4DR4C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 52
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr4C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr4C02
2PT7G 2UXDC 4JI0C 1N33C 3IEUA 1XNRC 1J5EC 2KZFA 4LF4C 3J7AD 4DR4C 1LQLA 4JI3C 2UXCC 4JI6C 4DV7C 2UUBC 2E7GA 1HR0C 4GKJC 2QL8A 2ATWA 4X62C 1HNXC 1QWIA 4OX9C 4JI1C 1L2FA 2VQEC 1XMOC 2ZM6C 4NXMC 4YHHC 1UKKA 4NOZA 4DV6C 4JI4C 4LFCC 2YCBA 2VQFC 4DCUA 3LUSA 4BSZA 3T1HC 2UUAC 4X66C 2BJOA 2CXCA 4AQYC 4LF6C 2PN2A 3J80D 2UXBC 4NXNC 1MKYA 4JI8C 4LFAC 4DR2C 2DYJA 2UU9C 1I94C 1EGAA 3JAMD 2XR1A 1WH9A 4MTNA 5BR8C 1XMQC 4KHPC 2OPLA 4YY3C 1KKGA 4DR1C 4B3TC 4LF8C 5IWAC 1N2FA 2JMPA 2E8EA 1IBMC 2EGTA 1XNQC 3R9WA 4GKKC 2UUCC 1JOSA 4B3RC 5LMUC 1ZB8A 1IBLC 4MH4A 4B3MC 2HHHC 1ML8A 4LFBC 4DR7C 4DR6C 2E8FA 4DUZC 5IT9D 3AF6A 1IBKC 4LF7C 3IEVA 2OPLB 4JI5C 3T1YC 4DCSA 4DV2C 3R9XA 1USPA 4DV1C 4DUYC 1HH2P 3GKUA 4JI7C 1N32C 5FLXD 4LF9C 2E8CA 2ONFA 4DCVA 5A2QD 1FJGC 4JYAC 4DR5C 1WF3A 4JV5C 1HNWC 2D7VA 4X65C 1NYEA 3I07A 2ASBA 4DV0C 1VLAA 4XX2A 2CY1A 3CJEA 4JI2C 3EERA 4DV3C 3J81D 4DV4C 1HNZC 2F4VC 3AF5A 3OTOC 4B3SC 1PA4A 4K0KC 1USPB 4DR3C 4DV5C 1K0RA 4X64C 1N34C 5LMNC 2E5LC 1ZB9A 4DCTA 4LF5C 1N36C 2HJGA
chains in the Genus database with same CATH superfamily
2PT7G 4L7IA 4D56A 2D1TA 2E0GA 3H2TA 1M6XC 2ZZMA 5BUSA 3J7AD 4DR4C 2D1RA 3B7WA 4JI3C 4JI6C 4DV7C 5A1GA 2UUBC 4GKJC 2ATWA 4X62C 4D4IA 4RLQA 5AE2A 4JI1C 1XMOC 2PROA 3O2EA 5BUQA 5DV9A 4DCUA 3T1HC 4LF6C 2UXBC 5AE3A 1XRCA 5BSWA 2DYJA 2UU9C 2XR1A 3AY0A 3IPLA 2NCLA 4MTNA 5BSUA 1NY8A 4ODJA 4YY3C 4DR1C 2P2BA 3LAXA 1N2FA 2JMPA 2E8EA 1IBMC 5KYTA 5ADZA 2UUCC 1MXAA 3UX2A 5A19A 4GXRA 3R44A 4RVNA 2KZ0A 1MDFA 4MH4A 4PHTA 3TDEA 4RVOA 3TR3A 3VNQA 1IBKC 1FUGA 5CZXA 3IEVA 4KTVA 4RLFA 5K8FA 1MXBA 1T5DX 4DV1C 5BSTA 3GKUA 1N32C 2OO4A 3UEBA 3CQ2A 3A26A 1WF3A 1O92A 3EQ6A 1NYEA 4G37A 4G36A 3CJEA 4JI2C 3GR1A 2F4VC 4K0KC 5KYVA 4R1LA 4X64C 2E5LC 1ZB9A 4DCTA 4EATA 1O90A 3VNRA 3C5EA 2UXDC 3DLPX 4LF4C 2CU6A 1PG4A 4FTFA 1LQLA 4K0BA 1HR0C 1P4EA 5K85A 1QWIA 1PG3A 5A1IA 2ZM6C 3CW9A 4NXMC 1M6XA 3TUFA 2D1SA 4IR7A 4JI4C 4LFCC 4PUIA 2UUAC 2PN2A 1XHJA 1MKYA 4LFAC 3LNOA 5AE1A 1EGAA 4ZJZA 1WH9A 1TH5A 1XMQC 5IWAC 4U5YD 2P02A 4IZ6A 3E7XA 3R9WA 4D4GA 3RV2A 1ZB8A 1IBLC 1XRBA 3DAYA 3ETCA 1ML8A 4LFBC 3VNSA 4DR6C 2Y27A 3LNVA 2YX1A 3DHVA 4DCSA 3SO4A 5IFIA 4R0MA 1USPA 4BC9A 4PUHA 4L2ZA 4FUQA 2ONFA 4DCVA 1FJGC 2D27A 4JV5C 1IB8A 2D7VA 1MXCA 2P2QA 4BC7A 1O93A 1VLAA 4XX2A 1PU1A 3J81D 3OTOC 4HPVA 5LCIA 3A9UA 1K0RA 1YJ7A 1RG9A 2MM9A 3GR0A 1VEHA 4LF5C 3UZ0A 4JI0C 1N33C 3IEUA 3TQIA 4TPSB 5BURA 4I9GA 4ISBA 1J5EC 3KXWA 4BBYA 2UXCC 2ZZNA 3FCEA 2QL8A 1HNXC 3L8CA 1L2FA 4GXQA 1ULTA 4WS9A 4YHHC 5BSRA 1UKKA 2P2FA 3FCCA 4NOZA 4I9FA 3I08A 4DV6C 2MCQA 2VQFC 3LUSA 4PUGA 4X66C 2CXCA 3N54B 4AQYC 3J80D 4NXNC 5H9UA 4FUTA 5T8TA 1I94C 2WP0C 2V7BA 2Y4OA 4KHPC 2OPLA 4LF8C 4B3TC 2EGTA 1XNQC 3NPDA 3LGXA 1JOSA 4RM2A 4B3RC 2D28C 2DHMA 4B3MC 2HHHC 4OYCA 1WCJA 5T8SA 5GTDA 2M5OA 1MD9A 4PZPA 4DUZC 5IT9D 3AF6A 4JI5C 2KDNA 3T1YC 3CQ3A 3R9XA 2VSQA 4G1IA 2Z51A 4JI7C 1XDXA 5FLXD 3S82A 4DG9A 4PROC 4KTTA 2E8CA 5A2QD 4R1MA 3ETOA 4JYAC 4DR5C 4X65C 2P2MA 4DV0C 5BSMA 2CY1A 3NYRA 4DV3C 4DV4C 1V25A 1T5HX 3AF5A 1PA4A 3A9VA 3CW8X 2YWBA 1USPB 2WD9A 1N36C 2HJGA 2AYAA 4GS5A 1XNRC 2VZEA 2KZFA 2QW0X 3A4IA 5E7QA 1FLOA 2DPLA 2MMAB 3E7WA 4OXIA 1P7LA 2QVXX 4RM3A 2E7GA 5JRHA 3NI2A 4RMNA 1V60A 4OX9C 2VQEC 1V26A 2Y4NA 5CZVA 1MDBA 2ZTBA 1QM4A 2YCBA 4DG8A 4BSZA 5KEIA 2QVYX 2BJOA 1UWDA 4LE5A 2YWCA 1XRAA 3PBKA 4JI8C 4DR2C 2P2JA 3RG2A 3JAMD 2M5HA 1GPMA 3NYQA 1O9TA 5BR8C 1KKGA 3G7SA 4WV3A 4GKKC 3CQ1A 5LMUC 3A25A 4L4QA 4DR7C 2JNVA 1LCIA 2E8FA 4LF7C 3PESA 2OPLB 3UX3A 1BA3A 4DV2C 3N2QA 4D57A 3K6RA 3L95X 4DUYC 1HH2P 1RY2A 3GPCA 2BH1X 1AMUA 4LF9C 1YGTA 4ZLPA 2D1QA 4JM1A 1HNWC 2PG1E 2OBVA 3I07A 2ASBA 2P20A 4BCAA 3IMLA 3FM7A 1XS3A 3EERA 3PROC 1HNZC 4B3SC 5BSVA 2QVZX 4DR3C 4DV5C 1N34C 4NDNA 3UOWA 1P4EC 5LMNC
chains in the Genus database with same CATH topology
2PT7G 4L7IA 4D56A 2D1TA 2E0GA 3H2TA 5BUSA 3J7AD 4DR4C 2D1RA 3B7WA 4JI3C 4JI6C 4DV7C 5A1GA 2UUBC 4GKJC 2ATWA 4X62C 4D4IA 4RLQA 5AE2A 4JI1C 1XMOC 2PROA 5BUQA 5DV9A 4DCUA 3T1HC 4LF6C 2UXBC 5AE3A 1XRCA 5BSWA 2DYJA 2UU9C 2XR1A 3IPLA 4MTNA 5BSUA 4ODJA 4YY3C 4DR1C 2P2BA 3LAXA 1N2FA 2JMPA 2E8EA 1IBMC 5KYTA 5ADZA 2UUCC 1MXAA 5A19A 4GXRA 3R44A 4RVNA 1MDFA 4MH4A 4PHTA 3TDEA 4RVOA 3VNQA 1IBKC 1FUGA 5CZXA 3IEVA 4KTVA 4RLFA 5K8FA 1MXBA 1T5DX 4DV1C 5BSTA 3GKUA 1N32C 2OO4A 1WF3A 1O92A 3EQ6A 1NYEA 4G37A 4G36A 3CJEA 4JI2C 3GR1A 2F4VC 4K0KC 5KYVA 4R1LA 4X64C 2E5LC 1ZB9A 4DCTA 4EATA 1O90A 3VNRA 3C5EA 2UXDC 3DLPX 4LF4C 1PG4A 4FTFA 1LQLA 4K0BA 1HR0C 5K85A 1QWIA 1PG3A 5A1IA 2ZM6C 3CW9A 4NXMC 3TUFA 2D1SA 4IR7A 4JI4C 4LFCC 2UUAC 2PN2A 1MKYA 4LFAC 5AE1A 1EGAA 4ZJZA 1WH9A 1XMQC 5IWAC 4U5YD 2P02A 4IZ6A 3E7XA 3R9WA 4D4GA 3RV2A 1ZB8A 1IBLC 1XRBA 3DAYA 3ETCA 1ML8A 4LFBC 3VNSA 4DR6C 2Y27A 3LNVA 3DHVA 4DCSA 3SO4A 5IFIA 4R0MA 1USPA 4BC9A 4L2ZA 4FUQA 2ONFA 4DCVA 1FJGC 2D27A 4JV5C 2D7VA 1MXCA 2P2QA 4BC7A 1O93A 1VLAA 4XX2A 3J81D 3OTOC 4HPVA 3A9UA 1K0RA 1YJ7A 1RG9A 3GR0A 4LF5C 3UZ0A 4JI0C 1N33C 3IEUA 3TQIA 4TPSB 5BURA 4I9GA 4ISBA 1J5EC 3KXWA 4BBYA 2UXCC 3FCEA 2QL8A 1HNXC 3L8CA 1L2FA 4GXQA 1ULTA 4WS9A 4YHHC 5BSRA 1UKKA 2P2FA 3FCCA 4NOZA 4I9FA 3I08A 4DV6C 2VQFC 3LUSA 4X66C 2CXCA 3N54B 4AQYC 3J80D 4NXNC 5H9UA 4FUTA 5T8TA 1I94C 2WP0C 2V7BA 2Y4OA 4KHPC 2OPLA 4LF8C 4B3TC 2EGTA 1XNQC 3NPDA 3LGXA 1JOSA 4RM2A 4B3RC 2D28C 4B3MC 2HHHC 4OYCA 5T8SA 5GTDA 1MD9A 4PZPA 4DUZC 5IT9D 3AF6A 4JI5C 3T1YC 3R9XA 2VSQA 4G1IA 4JI7C 5FLXD 3S82A 4DG9A 4PROC 4KTTA 2E8CA 5A2QD 4R1MA 3ETOA 4JYAC 4DR5C 4X65C 2P2MA 4DV0C 5BSMA 2CY1A 3NYRA 4DV3C 4DV4C 1V25A 1T5HX 3AF5A 1PA4A 3A9VA 3CW8X 2YWBA 1USPB 2WD9A 1N36C 2AYAA 2HJGA 4GS5A 1XNRC 2VZEA 2KZFA 2QW0X 3A4IA 5E7QA 2DPLA 3E7WA 4OXIA 1P7LA 2QVXX 4RM3A 2E7GA 5JRHA 3NI2A 4RMNA 4OX9C 2VQEC 1V26A 2Y4NA 5CZVA 1MDBA 1QM4A 2YCBA 4DG8A 4BSZA 5KEIA 2QVYX 2BJOA 4LE5A 2YWCA 1XRAA 3PBKA 4JI8C 4DR2C 2P2JA 3RG2A 3JAMD 1GPMA 3NYQA 1O9TA 5BR8C 1KKGA 3G7SA 4WV3A 4GKKC 5LMUC 4L4QA 4DR7C 1LCIA 2E8FA 4LF7C 3PESA 2OPLB 4DV2C 1BA3A 3N2QA 4D57A 3L95X 4DUYC 1HH2P 1RY2A 3GPCA 2BH1X 1AMUA 4LF9C 4ZLPA 2D1QA 4JM1A 1HNWC 2OBVA 3I07A 2ASBA 2P20A 4BCAA 3IMLA 3EERA 3PROC 1HNZC 4B3SC 5BSVA 2QVZX 4DR3C 4DV5C 1N34C 4NDNA 3UOWA 5LMNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PT7 G;  2UXD C;  4JI0 C;  1N33 C;  3IEU A;  1XNR C;  1J5E C;  2KZF A;  4LF4 C;  3J7A D;  4DR4 C;  1LQL A;  4JI3 C;  2UXC C;  4JI6 C;  4DV7 C;  2UUB C;  2E7G A;  1HR0 C;  4GKJ C;  2QL8 A;  2ATW A;  4X62 C;  1HNX C;  1QWI A;  4OX9 C;  4JI1 C;  1L2F A;  2VQE C;  1XMO C;  2ZM6 C;  4NXM C;  4YHH C;  1UKK A;  4NOZ A;  4DV6 C;  4JI4 C;  4LFC C;  2YCB A;  2VQF C;  4DCU A;  3LUS A;  4BSZ A;  3T1H C;  2UUA C;  4X66 C;  2BJO A;  2CXC A;  4AQY C;  4LF6 C;  2PN2 A;  3J80 D;  2UXB C;  4NXN C;  1MKY A;  4JI8 C;  4LFA C;  4DR2 C;  2DYJ A;  2UU9 C;  1I94 C;  1EGA A;  3JAM D;  2XR1 A;  1WH9 A;  4MTN A;  5BR8 C;  1XMQ C;  4KHP C;  2OPL A;  4YY3 C;  1KKG A;  4DR1 C;  4B3T C;  4LF8 C;  5IWA C;  1N2F A;  2JMP A;  2E8E A;  1IBM C;  2EGT A;  1XNQ C;  3R9W A;  4GKK C;  2UUC C;  1JOS A;  4B3R C;  5LMU C;  1ZB8 A;  1IBL C;  4MH4 A;  4B3M C;  2HHH C;  1ML8 A;  4LFB C;  4DR7 C;  4DR6 C;  2E8F A;  4DUZ C;  5IT9 D;  3AF6 A;  1IBK C;  4LF7 C;  3IEV A;  2OPL B;  4JI5 C;  3T1Y C;  4DCS A;  4DV2 C;  3R9X A;  1USP A;  4DV1 C;  4DUY C;  1HH2 P;  3GKU A;  4JI7 C;  1N32 C;  5FLX D;  4LF9 C;  2E8C A;  2ONF A;  4DCV A;  5A2Q D;  1FJG C;  4JYA C;  4DR5 C;  1WF3 A;  4JV5 C;  1HNW C;  2D7V A;  4X65 C;  1NYE A;  3I07 A;  2ASB A;  4DV0 C;  1VLA A;  4XX2 A;  2CY1 A;  3CJE A;  4JI2 C;  3EER A;  4DV3 C;  3J81 D;  4DV4 C;  1HNZ C;  2F4V C;  3AF5 A;  3OTO C;  4B3S C;  1PA4 A;  4K0K C;  1USP B;  4DR3 C;  4DV5 C;  1K0R A;  4X64 C;  1N34 C;  5LMN C;  2E5L C;  1ZB9 A;  4DCT A;  4LF5 C;  1N36 C;  2HJG A; 
#chains in the Genus database with same CATH topology
 2PT7 G;  4L7I A;  4D56 A;  2D1T A;  2E0G A;  3H2T A;  1M6X C;  2ZZM A;  5BUS A;  3J7A D;  4DR4 C;  2D1R A;  3B7W A;  4JI3 C;  4JI6 C;  4DV7 C;  5A1G A;  2UUB C;  4GKJ C;  2ATW A;  4X62 C;  4D4I A;  4RLQ A;  5AE2 A;  4JI1 C;  1XMO C;  2PRO A;  3O2E A;  5BUQ A;  5DV9 A;  4DCU A;  3T1H C;  4LF6 C;  2UXB C;  5AE3 A;  1XRC A;  5BSW A;  2DYJ A;  2UU9 C;  2XR1 A;  3AY0 A;  3IPL A;  2NCL A;  4MTN A;  5BSU A;  1NY8 A;  4ODJ A;  4YY3 C;  4DR1 C;  2P2B A;  3LAX A;  1N2F A;  2JMP A;  2E8E A;  1IBM C;  5KYT A;  5ADZ A;  2UUC C;  1MXA A;  3UX2 A;  5A19 A;  4GXR A;  3R44 A;  4RVN A;  2KZ0 A;  1MDF A;  4MH4 A;  4PHT A;  3TDE A;  4RVO A;  3TR3 A;  3VNQ A;  1IBK C;  1FUG A;  5CZX A;  3IEV A;  4KTV A;  4RLF A;  5K8F A;  1MXB A;  1T5D X;  4DV1 C;  5BST A;  3GKU A;  1N32 C;  2OO4 A;  3UEB A;  3CQ2 A;  3A26 A;  1WF3 A;  1O92 A;  3EQ6 A;  1NYE A;  4G37 A;  4G36 A;  3CJE A;  4JI2 C;  3GR1 A;  2F4V C;  4K0K C;  5KYV A;  4R1L A;  4X64 C;  2E5L C;  1ZB9 A;  4DCT A;  4EAT A;  1O90 A;  3VNR A;  3C5E A;  2UXD C;  3DLP X;  4LF4 C;  2CU6 A;  1PG4 A;  4FTF A;  1LQL A;  4K0B A;  1HR0 C;  1P4E A;  5K85 A;  1QWI A;  1PG3 A;  5A1I A;  2ZM6 C;  3CW9 A;  4NXM C;  1M6X A;  3TUF A;  2D1S A;  4IR7 A;  4JI4 C;  4LFC C;  4PUI A;  2UUA C;  2PN2 A;  1XHJ A;  1MKY A;  4LFA C;  3LNO A;  5AE1 A;  1EGA A;  4ZJZ A;  1WH9 A;  1TH5 A;  1XMQ C;  5IWA C;  4U5Y D;  2P02 A;  4IZ6 A;  3E7X A;  3R9W A;  4D4G A;  3RV2 A;  1ZB8 A;  1IBL C;  1XRB A;  3DAY A;  3ETC A;  1ML8 A;  4LFB C;  3VNS A;  4DR6 C;  2Y27 A;  3LNV A;  2YX1 A;  3DHV A;  4DCS A;  3SO4 A;  5IFI A;  4R0M A;  1USP A;  4BC9 A;  4PUH A;  4L2Z A;  4FUQ A;  2ONF A;  4DCV A;  1FJG C;  2D27 A;  4JV5 C;  1IB8 A;  2D7V A;  1MXC A;  2P2Q A;  4BC7 A;  1O93 A;  1VLA A;  4XX2 A;  1PU1 A;  3J81 D;  3OTO C;  4HPV A;  5LCI A;  3A9U A;  1K0R A;  1YJ7 A;  1RG9 A;  2MM9 A;  3GR0 A;  1VEH A;  4LF5 C;  3UZ0 A;  4JI0 C;  1N33 C;  3IEU A;  3TQI A;  4TPS B;  5BUR A;  4I9G A;  4ISB A;  1J5E C;  3KXW A;  4BBY A;  2UXC C;  2ZZN A;  3FCE A;  2QL8 A;  1HNX C;  3L8C A;  1L2F A;  4GXQ A;  1ULT A;  4WS9 A;  4YHH C;  5BSR A;  1UKK A;  2P2F A;  3FCC A;  4NOZ A;  4I9F A;  3I08 A;  4DV6 C;  2MCQ A;  2VQF C;  3LUS A;  4PUG A;  4X66 C;  2CXC A;  3N54 B;  4AQY C;  3J80 D;  4NXN C;  5H9U A;  4FUT A;  5T8T A;  1I94 C;  2WP0 C;  2V7B A;  2Y4O A;  4KHP C;  2OPL A;  4LF8 C;  4B3T C;  2EGT A;  1XNQ C;  3NPD A;  3LGX A;  1JOS A;  4RM2 A;  4B3R C;  2D28 C;  2DHM A;  4B3M C;  2HHH C;  4OYC A;  1WCJ A;  5T8S A;  5GTD A;  2M5O A;  1MD9 A;  4PZP A;  4DUZ C;  5IT9 D;  3AF6 A;  4JI5 C;  2KDN A;  3T1Y C;  3CQ3 A;  3R9X A;  2VSQ A;  4G1I A;  2Z51 A;  4JI7 C;  1XDX A;  5FLX D;  3S82 A;  4DG9 A;  4PRO C;  4KTT A;  2E8C A;  5A2Q D;  4R1M A;  3ETO A;  4JYA C;  4DR5 C;  4X65 C;  2P2M A;  4DV0 C;  5BSM A;  2CY1 A;  3NYR A;  4DV3 C;  4DV4 C;  1V25 A;  1T5H X;  3AF5 A;  1PA4 A;  3A9V A;  3CW8 X;  2YWB A;  1USP B;  2WD9 A;  1N36 C;  2HJG A;  2AYA A;  4GS5 A;  1XNR C;  2VZE A;  2KZF A;  2QW0 X;  3A4I A;  5E7Q A;  1FLO A;  2DPL A;  2MMA B;  3E7W A;  4OXI A;  1P7L A;  2QVX X;  4RM3 A;  2E7G A;  5JRH A;  3NI2 A;  4RMN A;  1V60 A;  4OX9 C;  2VQE C;  1V26 A;  2Y4N A;  5CZV A;  1MDB A;  2ZTB A;  1QM4 A;  2YCB A;  4DG8 A;  4BSZ A;  5KEI A;  2QVY X;  2BJO A;  1UWD A;  4LE5 A;  2YWC A;  1XRA A;  3PBK A;  4JI8 C;  4DR2 C;  2P2J A;  3RG2 A;  3JAM D;  2M5H A;  1GPM A;  3NYQ A;  1O9T A;  5BR8 C;  1KKG A;  3G7S A;  4WV3 A;  4GKK C;  3CQ1 A;  5LMU C;  3A25 A;  4L4Q A;  4DR7 C;  2JNV A;  1LCI A;  2E8F A;  4LF7 C;  3PES A;  2OPL B;  3UX3 A;  1BA3 A;  4DV2 C;  3N2Q A;  4D57 A;  3K6R A;  3L95 X;  4DUY C;  1HH2 P;  1RY2 A;  3GPC A;  2BH1 X;  1AMU A;  4LF9 C;  1YGT A;  4ZLP A;  2D1Q A;  4JM1 A;  1HNW C;  2PG1 E;  2OBV A;  3I07 A;  2ASB A;  2P20 A;  4BCA A;  3IML A;  3FM7 A;  1XS3 A;  3EER A;  3PRO C;  1HNZ C;  4B3S C;  5BSV A;  2QVZ X;  4DR3 C;  4DV5 C;  1N34 C;  4NDN A;  3UOW A;  1P4E C;  5LMN C; 
#chains in the Genus database with same CATH homology
 2PT7 G;  4L7I A;  4D56 A;  2D1T A;  2E0G A;  3H2T A;  5BUS A;  3J7A D;  4DR4 C;  2D1R A;  3B7W A;  4JI3 C;  4JI6 C;  4DV7 C;  5A1G A;  2UUB C;  4GKJ C;  2ATW A;  4X62 C;  4D4I A;  4RLQ A;  5AE2 A;  4JI1 C;  1XMO C;  2PRO A;  5BUQ A;  5DV9 A;  4DCU A;  3T1H C;  4LF6 C;  2UXB C;  5AE3 A;  1XRC A;  5BSW A;  2DYJ A;  2UU9 C;  2XR1 A;  3IPL A;  4MTN A;  5BSU A;  4ODJ A;  4YY3 C;  4DR1 C;  2P2B A;  3LAX A;  1N2F A;  2JMP A;  2E8E A;  1IBM C;  5KYT A;  5ADZ A;  2UUC C;  1MXA A;  5A19 A;  4GXR A;  3R44 A;  4RVN A;  1MDF A;  4MH4 A;  4PHT A;  3TDE A;  4RVO A;  3VNQ A;  1IBK C;  1FUG A;  5CZX A;  3IEV A;  4KTV A;  4RLF A;  5K8F A;  1MXB A;  1T5D X;  4DV1 C;  5BST A;  3GKU A;  1N32 C;  2OO4 A;  1WF3 A;  1O92 A;  3EQ6 A;  1NYE A;  4G37 A;  4G36 A;  3CJE A;  4JI2 C;  3GR1 A;  2F4V C;  4K0K C;  5KYV A;  4R1L A;  4X64 C;  2E5L C;  1ZB9 A;  4DCT A;  4EAT A;  1O90 A;  3VNR A;  3C5E A;  2UXD C;  3DLP X;  4LF4 C;  1PG4 A;  4FTF A;  1LQL A;  4K0B A;  1HR0 C;  5K85 A;  1QWI A;  1PG3 A;  5A1I A;  2ZM6 C;  3CW9 A;  4NXM C;  3TUF A;  2D1S A;  4IR7 A;  4JI4 C;  4LFC C;  2UUA C;  2PN2 A;  1MKY A;  4LFA C;  5AE1 A;  1EGA A;  4ZJZ A;  1WH9 A;  1XMQ C;  5IWA C;  4U5Y D;  2P02 A;  4IZ6 A;  3E7X A;  3R9W A;  4D4G A;  3RV2 A;  1ZB8 A;  1IBL C;  1XRB A;  3DAY A;  3ETC A;  1ML8 A;  4LFB C;  3VNS A;  4DR6 C;  2Y27 A;  3LNV A;  3DHV A;  4DCS A;  3SO4 A;  5IFI A;  4R0M A;  1USP A;  4BC9 A;  4L2Z A;  4FUQ A;  2ONF A;  4DCV A;  1FJG C;  2D27 A;  4JV5 C;  2D7V A;  1MXC A;  2P2Q A;  4BC7 A;  1O93 A;  1VLA A;  4XX2 A;  3J81 D;  3OTO C;  4HPV A;  3A9U A;  1K0R A;  1YJ7 A;  1RG9 A;  3GR0 A;  4LF5 C;  3UZ0 A;  4JI0 C;  1N33 C;  3IEU A;  3TQI A;  4TPS B;  5BUR A;  4I9G A;  4ISB A;  1J5E C;  3KXW A;  4BBY A;  2UXC C;  3FCE A;  2QL8 A;  1HNX C;  3L8C A;  1L2F A;  4GXQ A;  1ULT A;  4WS9 A;  4YHH C;  5BSR A;  1UKK A;  2P2F A;  3FCC A;  4NOZ A;  4I9F A;  3I08 A;  4DV6 C;  2VQF C;  3LUS A;  4X66 C;  2CXC A;  3N54 B;  4AQY C;  3J80 D;  4NXN C;  5H9U A;  4FUT A;  5T8T A;  1I94 C;  2WP0 C;  2V7B A;  2Y4O A;  4KHP C;  2OPL A;  4LF8 C;  4B3T C;  2EGT A;  1XNQ C;  3NPD A;  3LGX A;  1JOS A;  4RM2 A;  4B3R C;  2D28 C;  4B3M C;  2HHH C;  4OYC A;  5T8S A;  5GTD A;  1MD9 A;  4PZP A;  4DUZ C;  5IT9 D;  3AF6 A;  4JI5 C;  3T1Y C;  3R9X A;  2VSQ A;  4G1I A;  4JI7 C;  5FLX D;  3S82 A;  4DG9 A;  4PRO C;  4KTT A;  2E8C A;  5A2Q D;  4R1M A;  3ETO A;  4JYA C;  4DR5 C;  4X65 C;  2P2M A;  4DV0 C;  5BSM A;  2CY1 A;  3NYR A;  4DV3 C;  4DV4 C;  1V25 A;  1T5H X;  3AF5 A;  1PA4 A;  3A9V A;  3CW8 X;  2YWB A;  1USP B;  2WD9 A;  1N36 C;  2AYA A;  2HJG A;  4GS5 A;  1XNR C;  2VZE A;  2KZF A;  2QW0 X;  3A4I A;  5E7Q A;  2DPL A;  3E7W A;  4OXI A;  1P7L A;  2QVX X;  4RM3 A;  2E7G A;  5JRH A;  3NI2 A;  4RMN A;  4OX9 C;  2VQE C;  1V26 A;  2Y4N A;  5CZV A;  1MDB A;  1QM4 A;  2YCB A;  4DG8 A;  4BSZ A;  5KEI A;  2QVY X;  2BJO A;  4LE5 A;  2YWC A;  1XRA A;  3PBK A;  4JI8 C;  4DR2 C;  2P2J A;  3RG2 A;  3JAM D;  1GPM A;  3NYQ A;  1O9T A;  5BR8 C;  1KKG A;  3G7S A;  4WV3 A;  4GKK C;  5LMU C;  4L4Q A;  4DR7 C;  1LCI A;  2E8F A;  4LF7 C;  3PES A;  2OPL B;  4DV2 C;  1BA3 A;  3N2Q A;  4D57 A;  3L95 X;  4DUY C;  1HH2 P;  1RY2 A;  3GPC A;  2BH1 X;  1AMU A;  4LF9 C;  4ZLP A;  2D1Q A;  4JM1 A;  1HNW C;  2OBV A;  3I07 A;  2ASB A;  2P20 A;  4BCA A;  3IML A;  3EER A;  3PRO C;  1HNZ C;  4B3S C;  5BSV A;  2QVZ X;  4DR3 C;  4DV5 C;  1N34 C;  4NDN A;  3UOW A;  5LMN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...