUQ A;  4JI1 C;  4DR6 C;  2E8F A;  4LF6 C;  3NYR A;  5T8S A;  4LFA C;  1FLO A;  1N2F A;  1RG9 A;  4HPV A;  1P4E A;  4X62 C;  4GKK C;  2WP0 C;  1J5E C;  1O93 A;  3GKU A;  4NXN C;  5KYT A;  2VQE C;  3UX2 A;  2UUB C;  3R44 A;  3LNV A;  4AQY C;  3KXW A;  4U5Y D;  4PZP A;  2P2F A;  3N54 B;  2DPL A;  5IWA C;  2QW0 X;  5LMU C;  2PT7 G;  1VLA A;  2D27 A;  2KZF A;  1UKK A;  4JI8 C;  1EGA A;  1USP A;  3UEB A;  4B3S C;  4PUG A;  2VQF C;  4R0M A;  1ULT A;  2ONF A;  1HR0 C;  2UXD C;  5BST A;  4YY3 C;  3ETO A;  2E8C A;  3EQ6 A;  1P4E C;  1I94 C;  3LUS A;  3CW9 A;  1XDX A;  1TH5 A;  4B3R C;  1O92 A;  4JI5 C;  3VNQ A;  3TR3 A;  4GXR A;  1NY8 A;  4JI2 C;  1WH9 A;  3IPL A;  4JI7 C;  3J81 D;  4G37 A;  3EER A;  4GKJ C;  4BSZ A;  3R9W A;  1FUG A;  2QVZ X;  2E8E A;  4DV2 C;  4KHP C;  2QL8 A;  2UXB C;  4ZLP A;  5BUS A;  1PG4 A;  4D56 A;  5FLX D;  4OXI A;  1ZB9 A;  1LQL A;  2OBV A;  3NI2 A;  4NOZ A;  3AF6 A;  2QVY X;  4BC9 A;  3G7S A;  4DCV A;  1USP B;  3PBK A;  3J80 D;  1V25 A;  2E0G A;  3K6R A;  2CXC A;  4G36 A;  3ETC A;  4JI0 C;  3VNS A;  1T5H X;  5A19 A;  4PUI A;  5BSW A;  1M6X C;  1KKG A;  3FCC A;  4DV1 C;  4DR1 C;  3C5E A;  1M6X A;  2AYA A;  2ATW A;  3O2E A;  1AMU A;  3N2Q A;  1RY2 A;  4X64 C;  3A25 A;  1N36 C;  2JNV A;  1N32 C;  1IBM C;  5AE1 A;  4KTT A;  1VEH A;  4DR5 C;  4K0K C;  2OO4 A;  3RV2 A;  4OX9 C;  3LGX A;  1XMQ C;  3TQI A;  5CZX A;  1P7L A;  4XX2 A;  2MCQ A;  1XMO C;  4RM2 A;  2M5O A;  1O90 A;  2DYJ A;  3CW8 X;  4DV7 C;  2HHH C;  2D28 C;  1YJ7 A;  4NXM C;  5BSU A;  1MXC A;  4DV4 C;  4MTN A;  4DCT A;  3LNO A;  4PUH A;  4X65 C;  1V60 A;  3NYQ A;  2Y27 A;  4FTF A;  4EAT A;  4OYC A;  2P2B A;  4LE5 A;  1IBK C;  1GPM A;  2D1Q A;  4DV5 C;  4R1M A;  2Y4O A;  4ZJZ A;  2D1R A;  1QWI A;  2XR1 A;  2QVX X;  4DR3 C;  3AF5 A;  2P20 A;  3LAX A;  1XNR C;  5A1I A;  2UXC C;  2P2J A;  5BSV A;  5IFI A;  5A1G A;  1LCI A;  4DCS A;  4L7I A;  4DUY C;  2YCB A;  4B3T C;  3CJE A;  4RM3 A;  2P2M A;  2WD9 A;  4G1I A;  1PU1 A;  2D1S A;  3PES A;  5GTD A;  4ISB A;  4L2Z A;  4LFC C;  3E7W A;  4DR4 C;  2BH1 X;  2HJG A;  5KYV A;  1NYE A;  1L2F A;  1BA3 A;  5T8T A;  4FUT A;  1UWD A;  3B7W A;  3L95 X;  2NCL A;  2F4V C;  5BUR A;  3A4I A;  4LF9 C;  3GR1 A;  4RLQ A;  3OTO C;  2E5L C;  2VSQ A;  3UOW A;  1V26 A;  2Z51 A;  4LFB C;  4D4I A;  4K0B A;  2OPL A;  3GR0 A;  2PRO A;  1MXB A;  5K85 A;  3JAM D;  2KZ0 A;  2P02 A;  3CQ2 A;  5K8F A;  5E7Q A;  1IBL C;  4DUZ C;  3FCE A;  1PG3 A;  2DHM A;  3A26 A;  5JRH A;  4RMN A;  3SO4 A;  1ZB8 A;  1IB8 A;  1XS3 A;  3I07 A;  4DV0 C;  2ZZN A;  3TDE A;  2YWB A;  4GS5 A;  1YGT A;  5BSM A;  4JYA C;  2D7V A;  1HH2 P;  3A9U A;  5BSR A;  3DHV A;  3TUF A;  1QM4 A;  2V7B A;  3AY0 A;  4PRO C;  1XNQ C;  2UUA C;  5KEI A;  5AE3 A;  1MDF A;  4DG9 A;  5BUQ A;  3J7A D;  4BCA A;  1MXA A;  3DAY A;  3DLP X;  2UUC C;  2CY1 A;  3RG2 A;  4RVN A;  4DR2 C;  4L4Q A;  1K0R A;  4R1L A;  3CQ1 A;  5BR8 C;  5CZV A;  4X66 C;  1FJG C;  4YHH C;  1MD9 A;  4JV5 C;  1N34 C;  3IEV A;  1WF3 A;  4MH4 A;  3L8C A;  4D4G A;  4BC7 A;  3S82 A;  4JM1 A;  3UZ0 A;  4NDN A;  3IML A;  2YX1 A;  2EGT A;  2KDN A;  4DV6 C;  2PG1 E;  4BBY A;  4IR7 A;  3PRO C;  2CU6 A;  4B3M C;  3E7X A;  5IT9 D;  2ASB A;  1N33 C;  2ZZM A;  4LF7 C;  4LF4 C;  4DV3 C;  1T5D X;  2MMA B;  4PHT A;  2M5H A;  1HNW C;  1XRB A;  1XRC A;  3UX3 A;  4JI4 C;  4GXQ A;  2VZE A;  3NPD A;  3R9X A;  1PA4 A;  1WCJ A;  1HNX C;  4DCU A;  4WV3 A;  2ZTB A;  1O9T A;  2Y4N A;  4WS9 A;  5LMN C;  1XHJ A;  5ADZ A;  4I9G A;  3T1Y C;  4D57 A;  3I08 A;  4JI6 C;  4TPS B;  1HNZ C;  2YWC A;  4LF8 C;  4LF5 C;  3VNR A;  3FM7 A;  1MDB A;  2E7G A;  4I9F A;  4RVO A;  3IEU A;  3H2T A;  2JMP A; 
#chains in the Genus database with same CATH homology
 2UU9 C;  4ODJ A;  5AE2 A;  4IZ6 A;  2P2Q A;  4JI3 C;  4DG8 A;  1XRA A;  2BJO A;  1ML8 A;  2D1T A;  2PN2 A;  5A2Q D;  1MKY A;  5DV9 A;  3T1H C;  2ZM6 C;  5H9U A;  4KTV A;  4DR7 C;  3GPC A;  4RLF A;  3A9V A;  1JOS A;  2OPL B;  4FUQ A;  4JI1 C;  4DR6 C;  2E8F A;  4LF6 C;  3NYR A;  5T8S A;  4LFA C;  1N2F A;  1RG9 A;  4HPV A;  4X62 C;  4GKK C;  2WP0 C;  1J5E C;  1O93 A;  3GKU A;  4NXN C;  5KYT A;  2VQE C;  2UUB C;  3R44 A;  3LNV A;  4AQY C;  3KXW A;  4U5Y D;  4PZP A;  2P2F A;  3N54 B;  2DPL A;  5IWA C;  2QW0 X;  5LMU C;  2PT7 G;  1VLA A;  2D27 A;  2KZF A;  1UKK A;  4JI8 C;  1EGA A;  1USP A;  4B3S C;  2VQF C;  4R0M A;  1HR0 C;  1ULT A;  2ONF A;  2UXD C;  5BST A;  4YY3 C;  3ETO A;  2E8C A;  3EQ6 A;  1I94 C;  3LUS A;  3CW9 A;  4B3R C;  1O92 A;  4JI5 C;  3VNQ A;  4GXR A;  4JI2 C;  1WH9 A;  3IPL A;  4JI7 C;  3J81 D;  4G37 A;  3EER A;  4GKJ C;  4BSZ A;  3R9W A;  1FUG A;  2QVZ X;  2E8E A;  4DV2 C;  4KHP C;  2QL8 A;  2UXB C;  4ZLP A;  5BUS A;  1PG4 A;  4D56 A;  5FLX D;  4OXI A;  1ZB9 A;  1LQL A;  2OBV A;  3NI2 A;  4NOZ A;  3AF6 A;  2QVY X;  4BC9 A;  3G7S A;  4DCV A;  1USP B;  3PBK A;  3J80 D;  1V25 A;  2E0G A;  2CXC A;  4G36 A;  3ETC A;  4JI0 C;  3VNS A;  1T5H X;  5A19 A;  5BSW A;  1KKG A;  3FCC A;  4DV1 C;  4DR1 C;  3C5E A;  2AYA A;  2ATW A;  1AMU A;  3N2Q A;  1RY2 A;  4X64 C;  1N36 C;  1N32 C;  1IBM C;  5AE1 A;  4KTT A;  4DR5 C;  4K0K C;  2OO4 A;  3RV2 A;  4OX9 C;  3LGX A;  1XMQ C;  3TQI A;  5CZX A;  1P7L A;  4XX2 A;  1XMO C;  4RM2 A;  1O90 A;  2DYJ A;  3CW8 X;  4DV7 C;  2HHH C;  2D28 C;  1YJ7 A;  4NXM C;  5BSU A;  1MXC A;  4DV4 C;  4MTN A;  4DCT A;  4X65 C;  3NYQ A;  2Y27 A;  4FTF A;  4EAT A;  4OYC A;  2P2B A;  4LE5 A;  1IBK C;  1GPM A;  2D1Q A;  4DV5 C;  4R1M A;  2Y4O A;  4ZJZ A;  2D1R A;  1QWI A;  2XR1 A;  2QVX X;  4DR3 C;  3AF5 A;  2P20 A;  3LAX A;  1XNR C;  5A1I A;  2UXC C;  2P2J A;  5BSV A;  5IFI A;  5A1G A;  1LCI A;  4DCS A;  4L7I A;  4DUY C;  2YCB A;  4B3T C;  3CJE A;  4RM3 A;  2P2M A;  2WD9 A;  4G1I A;  2D1S A;  3PES A;  5GTD A;  4ISB A;  4L2Z A;  4LFC C;  3E7W A;  4DR4 C;  2BH1 X;  2HJG A;  5KYV A;  1NYE A;  1L2F A;  1BA3 A;  5T8T A;  4FUT A;  3B7W A;  3L95 X;  2F4V C;  5BUR A;  3A4I A;  4LF9 C;  3GR1 A;  4RLQ A;  3OTO C;  2E5L C;  2VSQ A;  3UOW A;  1V26 A;  4LFB C;  4D4I A;  4K0B A;  2OPL A;  3GR0 A;  2PRO A;  1MXB A;  5K85 A;  3JAM D;  2P02 A;  5K8F A;  5E7Q A;  1IBL C;  4DUZ C;  3FCE A;  1PG3 A;  5JRH A;  4RMN A;  3SO4 A;  1ZB8 A;  3I07 A;  4DV0 C;  3TDE A;  2YWB A;  4GS5 A;  5BSM A;  4JYA C;  2D7V A;  1HH2 P;  3A9U A;  5BSR A;  3DHV A;  3TUF A;  1QM4 A;  2V7B A;  4PRO C;  1XNQ C;  2UUA C;  5KEI A;  5AE3 A;  1MDF A;  4DG9 A;  5BUQ A;  3J7A D;  4BCA A;  1MXA A;  3DAY A;  3DLP X;  2UUC C;  2CY1 A;  3RG2 A;  4RVN A;  4DR2 C;  4L4Q A;  1K0R A;  4R1L A;  5BR8 C;  5CZV A;  4X66 C;  1FJG C;  4YHH C;  1MD9 A;  4JV5 C;  1N34 C;  3IEV A;  1WF3 A;  4MH4 A;  3L8C A;  4D4G A;  4BC7 A;  3S82 A;  4JM1 A;  3UZ0 A;  4NDN A;  3IML A;  2EGT A;  4DV6 C;  4BBY A;  4IR7 A;  3PRO C;  4B3M C;  3E7X A;  5IT9 D;  2ASB A;  1N33 C;  4LF7 C;  4LF4 C;  4DV3 C;  1T5D X;  4PHT A;  1HNW C;  1XRB A;  1XRC A;  4GXQ A;  4JI4 C;  2VZE A;  3NPD A;  3R9X A;  1PA4 A;  1HNX C;  4DCU A;  4WV3 A;  1O9T A;  2Y4N A;  4WS9 A;  5LMN C;  5ADZ A;  4I9G A;  3T1Y C;  4D57 A;  3I08 A;  4JI6 C;  4TPS B;  1HNZ C;  2YWC A;  4LF8 C;  4LF5 C;  3VNR A;  1MDB A;  2E7G A;  4I9F A;  4RVO A;  3IEU A;  3H2T A;  2JMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...