4X66C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4x66C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4x66C02
3IEVA 4MH4A 4LFBC 2PT7G 4JI4C 1PA4A 2EGTA 2CXCA 2OPLB 4LF7C 2UUCC 5FLXD 5LMUC 4OX9C 4JI5C 4JI6C 2E8CA 2UUAC 3GKUA 1WH9A 4DV6C 1K0RA 4X62C 4DV5C 1QWIA 1LQLA 4DV1C 1XNQC 3AF5A 4JV5C 1KKGA 4DR4C 4YHHC 1I94C 1IBKC 4JI8C 1UKKA 2DYJA 2VQEC 3CJEA 1EGAA 1ZB8A 3AF6A 4GKKC 2QL8A 2XR1A 4DR5C 4JI7C 3OTOC 4DR6C 5A2QD 4X65C 1N32C 4BSZA 3LUSA 4MTNA 5IT9D 4DCVA 4KHPC 4NOZA 4X64C 1ML8A 4DV4C 2BJOA 4JYAC 4DCSA 4DCUA 3T1HC 1XMOC 1N34C 3R9WA 4DR1C 2JMPA 4JI1C 2UXBC 4DCTA 3R9XA 4DV2C 4DR7C 3J7AD 2UXDC 4LFAC 2E8EA 3T1YC 4AQYC 4B3RC 4K0KC 4DR2C 4JI2C 3IEUA 2ASBA 2UU9C 1WF3A 2E7GA 5IWAC 4B3MC 2YCBA 4DUZC 4DV7C 2VQFC 2CY1A 1NYEA 2UXCC 2E5LC 2HHHC 1VLAA 3I07A 3JAMD 3J81D 4B3TC 2PN2A 2UUBC 1HNXC 4XX2A 4LFCC 1J5EC 4NXNC 1IBLC 1HNZC 1HNWC 4NXMC 4JI0C 1L2FA 1JOSA 2F4VC 1N33C 1USPA 1HH2P 2KZFA 4LF8C 4DUYC 1N36C 4B3SC 4LF9C 4DV0C 5LMNC 4GKJC 2HJGA 4DV3C 4JI3C 4LF5C 3J80D 2D7VA 1XNRC 4YY3C 1HR0C 4LF4C 1MKYA 2OPLA 4LF6C 1N2FA 2ONFA 2ZM6C 2ATWA 1IBMC 1USPB 4X66C 4DR3C 5BR8C 1XMQC 1FJGC 1ZB9A 3EERA 2E8FA
chains in the Genus database with same CATH superfamily
4G36A 2D1SA 1P7LA 2VZEA 5KYTA 4BBYA 2UUCC 5LMUC 4WV3A 4JI5C 4I9FA 3GKUA 1WH9A 1MD9A 4DV6C 1K0RA 4X62C 4DV5C 1LQLA 3AF5A 4PUGA 3RV2A 1KKGA 4YHHC 1I94C 5BSTA 4JI8C 3NI2A 2PROA 3CJEA 1EGAA 3FCEA 1ZB8A 3N2QA 4JI7C 3UZ0A 3UOWA 4ZLPA 2D1RA 3CQ3A 4PHTA 3NYRA 4GXQA 4NOZA 4X64C 4DV4C 3GR1A 4DCUA 4DCSA 3FCCA 2KDNA 3O2EA 3R9WA 4KTTA 5GTDA 2ZZMA 3KXWA 3R9XA 2YX1A 2UXDC 2E8EA 4RM2A 5A1IA 1M6XC 4OXIA 2D27A 2E7GA 1M6XA 5IWAC 3UX3A 4B3MC 1RY2A 4DUZC 2VQFC 2CY1A 2UXCC 4GXRA 2HHHC 3PESA 3J81D 2Y27A 3CQ1A 1PG3A 4XX2A 4LFCC 5T8SA 2QVXX 1IBLC 1MDBA 5K8FA 1JOSA 1N33C 2KZFA 3TR3A 2P2MA 4DV0C 2HJGA 1V25A 5JRHA 4YY3C 1PG4A 1HR0C 4KTVA 4LF4C 2OPLA 1N2FA 4DG8A 4D56A 1P4EC 1USPB 3N54B 5BUQA 1P4EA 1XDXA 1RG9A 2JNVA 2PT7G 3EQ6A 2WD9A 5DV9A 2OO4A 2CXCA 3VNQA 2UUAC 5AE2A 4PUHA 1BA3A 1XNQC 4JV5C 1XS3A 3B7WA 3E7WA 4DR4C 1MDFA 3GR0A 2WP0C 5E7QA 2D1QA 2DYJA 3PBKA 2VQEC 2D28C 1VEHA 3AF6A 2XR1A 4DR5C 2D1TA 3A9VA 3IPLA 1V26A 2AYAA 1N32C 3TDEA 1FUGA 3LUSA 4MTNA 5IT9D 4KHPC 1ML8A 3LNVA 2BH1X 5AE1A 2BJOA 4D4GA 4JYAC 1N34C 1O92A 1XHJA 2KZ0A 4DR1C 1IB8A 2UXBC 2YWCA 5A1GA 3VNRA 4R0MA 3RG2A 4AQYC 4L7IA 4JI2C 3IEUA 2ASBA 3E7XA 3LAXA 2QVZX 2YCBA 3S82A 1QM4A 1NYEA 1VLAA 2DPLA 4B3TC 2PN2A 1HNXC 1J5EC 4NXNC 1HNWC 4U5YD 1YGTA 3L95X 4OYCA 1HH2P 1O93A 1MXAA 3A4IA 4DUYC 2DHMA 5H9UA 4LF9C 3LGXA 4PZPA 3J80D 3FM7A 5AE3A 4PROC 4G37A 1MKYA 4LF6C 5IFIA 3CQ2A 2ZM6C 1IBMC 3K6RA 4X66C 4DR3C 1XMQC 4OX9C 1FJGC 3EERA 2MCQA 4LFBC 1LCIA 5KEIA 4I9GA 2EGTA 2OPLB 4LF7C 2M5OA 3IMLA 5FLXD 4JI6C 4GS5A 1QWIA 2CU6A 1T5HX 1V60A 1IBKC 3VNSA 2P02A 4HPVA 5K85A 2QL8A 3DAYA 2PG1E 3OTOC 5CZXA 4EATA 4DR6C 3GPCA 4RM3A 1YJ7A 4X65C 5A2QD 4BSZA 4ZJZA 4R1MA 2P20A 2JMPA 1ULTA 4JI1C 4DV2C 5LCIA 4DR7C 4BCAA 4DR2C 2UU9C 5BSWA 3TUFA 3C5EA 3DLPX 5BSMA 4R1LA 3JAMD 3L8CA 2UUBC 4JI0C 4RVOA 2P2JA 2M5HA 3ETCA 4ODJA 1N36C 4B3SC 4BC7A 4IR7A 2Y4OA 4DG9A 3CW8X 2QVYX 4LF5C 3ETOA 2D7VA 4K0BA 5BR8C 5T8TA 4BC9A 1ZB9A 3IEVA 4MH4A 1FLOA 4JI4C 4JM1A 1PA4A 4ISBA 4L2ZA 3G7SA 2OBVA 2E8CA 1WCJA 4FUTA 4DV1C 4RMNA 3H2TA 1UKKA 5BURA 2E0GA 1PU1A 1TH5A 4RLQA 3NYQA 2NCLA 5BSRA 3UX2A 3PROC 2VSQA 1AMUA 1XRBA 4D57A 4DCVA 2YWBA 4TPSB 4NDNA 1T5DX 3NPDA 3T1HC 1XMOC 2V7BA 4L4QA 5BSVA 4DCTA 3J7AD 1MXCA 4LFAC 2Y4NA 3DHVA 2MMAB 3T1YC 4B3RC 4K0KC 4FUQA 1O90A 3R44A 4D4IA 4LE5A 1WF3A 2ZTBA 2MM9A 2Z51A 4DV7C 3TQIA 2E5LC 3I07A 3UEBA 4PUIA 3A26A 4WS9A 1MXBA 2QW0X 5BSUA 1HNZC 3A25A 4NXMC 2ZZNA 1L2FA 2P2FA 2F4VC 1USPA 5ADZA 1XRAA 2P2BA 4LF8C 1NY8A 5CZVA 4FTFA 3AY0A 5LMNC 4GKJC 4DV3C 4JI3C 3A9UA 3CW9A 3LNOA 3I08A 1XNRC 3SO4A 4G1IA 5BUSA 2ONFA 4IZ6A 4RLFA 1O9TA 5KYVA 1UWDA 2ATWA 4RVNA 1GPMA 5A19A 2P2QA 4GKKC 1XRCA 2E8FA
chains in the Genus database with same CATH topology
4G36A 2D1SA 1P7LA 2VZEA 5KYTA 4BBYA 2UUCC 5LMUC 4WV3A 4JI5C 4I9FA 3GKUA 1WH9A 1MD9A 4DV6C 1K0RA 4X62C 4DV5C 1LQLA 3AF5A 3RV2A 1KKGA 4YHHC 1I94C 5BSTA 4JI8C 3NI2A 2PROA 3CJEA 1EGAA 3FCEA 1ZB8A 3N2QA 4JI7C 3UZ0A 3UOWA 4ZLPA 2D1RA 4PHTA 3NYRA 4GXQA 4NOZA 4X64C 4DV4C 3GR1A 4DCUA 4DCSA 3FCCA 3R9WA 4KTTA 5GTDA 3KXWA 3R9XA 2UXDC 2E8EA 4RM2A 5A1IA 4OXIA 2D27A 2E7GA 5IWAC 4B3MC 4DUZC 1RY2A 2VQFC 2CY1A 2UXCC 4GXRA 2HHHC 3PESA 3J81D 2Y27A 1PG3A 4XX2A 4LFCC 5T8SA 2QVXX 1IBLC 1MDBA 5K8FA 1JOSA 1N33C 2KZFA 2P2MA 4DV0C 2HJGA 1V25A 5JRHA 4YY3C 1PG4A 1HR0C 4KTVA 4LF4C 2OPLA 1N2FA 4DG8A 4D56A 1USPB 3N54B 5BUQA 1RG9A 2PT7G 3EQ6A 2WD9A 5DV9A 2OO4A 2CXCA 3VNQA 2UUAC 5AE2A 1BA3A 1XNQC 4JV5C 3B7WA 3E7WA 4DR4C 1MDFA 3GR0A 2WP0C 5E7QA 2D1QA 2DYJA 3PBKA 2VQEC 2D28C 3AF6A 2XR1A 4DR5C 2D1TA 3A9VA 3IPLA 1V26A 2AYAA 1N32C 3TDEA 1FUGA 3LUSA 4MTNA 5IT9D 4KHPC 1ML8A 3LNVA 2BH1X 5AE1A 2BJOA 4D4GA 4JYAC 1N34C 1O92A 4DR1C 2UXBC 2YWCA 5A1GA 3VNRA 4R0MA 3RG2A 4AQYC 4L7IA 4JI2C 3IEUA 2ASBA 3E7XA 3LAXA 2QVZX 2YCBA 3S82A 1QM4A 1NYEA 1VLAA 2DPLA 4B3TC 2PN2A 1HNXC 1J5EC 4NXNC 1HNWC 4U5YD 3L95X 4OYCA 1HH2P 1O93A 1MXAA 3A4IA 4DUYC 5H9UA 4LF9C 3LGXA 4PZPA 3J80D 5AE3A 4PROC 4G37A 1MKYA 4LF6C 5IFIA 2ZM6C 1IBMC 4X66C 4DR3C 1XMQC 4OX9C 1FJGC 3EERA 4LFBC 1LCIA 5KEIA 4I9GA 2EGTA 2OPLB 4LF7C 3IMLA 5FLXD 4JI6C 4GS5A 1QWIA 1T5HX 1IBKC 3VNSA 2P02A 4HPVA 5K85A 2QL8A 3DAYA 3OTOC 5CZXA 4EATA 4DR6C 3GPCA 4RM3A 1YJ7A 4X65C 5A2QD 4BSZA 4ZJZA 4R1MA 2P20A 2JMPA 1ULTA 4JI1C 4DV2C 4DR7C 4BCAA 4DR2C 2UU9C 5BSWA 3TUFA 3C5EA 3DLPX 5BSMA 4R1LA 3JAMD 3L8CA 2UUBC 4JI0C 4RVOA 2P2JA 3ETCA 4ODJA 1N36C 4B3SC 4BC7A 4IR7A 2Y4OA 4DG9A 3CW8X 2QVYX 4LF5C 3ETOA 2D7VA 4K0BA 5BR8C 5T8TA 4BC9A 1ZB9A 3IEVA 4MH4A 4JI4C 4JM1A 1PA4A 4ISBA 4L2ZA 3G7SA 2OBVA 2E8CA 4FUTA 4DV1C 4RMNA 3H2TA 1UKKA 5BURA 2E0GA 4RLQA 3NYQA 5BSRA 3PROC 2VSQA 1AMUA 1XRBA 4D57A 4DCVA 2YWBA 4TPSB 4NDNA 1T5DX 3NPDA 3T1HC 1XMOC 2V7BA 4L4QA 5BSVA 4DCTA 3J7AD 1MXCA 4LFAC 2Y4NA 3DHVA 3T1YC 4B3RC 4K0KC 4FUQA 1O90A 3R44A 4D4IA 4LE5A 1WF3A 4DV7C 3TQIA 2E5LC 3I07A 4WS9A 1MXBA 2QW0X 5BSUA 1HNZC 4NXMC 1L2FA 2P2FA 2F4VC 1USPA 5ADZA 1XRAA 2P2BA 4LF8C 5CZVA 4FTFA 5LMNC 4GKJC 4DV3C 4JI3C 3A9UA 3CW9A 3I08A 1XNRC 3SO4A 4G1IA 5BUSA 2ONFA 4IZ6A 4RLFA 1O9TA 5KYVA 2ATWA 4RVNA 1GPMA 5A19A 2P2QA 4GKKC 1XRCA 2E8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEV A;  4MH4 A;  4LFB C;  2PT7 G;  4JI4 C;  1PA4 A;  2EGT A;  2CXC A;  2OPL B;  4LF7 C;  2UUC C;  5FLX D;  5LMU C;  4OX9 C;  4JI5 C;  4JI6 C;  2E8C A;  2UUA C;  3GKU A;  1WH9 A;  4DV6 C;  1K0R A;  4X62 C;  4DV5 C;  1QWI A;  1LQL A;  4DV1 C;  1XNQ C;  3AF5 A;  4JV5 C;  1KKG A;  4DR4 C;  4YHH C;  1I94 C;  1IBK C;  4JI8 C;  1UKK A;  2DYJ A;  2VQE C;  3CJE A;  1EGA A;  1ZB8 A;  3AF6 A;  4GKK C;  2QL8 A;  2XR1 A;  4DR5 C;  4JI7 C;  3OTO C;  4DR6 C;  5A2Q D;  4X65 C;  1N32 C;  4BSZ A;  3LUS A;  4MTN A;  5IT9 D;  4DCV A;  4KHP C;  4NOZ A;  4X64 C;  1ML8 A;  4DV4 C;  2BJO A;  4JYA C;  4DCS A;  4DCU A;  3T1H C;  1XMO C;  1N34 C;  3R9W A;  4DR1 C;  2JMP A;  4JI1 C;  2UXB C;  4DCT A;  3R9X A;  4DV2 C;  4DR7 C;  3J7A D;  2UXD C;  4LFA C;  2E8E A;  3T1Y C;  4AQY C;  4B3R C;  4K0K C;  4DR2 C;  4JI2 C;  3IEU A;  2ASB A;  2UU9 C;  1WF3 A;  2E7G A;  5IWA C;  4B3M C;  2YCB A;  4DUZ C;  4DV7 C;  2VQF C;  2CY1 A;  1NYE A;  2UXC C;  2E5L C;  2HHH C;  1VLA A;  3I07 A;  3JAM D;  3J81 D;  4B3T C;  2PN2 A;  2UUB C;  1HNX C;  4XX2 A;  4LFC C;  1J5E C;  4NXN C;  1IBL C;  1HNZ C;  1HNW C;  4NXM C;  4JI0 C;  1L2F A;  1JOS A;  2F4V C;  1N33 C;  1USP A;  1HH2 P;  2KZF A;  4LF8 C;  4DUY C;  1N36 C;  4B3S C;  4LF9 C;  4DV0 C;  5LMN C;  4GKJ C;  2HJG A;  4DV3 C;  4JI3 C;  4LF5 C;  3J80 D;  2D7V A;  1XNR C;  4YY3 C;  1HR0 C;  4LF4 C;  1MKY A;  2OPL A;  4LF6 C;  1N2F A;  2ONF A;  2ZM6 C;  2ATW A;  1IBM C;  1USP B;  4X66 C;  4DR3 C;  5BR8 C;  1XMQ C;  1FJG C;  1ZB9 A;  3EER A;  2E8F A; 
#chains in the Genus database with same CATH topology
 4G36 A;  2D1S A;  1P7L A;  2VZE A;  5KYT A;  4BBY A;  2UUC C;  5LMU C;  4WV3 A;  4JI5 C;  4I9F A;  3GKU A;  1WH9 A;  1MD9 A;  4DV6 C;  1K0R A;  4X62 C;  4DV5 C;  1LQL A;  3AF5 A;  4PUG A;  3RV2 A;  1KKG A;  4YHH C;  1I94 C;  5BST A;  4JI8 C;  3NI2 A;  2PRO A;  3CJE A;  1EGA A;  3FCE A;  1ZB8 A;  3N2Q A;  4JI7 C;  3UZ0 A;  3UOW A;  4ZLP A;  2D1R A;  3CQ3 A;  4PHT A;  3NYR A;  4GXQ A;  4NOZ A;  4X64 C;  4DV4 C;  3GR1 A;  4DCU A;  4DCS A;  3FCC A;  2KDN A;  3O2E A;  3R9W A;  4KTT A;  5GTD A;  2ZZM A;  3KXW A;  3R9X A;  2YX1 A;  2UXD C;  2E8E A;  4RM2 A;  5A1I A;  1M6X C;  4OXI A;  2D27 A;  2E7G A;  1M6X A;  5IWA C;  3UX3 A;  4B3M C;  1RY2 A;  4DUZ C;  2VQF C;  2CY1 A;  2UXC C;  4GXR A;  2HHH C;  3PES A;  3J81 D;  2Y27 A;  3CQ1 A;  1PG3 A;  4XX2 A;  4LFC C;  5T8S A;  2QVX X;  1IBL C;  1MDB A;  5K8F A;  1JOS A;  1N33 C;  2KZF A;  3TR3 A;  2P2M A;  4DV0 C;  2HJG A;  1V25 A;  5JRH A;  4YY3 C;  1PG4 A;  1HR0 C;  4KTV A;  4LF4 C;  2OPL A;  1N2F A;  4DG8 A;  4D56 A;  1P4E C;  1USP B;  3N54 B;  5BUQ A;  1P4E A;  1XDX A;  1RG9 A;  2JNV A;  2PT7 G;  3EQ6 A;  2WD9 A;  5DV9 A;  2OO4 A;  2CXC A;  3VNQ A;  2UUA C;  5AE2 A;  4PUH A;  1BA3 A;  1XNQ C;  4JV5 C;  1XS3 A;  3B7W A;  3E7W A;  4DR4 C;  1MDF A;  3GR0 A;  2WP0 C;  5E7Q A;  2D1Q A;  2DYJ A;  3PBK A;  2VQE C;  2D28 C;  1VEH A;  3AF6 A;  2XR1 A;  4DR5 C;  2D1T A;  3A9V A;  3IPL A;  1V26 A;  2AYA A;  1N32 C;  3TDE A;  1FUG A;  3LUS A;  4MTN A;  5IT9 D;  4KHP C;  1ML8 A;  3LNV A;  2BH1 X;  5AE1 A;  2BJO A;  4D4G A;  4JYA C;  1N34 C;  1O92 A;  1XHJ A;  2KZ0 A;  4DR1 C;  1IB8 A;  2UXB C;  2YWC A;  5A1G A;  3VNR A;  4R0M A;  3RG2 A;  4AQY C;  4L7I A;  4JI2 C;  3IEU A;  2ASB A;  3E7X A;  3LAX A;  2QVZ X;  2YCB A;  3S82 A;  1QM4 A;  1NYE A;  1VLA A;  2DPL A;  4B3T C;  2PN2 A;  1HNX C;  1J5E C;  4NXN C;  1HNW C;  4U5Y D;  1YGT A;  3L95 X;  4OYC A;  1HH2 P;  1O93 A;  1MXA A;  3A4I A;  4DUY C;  2DHM A;  5H9U A;  4LF9 C;  3LGX A;  4PZP A;  3J80 D;  3FM7 A;  5AE3 A;  4PRO C;  4G37 A;  1MKY A;  4LF6 C;  5IFI A;  3CQ2 A;  2ZM6 C;  1IBM C;  3K6R A;  4X66 C;  4DR3 C;  1XMQ C;  4OX9 C;  1FJG C;  3EER A;  2MCQ A;  4LFB C;  1LCI A;  5KEI A;  4I9G A;  2EGT A;  2OPL B;  4LF7 C;  2M5O A;  3IML A;  5FLX D;  4JI6 C;  4GS5 A;  1QWI A;  2CU6 A;  1T5H X;  1V60 A;  1IBK C;  3VNS A;  2P02 A;  4HPV A;  5K85 A;  2QL8 A;  3DAY A;  2PG1 E;  3OTO C;  5CZX A;  4EAT A;  4DR6 C;  3GPC A;  4RM3 A;  1YJ7 A;  4X65 C;  5A2Q D;  4BSZ A;  4ZJZ A;  4R1M A;  2P20 A;  2JMP A;  1ULT A;  4JI1 C;  4DV2 C;  5LCI A;  4DR7 C;  4BCA A;  4DR2 C;  2UU9 C;  5BSW A;  3TUF A;  3C5E A;  3DLP X;  5BSM A;  4R1L A;  3JAM D;  3L8C A;  2UUB C;  4JI0 C;  4RVO A;  2P2J A;  2M5H A;  3ETC A;  4ODJ A;  1N36 C;  4B3S C;  4BC7 A;  4IR7 A;  2Y4O A;  4DG9 A;  3CW8 X;  2QVY X;  4LF5 C;  3ETO A;  2D7V A;  4K0B A;  5BR8 C;  5T8T A;  4BC9 A;  1ZB9 A;  3IEV A;  4MH4 A;  1FLO A;  4JI4 C;  4JM1 A;  1PA4 A;  4ISB A;  4L2Z A;  3G7S A;  2OBV A;  2E8C A;  1WCJ A;  4FUT A;  4DV1 C;  4RMN A;  3H2T A;  1UKK A;  5BUR A;  2E0G A;  1PU1 A;  1TH5 A;  4RLQ A;  3NYQ A;  2NCL A;  5BSR A;  3UX2 A;  3PRO C;  2VSQ A;  1AMU A;  1XRB A;  4D57 A;  4DCV A;  2YWB A;  4TPS B;  4NDN A;  1T5D X;  3NPD A;  3T1H C;  1XMO C;  2V7B A;  4L4Q A;  5BSV A;  4DCT A;  3J7A D;  1MXC A;  4LFA C;  2Y4N A;  3DHV A;  2MMA B;  3T1Y C;  4B3R C;  4K0K C;  4FUQ A;  1O90 A;  3R44 A;  4D4I A;  4LE5 A;  1WF3 A;  2ZTB A;  2MM9 A;  2Z51 A;  4DV7 C;  3TQI A;  2E5L C;  3I07 A;  3UEB A;  4PUI A;  3A26 A;  4WS9 A;  1MXB A;  2QW0 X;  5BSU A;  1HNZ C;  3A25 A;  4NXM C;  2ZZN A;  1L2F A;  2P2F A;  2F4V C;  1USP A;  5ADZ A;  1XRA A;  2P2B A;  4LF8 C;  1NY8 A;  5CZV A;  4FTF A;  3AY0 A;  5LMN C;  4GKJ C;  4DV3 C;  4JI3 C;  3A9U A;  3CW9 A;  3LNO A;  3I08 A;  1XNR C;  3SO4 A;  4G1I A;  5BUS A;  2ONF A;  4IZ6 A;  4RLF A;  1O9T A;  5KYV A;  1UWD A;  2ATW A;  4RVN A;  1GPM A;  5A19 A;  2P2Q A;  4GKK C;  1XRC A;  2E8F A; 
#chains in the Genus database with same CATH homology
 4G36 A;  2D1S A;  1P7L A;  2VZE A;  5KYT A;  4BBY A;  2UUC C;  5LMU C;  4WV3 A;  4JI5 C;  4I9F A;  3GKU A;  1WH9 A;  1MD9 A;  4DV6 C;  1K0R A;  4X62 C;  4DV5 C;  1LQL A;  3AF5 A;  3RV2 A;  1KKG A;  4YHH C;  1I94 C;  5BST A;  4JI8 C;  3NI2 A;  2PRO A;  3CJE A;  1EGA A;  3FCE A;  1ZB8 A;  3N2Q A;  4JI7 C;  3UZ0 A;  3UOW A;  4ZLP A;  2D1R A;  4PHT A;  3NYR A;  4GXQ A;  4NOZ A;  4X64 C;  4DV4 C;  3GR1 A;  4DCU A;  4DCS A;  3FCC A;  3R9W A;  4KTT A;  5GTD A;  3KXW A;  3R9X A;  2UXD C;  2E8E A;  4RM2 A;  5A1I A;  4OXI A;  2D27 A;  2E7G A;  5IWA C;  4B3M C;  4DUZ C;  1RY2 A;  2VQF C;  2CY1 A;  2UXC C;  4GXR A;  2HHH C;  3PES A;  3J81 D;  2Y27 A;  1PG3 A;  4XX2 A;  4LFC C;  5T8S A;  2QVX X;  1IBL C;  1MDB A;  5K8F A;  1JOS A;  1N33 C;  2KZF A;  2P2M A;  4DV0 C;  2HJG A;  1V25 A;  5JRH A;  4YY3 C;  1PG4 A;  1HR0 C;  4KTV A;  4LF4 C;  2OPL A;  1N2F A;  4DG8 A;  4D56 A;  1USP B;  3N54 B;  5BUQ A;  1RG9 A;  2PT7 G;  3EQ6 A;  2WD9 A;  5DV9 A;  2OO4 A;  2CXC A;  3VNQ A;  2UUA C;  5AE2 A;  1BA3 A;  1XNQ C;  4JV5 C;  3B7W A;  3E7W A;  4DR4 C;  1MDF A;  3GR0 A;  2WP0 C;  5E7Q A;  2D1Q A;  2DYJ A;  3PBK A;  2VQE C;  2D28 C;  3AF6 A;  2XR1 A;  4DR5 C;  2D1T A;  3A9V A;  3IPL A;  1V26 A;  2AYA A;  1N32 C;  3TDE A;  1FUG A;  3LUS A;  4MTN A;  5IT9 D;  4KHP C;  1ML8 A;  3LNV A;  2BH1 X;  5AE1 A;  2BJO A;  4D4G A;  4JYA C;  1N34 C;  1O92 A;  4DR1 C;  2UXB C;  2YWC A;  5A1G A;  3VNR A;  4R0M A;  3RG2 A;  4AQY C;  4L7I A;  4JI2 C;  3IEU A;  2ASB A;  3E7X A;  3LAX A;  2QVZ X;  2YCB A;  3S82 A;  1QM4 A;  1NYE A;  1VLA A;  2DPL A;  4B3T C;  2PN2 A;  1HNX C;  1J5E C;  4NXN C;  1HNW C;  4U5Y D;  3L95 X;  4OYC A;  1HH2 P;  1O93 A;  1MXA A;  3A4I A;  4DUY C;  5H9U A;  4LF9 C;  3LGX A;  4PZP A;  3J80 D;  5AE3 A;  4PRO C;  4G37 A;  1MKY A;  4LF6 C;  5IFI A;  2ZM6 C;  1IBM C;  4X66 C;  4DR3 C;  1XMQ C;  4OX9 C;  1FJG C;  3EER A;  4LFB C;  1LCI A;  5KEI A;  4I9G A;  2EGT A;  2OPL B;  4LF7 C;  3IML A;  5FLX D;  4JI6 C;  4GS5 A;  1QWI A;  1T5H X;  1IBK C;  3VNS A;  2P02 A;  4HPV A;  5K85 A;  2QL8 A;  3DAY A;  3OTO C;  5CZX A;  4EAT A;  4DR6 C;  3GPC A;  4RM3 A;  1YJ7 A;  4X65 C;  5A2Q D;  4BSZ A;  4ZJZ A;  4R1M A;  2P20 A;  2JMP A;  1ULT A;  4JI1 C;  4DV2 C;  4DR7 C;  4BCA A;  4DR2 C;  2UU9 C;  5BSW A;  3TUF A;  3C5E A;  3DLP X;  5BSM A;  4R1L A;  3JAM D;  3L8C A;  2UUB C;  4JI0 C;  4RVO A;  2P2J A;  3ETC A;  4ODJ A;  1N36 C;  4B3S C;  4BC7 A;  4IR7 A;  2Y4O A;  4DG9 A;  3CW8 X;  2QVY X;  4LF5 C;  3ETO A;  2D7V A;  4K0B A;  5BR8 C;  5T8T A;  4BC9 A;  1ZB9 A;  3IEV A;  4MH4 A;  4JI4 C;  4JM1 A;  1PA4 A;  4ISB A;  4L2Z A;  3G7S A;  2OBV A;  2E8C A;  4FUT A;  4DV1 C;  4RMN A;  3H2T A;  1UKK A;  5BUR A;  2E0G A;  4RLQ A;  3NYQ A;  5BSR A;  3PRO C;  2VSQ A;  1AMU A;  1XRB A;  4D57 A;  4DCV A;  2YWB A;  4TPS B;  4NDN A;  1T5D X;  3NPD A;  3T1H C;  1XMO C;  2V7B A;  4L4Q A;  5BSV A;  4DCT A;  3J7A D;  1MXC A;  4LFA C;  2Y4N A;  3DHV A;  3T1Y C;  4B3R C;  4K0K C;  4FUQ A;  1O90 A;  3R44 A;  4D4I A;  4LE5 A;  1WF3 A;  4DV7 C;  3TQI A;  2E5L C;  3I07 A;  4WS9 A;  1MXB A;  2QW0 X;  5BSU A;  1HNZ C;  4NXM C;  1L2F A;  2P2F A;  2F4V C;  1USP A;  5ADZ A;  1XRA A;  2P2B A;  4LF8 C;  5CZV A;  4FTF A;  5LMN C;  4GKJ C;  4DV3 C;  4JI3 C;  3A9U A;  3CW9 A;  3I08 A;  1XNR C;  3SO4 A;  4G1I A;  5BUS A;  2ONF A;  4IZ6 A;  4RLF A;  1O9T A;  5KYV A;  2ATW A;  4RVN A;  1GPM A;  5A19 A;  2P2Q A;  4GKK C;  1XRC A;  2E8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...