4X66C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4x66C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4x66C02
4DV6C 4DUZC 4X64C 1WH9A 4B3RC 3T1HC 5LMNC 4LF5C 1PA4A 4B3MC 2E8CA 2UXCC 2XR1A 1K0RA 2QL8A 3IEVA 3IEUA 1IBLC 3I07A 4DV1C 4JI0C 4JI6C 4LFCC 4LF6C 4LF7C 2UUCC 5IT9D 2OPLA 1L2FA 4JI5C 2VQFC 4LF9C 4DV2C 1IBKC 1NYEA 4K0KC 4GKKC 1XMQC 1XNQC 5IWAC 5BR8C 2EGTA 3T1YC 4LF4C 4BSZA 2E7GA 4DUYC 4X65C 1XNRC 4DR3C 4DV0C 4X66C 2VQEC 4DV3C 4NOZA 1N34C 1ZB9A 4LFAC 2ZM6C 4DCSA 4XX2A 5FLXD 1ML8A 2KZFA 2CY1A 1HR0C 4JI2C 3OTOC 3AF6A 2OPLB 4JI7C 4LF8C 3GKUA 1N32C 1XMOC 4JI3C 4YY3C 3EERA 1I94C 4DV7C 4MH4A 4DR6C 1N36C 3R9WA 1FJGC 4GKJC 2PN2A 2PT7G 2JMPA 2YCBA 5A2QD 1UKKA 1N2FA 4B3TC 1KKGA 4DCUA 4DR7C 3J81D 3R9XA 4JYAC 2UUBC 5LMUC 2D7VA 2HHHC 4JI1C 2HJGA 4DR1C 2UXBC 1WF3A 4NXMC 1QWIA 4DV5C 4DR5C 4B3SC 4NXNC 2ATWA 2ASBA 4JI4C 1USPB 1USPA 2BJOA 4OX9C 3J80D 1VLAA 3JAMD 2UUAC 1HH2P 1LQLA 3J7AD 2F4VC 1ZB8A 4YHHC 1HNXC 2UXDC 4JV5C 1JOSA 4MTNA 3CJEA 4JI8C 1HNWC 4AQYC 2DYJA 1EGAA 2ONFA 4LFBC 1MKYA 3LUSA 4KHPC 1IBMC 1J5EC 1N33C 2E8FA 4X62C 4DR2C 4DR4C 4DCTA 2E8EA 2E5LC 4DCVA 1HNZC 4DV4C 3AF5A 2CXCA 2UU9C
chains in the Genus database with same CATH superfamily
3CQ3A 3I08A 5DV9A 4DUZC 4X64C 4B3RC 2Z51A 3T1HC 2UXCC 4BC7A 2KZ0A 4L7IA 2MMAB 2ZZNA 5BSTA 5BSWA 5IT9D 2CU6A 4JI5C 4LF9C 1IBKC 1NYEA 3RV2A 3UEBA 2YX1A 2M5HA 4D4IA 5IWAC 4BSZA 3CQ1A 1MDFA 3FM7A 3PESA 3A9UA 4DV3C 1O93A 4R0MA 1N34C 2OO4A 5BUSA 1ML8A 2WP0C 4JI2C 1N32C 2VSQA 1XMOC 3PBKA 4JI3C 1IB8A 4YY3C 4IR7A 1I94C 4DR6C 3RG2A 3TR3A 1FJGC 2D1TA 4GKJC 2PN2A 2PT7G 2JMPA 5A2QD 3TDEA 1N2FA 1KKGA 3N2QA 1V60A 1XRCA 1ULTA 4FTFA 2D7VA 4G37A 1WCJA 3TQIA 1M6XC 4TPSB 2ATWA 2ASBA 1USPB 4KTTA 2BJOA 2QVXX 2UUAC 1HH2P 1LQLA 3J7AD 1BA3A 1T5DX 4MTNA 3NYQA 3LNOA 1HNWC 1O9TA 3A26A 1EGAA 4PROC 3TUFA 1MKYA 2MCQA 4R1LA 4NDNA 2WD9A 1N33C 1V25A 2QW0X 3A9VA 3H2TA 3FCEA 4DCVA 1HNZC 4D57A 5KYVA 4RLQA 5GTDA 3LNVA 2CXCA 2UU9C 4FUQA 4DV6C 4R1MA 4WS9A 2E8CA 5KYTA 1K0RA 3GR1A 2D1QA 4ZJZA 2BH1X 4LF7C 1O92A 4PUHA 5BURA 1LCIA 4KTVA 4K0KC 4GKKC 1FUGA 3N54B 2EGTA 3T1YC 1MXBA 4RLFA 4X66C 4NOZA 4FUTA 1ZB9A 3DAYA 4WV3A 2P20A 2P2MA 2KZFA 1HR0C 4JI7C 3OTOC 4LF8C 2OPLB 3GKUA 3GR0A 1PU1A 4DG9A 5LCIA 3FCCA 4G36A 3CW9A 4PHTA 3EERA 2Y4OA 4MH4A 5A19A 1N36C 3R9WA 1P4EC 4RMNA 4B3TC 3J81D 4JYAC 5LMUC 3PROC 4PUGA 2HJGA 4NXMC 5BSMA 3UX2A 2D28C 3ETOA 4L4QA 2DPLA 2NCLA 3J80D 1VLAA 1XDXA 3JAMD 3UOWA 4PZPA 1HNXC 2UXDC 1JOSA 4PUIA 1QM4A 4AQYC 4BC9A 5K85A 1T5HX 4EATA 2ONFA 3G7SA 1PG3A 3LUSA 4OXIA 4D56A 5BSVA 1IBMC 1J5EC 4GXQA 1UWDA 4X62C 4DCTA 2YWCA 2E5LC 1GPMA 2ZTBA 2JNVA 2YWBA 1MDBA 3VNSA 5IFIA 1YJ7A 5LMNC 3CW8X 1MD9A 2PROA 4B3MC 2XR1A 3DHVA 2DHMA 4GS5A 1IBLC 2D1RA 3I07A 1P7LA 4DV1C 3DLPX 1AMUA 1RY2A 3NYRA 2UUCC 2VQFC 4DV2C 1XMQC 1XNQC 2OBVA 3UZ0A 5BR8C 2E0GA 4IZ6A 2P2FA 3L95X 3IMLA 2KDNA 4LF4C 2MM9A 2V7BA 1XNRC 3O2EA 4DV0C 3UX3A 1P4EA 2ZM6C 2P02A 4RM3A 1PG4A 3CQ2A 3AF6A 4RM2A 1MXAA 3NI2A 5CZVA 5ADZA 3GPCA 1UKKA 5BSRA 4L2ZA 3R9XA 4LE5A 4DR1C 3A4IA 4HPVA 4DV5C 2D1SA 4U5YD 4DR5C 4B3SC 3ETCA 5KEIA 3E7WA 4OX9C 2AYAA 1M6XA 2F4VC 4YHHC 5E7QA 2P2JA 1XS3A 4G1IA 1FLOA 3B7WA 5JRHA 5T8SA 2DYJA 3A25A 4KHPC 2E8FA 4DR4C 5H9UA 2E8EA 4D4GA 3S82A 3AY0A 1WH9A 4GXRA 5CZXA 4LF5C 1PA4A 3NPDA 2Y27A 2P2QA 2QL8A 3IEVA 3IEUA 2ZZMA 3VNRA 4JI0C 5AE3A 4JI6C 4LFCC 4LF6C 4I9GA 4I9FA 2OPLA 1L2FA 5T8TA 4OYCA 4JM1A 4ODJA 3IPLA 4BBYA 2E7GA 3E7XA 4DUYC 4X65C 4DR3C 3KXWA 2VQEC 2P2BA 1YGTA 4LFAC 1NY8A 4DCSA 4XX2A 5FLXD 2CY1A 5BUQA 4DG8A 3L8CA 1VEHA 4K0BA 3VNQA 1O90A 4ISBA 2PG1E 4DV7C 3SO4A 3LGXA 2YCBA 1XRAA 4DCUA 4DR7C 2QVYX 2UUBC 3LAXA 2HHHC 3R44A 4JI1C 2UXBC 1WF3A 1QWIA 1TH5A 1RG9A 2Y4NA 4NXNC 4JI4C 5AE1A 1USPA 2QVZX 1XHJA 5K8FA 4ZLPA 1ZB8A 5AE2A 4JV5C 2M5OA 1V26A 1MXCA 3CJEA 4JI8C 2D27A 4BCAA 4RVNA 5BSUA 2VZEA 5A1GA 4LFBC 4RVOA 4DR2C 1XRBA 5A1IA 4DV4C 3AF5A 3K6RA 3C5EA 3EQ6A
chains in the Genus database with same CATH topology
3I08A 5DV9A 4DUZC 4X64C 4B3RC 3T1HC 2UXCC 4BC7A 4L7IA 5BSTA 5BSWA 5IT9D 4JI5C 4LF9C 1IBKC 1NYEA 3RV2A 4D4IA 5IWAC 4BSZA 1MDFA 3PESA 3A9UA 4DV3C 1O93A 4R0MA 1N34C 2OO4A 5BUSA 1ML8A 2WP0C 4JI2C 1N32C 2VSQA 1XMOC 3PBKA 4JI3C 4YY3C 4IR7A 1I94C 4DR6C 3RG2A 1FJGC 2D1TA 4GKJC 2PN2A 2PT7G 2JMPA 5A2QD 3TDEA 1N2FA 1KKGA 3N2QA 1XRCA 1ULTA 4FTFA 2D7VA 4G37A 3TQIA 4TPSB 2ATWA 2ASBA 1USPB 4KTTA 2BJOA 2QVXX 2UUAC 1HH2P 1LQLA 3J7AD 1BA3A 1T5DX 4MTNA 3NYQA 1HNWC 1O9TA 1EGAA 4PROC 3TUFA 1MKYA 4R1LA 4NDNA 2WD9A 1N33C 1V25A 2QW0X 3A9VA 3H2TA 3FCEA 4DCVA 1HNZC 4D57A 5KYVA 4RLQA 5GTDA 3LNVA 2CXCA 2UU9C 4FUQA 4DV6C 4R1MA 4WS9A 2E8CA 5KYTA 1K0RA 3GR1A 2D1QA 4ZJZA 2BH1X 4LF7C 1O92A 5BURA 1LCIA 4KTVA 4K0KC 4GKKC 1FUGA 3N54B 2EGTA 3T1YC 1MXBA 4RLFA 4X66C 4NOZA 4FUTA 1ZB9A 3DAYA 4WV3A 2P20A 2P2MA 2KZFA 1HR0C 4JI7C 3OTOC 4LF8C 2OPLB 3GKUA 3GR0A 4DG9A 3FCCA 4G36A 3CW9A 4PHTA 3EERA 2Y4OA 4MH4A 5A19A 1N36C 3R9WA 4RMNA 4B3TC 3J81D 4JYAC 5LMUC 3PROC 2HJGA 4NXMC 5BSMA 2D28C 3ETOA 4L4QA 2DPLA 3J80D 1VLAA 3JAMD 3UOWA 4PZPA 1HNXC 2UXDC 1JOSA 1QM4A 4AQYC 4BC9A 5K85A 1T5HX 4EATA 2ONFA 3G7SA 1PG3A 3LUSA 4OXIA 4D56A 5BSVA 1IBMC 1J5EC 4GXQA 4X62C 4DCTA 2YWCA 2E5LC 1GPMA 2YWBA 1MDBA 3VNSA 5IFIA 1YJ7A 5LMNC 3CW8X 1MD9A 2PROA 4B3MC 2XR1A 3DHVA 4GS5A 1IBLC 2D1RA 3I07A 1P7LA 4DV1C 3DLPX 1AMUA 1RY2A 3NYRA 2UUCC 2VQFC 4DV2C 1XMQC 1XNQC 2OBVA 3UZ0A 5BR8C 2E0GA 4IZ6A 2P2FA 3L95X 3IMLA 4LF4C 2V7BA 1XNRC 4DV0C 2ZM6C 2P02A 4RM3A 1PG4A 3AF6A 4RM2A 1MXAA 3NI2A 5CZVA 5ADZA 3GPCA 1UKKA 5BSRA 4L2ZA 3R9XA 4LE5A 4DR1C 3A4IA 4HPVA 4DV5C 2D1SA 4U5YD 4DR5C 4B3SC 3ETCA 5KEIA 3E7WA 4OX9C 2AYAA 2F4VC 4YHHC 5E7QA 2P2JA 4G1IA 3B7WA 5JRHA 5T8SA 2DYJA 4KHPC 2E8FA 4DR4C 5H9UA 2E8EA 4D4GA 3S82A 1WH9A 4GXRA 5CZXA 4LF5C 1PA4A 3NPDA 2Y27A 2P2QA 2QL8A 3IEVA 3IEUA 3VNRA 4JI0C 5AE3A 4JI6C 4LFCC 4LF6C 4I9GA 4I9FA 2OPLA 1L2FA 5T8TA 4OYCA 4JM1A 4ODJA 3IPLA 4BBYA 2E7GA 3E7XA 4DUYC 4X65C 4DR3C 3KXWA 2VQEC 2P2BA 4LFAC 4DCSA 4XX2A 5FLXD 2CY1A 5BUQA 4DG8A 3L8CA 4K0BA 3VNQA 1O90A 4ISBA 4DV7C 3SO4A 3LGXA 2YCBA 1XRAA 4DCUA 4DR7C 2QVYX 2UUBC 3LAXA 2HHHC 3R44A 4JI1C 2UXBC 1WF3A 1QWIA 4NXNC 1RG9A 2Y4NA 4JI4C 1USPA 5AE1A 2QVZX 5K8FA 4ZLPA 1ZB8A 5AE2A 4JV5C 1V26A 1MXCA 3CJEA 4JI8C 2D27A 4BCAA 4RVNA 5BSUA 2VZEA 5A1GA 4LFBC 4RVOA 4DR2C 1XRBA 5A1IA 4DV4C 3AF5A 3C5EA 3EQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 C;  4DUZ C;  4X64 C;  1WH9 A;  4B3R C;  3T1H C;  5LMN C;  4LF5 C;  1PA4 A;  4B3M C;  2E8C A;  2UXC C;  2XR1 A;  1K0R A;  2QL8 A;  3IEV A;  3IEU A;  1IBL C;  3I07 A;  4DV1 C;  4JI0 C;  4JI6 C;  4LFC C;  4LF6 C;  4LF7 C;  2UUC C;  5IT9 D;  2OPL A;  1L2F A;  4JI5 C;  2VQF C;  4LF9 C;  4DV2 C;  1IBK C;  1NYE A;  4K0K C;  4GKK C;  1XMQ C;  1XNQ C;  5IWA C;  5BR8 C;  2EGT A;  3T1Y C;  4LF4 C;  4BSZ A;  2E7G A;  4DUY C;  4X65 C;  1XNR C;  4DR3 C;  4DV0 C;  4X66 C;  2VQE C;  4DV3 C;  4NOZ A;  1N34 C;  1ZB9 A;  4LFA C;  2ZM6 C;  4DCS A;  4XX2 A;  5FLX D;  1ML8 A;  2KZF A;  2CY1 A;  1HR0 C;  4JI2 C;  3OTO C;  3AF6 A;  2OPL B;  4JI7 C;  4LF8 C;  3GKU A;  1N32 C;  1XMO C;  4JI3 C;  4YY3 C;  3EER A;  1I94 C;  4DV7 C;  4MH4 A;  4DR6 C;  1N36 C;  3R9W A;  1FJG C;  4GKJ C;  2PN2 A;  2PT7 G;  2JMP A;  2YCB A;  5A2Q D;  1UKK A;  1N2F A;  4B3T C;  1KKG A;  4DCU A;  4DR7 C;  3J81 D;  3R9X A;  4JYA C;  2UUB C;  5LMU C;  2D7V A;  2HHH C;  4JI1 C;  2HJG A;  4DR1 C;  2UXB C;  1WF3 A;  4NXM C;  1QWI A;  4DV5 C;  4DR5 C;  4B3S C;  4NXN C;  2ATW A;  2ASB A;  4JI4 C;  1USP B;  1USP A;  2BJO A;  4OX9 C;  3J80 D;  1VLA A;  3JAM D;  2UUA C;  1HH2 P;  1LQL A;  3J7A D;  2F4V C;  1ZB8 A;  4YHH C;  1HNX C;  2UXD C;  4JV5 C;  1JOS A;  4MTN A;  3CJE A;  4JI8 C;  1HNW C;  4AQY C;  2DYJ A;  1EGA A;  2ONF A;  4LFB C;  1MKY A;  3LUS A;  4KHP C;  1IBM C;  1J5E C;  1N33 C;  2E8F A;  4X62 C;  4DR2 C;  4DR4 C;  4DCT A;  2E8E A;  2E5L C;  4DCV A;  1HNZ C;  4DV4 C;  3AF5 A;  2CXC A;  2UU9 C; 
#chains in the Genus database with same CATH topology
 3CQ3 A;  3I08 A;  5DV9 A;  4DUZ C;  4X64 C;  4B3R C;  2Z51 A;  3T1H C;  2UXC C;  4BC7 A;  2KZ0 A;  4L7I A;  2MMA B;  2ZZN A;  5BST A;  5BSW A;  5IT9 D;  2CU6 A;  4JI5 C;  4LF9 C;  1IBK C;  1NYE A;  3RV2 A;  3UEB A;  2YX1 A;  2M5H A;  4D4I A;  5IWA C;  4BSZ A;  3CQ1 A;  1MDF A;  3FM7 A;  3PES A;  3A9U A;  4DV3 C;  1O93 A;  4R0M A;  1N34 C;  2OO4 A;  5BUS A;  1ML8 A;  2WP0 C;  4JI2 C;  1N32 C;  2VSQ A;  1XMO C;  3PBK A;  4JI3 C;  1IB8 A;  4YY3 C;  4IR7 A;  1I94 C;  4DR6 C;  3RG2 A;  3TR3 A;  1FJG C;  2D1T A;  4GKJ C;  2PN2 A;  2PT7 G;  2JMP A;  5A2Q D;  3TDE A;  1N2F A;  1KKG A;  3N2Q A;  1V60 A;  1XRC A;  1ULT A;  4FTF A;  2D7V A;  4G37 A;  1WCJ A;  3TQI A;  1M6X C;  4TPS B;  2ATW A;  2ASB A;  1USP B;  4KTT A;  2BJO A;  2QVX X;  2UUA C;  1HH2 P;  1LQL A;  3J7A D;  1BA3 A;  1T5D X;  4MTN A;  3NYQ A;  3LNO A;  1HNW C;  1O9T A;  3A26 A;  1EGA A;  4PRO C;  3TUF A;  1MKY A;  2MCQ A;  4R1L A;  4NDN A;  2WD9 A;  1N33 C;  1V25 A;  2QW0 X;  3A9V A;  3H2T A;  3FCE A;  4DCV A;  1HNZ C;  4D57 A;  5KYV A;  4RLQ A;  5GTD A;  3LNV A;  2CXC A;  2UU9 C;  4FUQ A;  4DV6 C;  4R1M A;  4WS9 A;  2E8C A;  5KYT A;  1K0R A;  3GR1 A;  2D1Q A;  4ZJZ A;  2BH1 X;  4LF7 C;  1O92 A;  4PUH A;  5BUR A;  1LCI A;  4KTV A;  4K0K C;  4GKK C;  1FUG A;  3N54 B;  2EGT A;  3T1Y C;  1MXB A;  4RLF A;  4X66 C;  4NOZ A;  4FUT A;  1ZB9 A;  3DAY A;  4WV3 A;  2P20 A;  2P2M A;  2KZF A;  1HR0 C;  4JI7 C;  3OTO C;  4LF8 C;  2OPL B;  3GKU A;  3GR0 A;  1PU1 A;  4DG9 A;  5LCI A;  3FCC A;  4G36 A;  3CW9 A;  4PHT A;  3EER A;  2Y4O A;  4MH4 A;  5A19 A;  1N36 C;  3R9W A;  1P4E C;  4RMN A;  4B3T C;  3J81 D;  4JYA C;  5LMU C;  3PRO C;  4PUG A;  2HJG A;  4NXM C;  5BSM A;  3UX2 A;  2D28 C;  3ETO A;  4L4Q A;  2DPL A;  2NCL A;  3J80 D;  1VLA A;  1XDX A;  3JAM D;  3UOW A;  4PZP A;  1HNX C;  2UXD C;  1JOS A;  4PUI A;  1QM4 A;  4AQY C;  4BC9 A;  5K85 A;  1T5H X;  4EAT A;  2ONF A;  3G7S A;  1PG3 A;  3LUS A;  4OXI A;  4D56 A;  5BSV A;  1IBM C;  1J5E C;  4GXQ A;  1UWD A;  4X62 C;  4DCT A;  2YWC A;  2E5L C;  1GPM A;  2ZTB A;  2JNV A;  2YWB A;  1MDB A;  3VNS A;  5IFI A;  1YJ7 A;  5LMN C;  3CW8 X;  1MD9 A;  2PRO A;  4B3M C;  2XR1 A;  3DHV A;  2DHM A;  4GS5 A;  1IBL C;  2D1R A;  3I07 A;  1P7L A;  4DV1 C;  3DLP X;  1AMU A;  1RY2 A;  3NYR A;  2UUC C;  2VQF C;  4DV2 C;  1XMQ C;  1XNQ C;  2OBV A;  3UZ0 A;  5BR8 C;  2E0G A;  4IZ6 A;  2P2F A;  3L95 X;  3IML A;  2KDN A;  4LF4 C;  2MM9 A;  2V7B A;  1XNR C;  3O2E A;  4DV0 C;  3UX3 A;  1P4E A;  2ZM6 C;  2P02 A;  4RM3 A;  1PG4 A;  3CQ2 A;  3AF6 A;  4RM2 A;  1MXA A;  3NI2 A;  5CZV A;  5ADZ A;  3GPC A;  1UKK A;  5BSR A;  4L2Z A;  3R9X A;  4LE5 A;  4DR1 C;  3A4I A;  4HPV A;  4DV5 C;  2D1S A;  4U5Y D;  4DR5 C;  4B3S C;  3ETC A;  5KEI A;  3E7W A;  4OX9 C;  2AYA A;  1M6X A;  2F4V C;  4YHH C;  5E7Q A;  2P2J A;  1XS3 A;  4G1I A;  1FLO A;  3B7W A;  5JRH A;  5T8S A;  2DYJ A;  3A25 A;  4KHP C;  2E8F A;  4DR4 C;  5H9U A;  2E8E A;  4D4G A;  3S82 A;  3AY0 A;  1WH9 A;  4GXR A;  5CZX A;  4LF5 C;  1PA4 A;  3NPD A;  2Y27 A;  2P2Q A;  2QL8 A;  3IEV A;  3IEU A;  2ZZM A;  3VNR A;  4JI0 C;  5AE3 A;  4JI6 C;  4LFC C;  4LF6 C;  4I9G A;  4I9F A;  2OPL A;  1L2F A;  5T8T A;  4OYC A;  4JM1 A;  4ODJ A;  3IPL A;  4BBY A;  2E7G A;  3E7X A;  4DUY C;  4X65 C;  4DR3 C;  3KXW A;  2VQE C;  2P2B A;  1YGT A;  4LFA C;  1NY8 A;  4DCS A;  4XX2 A;  5FLX D;  2CY1 A;  5BUQ A;  4DG8 A;  3L8C A;  1VEH A;  4K0B A;  3VNQ A;  1O90 A;  4ISB A;  2PG1 E;  4DV7 C;  3SO4 A;  3LGX A;  2YCB A;  1XRA A;  4DCU A;  4DR7 C;  2QVY X;  2UUB C;  3LAX A;  2HHH C;  3R44 A;  4JI1 C;  2UXB C;  1WF3 A;  1QWI A;  1TH5 A;  1RG9 A;  2Y4N A;  4NXN C;  4JI4 C;  5AE1 A;  1USP A;  2QVZ X;  1XHJ A;  5K8F A;  4ZLP A;  1ZB8 A;  5AE2 A;  4JV5 C;  2M5O A;  1V26 A;  1MXC A;  3CJE A;  4JI8 C;  2D27 A;  4BCA A;  4RVN A;  5BSU A;  2VZE A;  5A1G A;  4LFB C;  4RVO A;  4DR2 C;  1XRB A;  5A1I A;  4DV4 C;  3AF5 A;  3K6R A;  3C5E A;  3EQ6 A; 
#chains in the Genus database with same CATH homology
 3I08 A;  5DV9 A;  4DUZ C;  4X64 C;  4B3R C;  3T1H C;  2UXC C;  4BC7 A;  4L7I A;  5BST A;  5BSW A;  5IT9 D;  4JI5 C;  4LF9 C;  1IBK C;  1NYE A;  3RV2 A;  4D4I A;  5IWA C;  4BSZ A;  1MDF A;  3PES A;  3A9U A;  4DV3 C;  1O93 A;  4R0M A;  1N34 C;  2OO4 A;  5BUS A;  1ML8 A;  2WP0 C;  4JI2 C;  1N32 C;  2VSQ A;  1XMO C;  3PBK A;  4JI3 C;  4YY3 C;  4IR7 A;  1I94 C;  4DR6 C;  3RG2 A;  1FJG C;  2D1T A;  4GKJ C;  2PN2 A;  2PT7 G;  2JMP A;  5A2Q D;  3TDE A;  1N2F A;  1KKG A;  3N2Q A;  1XRC A;  1ULT A;  4FTF A;  2D7V A;  4G37 A;  3TQI A;  4TPS B;  2ATW A;  2ASB A;  1USP B;  4KTT A;  2BJO A;  2QVX X;  2UUA C;  1HH2 P;  1LQL A;  3J7A D;  1BA3 A;  1T5D X;  4MTN A;  3NYQ A;  1HNW C;  1O9T A;  1EGA A;  4PRO C;  3TUF A;  1MKY A;  4R1L A;  4NDN A;  2WD9 A;  1N33 C;  1V25 A;  2QW0 X;  3A9V A;  3H2T A;  3FCE A;  4DCV A;  1HNZ C;  4D57 A;  5KYV A;  4RLQ A;  5GTD A;  3LNV A;  2CXC A;  2UU9 C;  4FUQ A;  4DV6 C;  4R1M A;  4WS9 A;  2E8C A;  5KYT A;  1K0R A;  3GR1 A;  2D1Q A;  4ZJZ A;  2BH1 X;  4LF7 C;  1O92 A;  5BUR A;  1LCI A;  4KTV A;  4K0K C;  4GKK C;  1FUG A;  3N54 B;  2EGT A;  3T1Y C;  1MXB A;  4RLF A;  4X66 C;  4NOZ A;  4FUT A;  1ZB9 A;  3DAY A;  4WV3 A;  2P20 A;  2P2M A;  2KZF A;  1HR0 C;  4JI7 C;  3OTO C;  4LF8 C;  2OPL B;  3GKU A;  3GR0 A;  4DG9 A;  3FCC A;  4G36 A;  3CW9 A;  4PHT A;  3EER A;  2Y4O A;  4MH4 A;  5A19 A;  1N36 C;  3R9W A;  4RMN A;  4B3T C;  3J81 D;  4JYA C;  5LMU C;  3PRO C;  2HJG A;  4NXM C;  5BSM A;  2D28 C;  3ETO A;  4L4Q A;  2DPL A;  3J80 D;  1VLA A;  3JAM D;  3UOW A;  4PZP A;  1HNX C;  2UXD C;  1JOS A;  1QM4 A;  4AQY C;  4BC9 A;  5K85 A;  1T5H X;  4EAT A;  2ONF A;  3G7S A;  1PG3 A;  3LUS A;  4OXI A;  4D56 A;  5BSV A;  1IBM C;  1J5E C;  4GXQ A;  4X62 C;  4DCT A;  2YWC A;  2E5L C;  1GPM A;  2YWB A;  1MDB A;  3VNS A;  5IFI A;  1YJ7 A;  5LMN C;  3CW8 X;  1MD9 A;  2PRO A;  4B3M C;  2XR1 A;  3DHV A;  4GS5 A;  1IBL C;  2D1R A;  3I07 A;  1P7L A;  4DV1 C;  3DLP X;  1AMU A;  1RY2 A;  3NYR A;  2UUC C;  2VQF C;  4DV2 C;  1XMQ C;  1XNQ C;  2OBV A;  3UZ0 A;  5BR8 C;  2E0G A;  4IZ6 A;  2P2F A;  3L95 X;  3IML A;  4LF4 C;  2V7B A;  1XNR C;  4DV0 C;  2ZM6 C;  2P02 A;  4RM3 A;  1PG4 A;  3AF6 A;  4RM2 A;  1MXA A;  3NI2 A;  5CZV A;  5ADZ A;  3GPC A;  1UKK A;  5BSR A;  4L2Z A;  3R9X A;  4LE5 A;  4DR1 C;  3A4I A;  4HPV A;  4DV5 C;  2D1S A;  4U5Y D;  4DR5 C;  4B3S C;  3ETC A;  5KEI A;  3E7W A;  4OX9 C;  2AYA A;  2F4V C;  4YHH C;  5E7Q A;  2P2J A;  4G1I A;  3B7W A;  5JRH A;  5T8S A;  2DYJ A;  4KHP C;  2E8F A;  4DR4 C;  5H9U A;  2E8E A;  4D4G A;  3S82 A;  1WH9 A;  4GXR A;  5CZX A;  4LF5 C;  1PA4 A;  3NPD A;  2Y27 A;  2P2Q A;  2QL8 A;  3IEV A;  3IEU A;  3VNR A;  4JI0 C;  5AE3 A;  4JI6 C;  4LFC C;  4LF6 C;  4I9G A;  4I9F A;  2OPL A;  1L2F A;  5T8T A;  4OYC A;  4JM1 A;  4ODJ A;  3IPL A;  4BBY A;  2E7G A;  3E7X A;  4DUY C;  4X65 C;  4DR3 C;  3KXW A;  2VQE C;  2P2B A;  4LFA C;  4DCS A;  4XX2 A;  5FLX D;  2CY1 A;  5BUQ A;  4DG8 A;  3L8C A;  4K0B A;  3VNQ A;  1O90 A;  4ISB A;  4DV7 C;  3SO4 A;  3LGX A;  2YCB A;  1XRA A;  4DCU A;  4DR7 C;  2QVY X;  2UUB C;  3LAX A;  2HHH C;  3R44 A;  4JI1 C;  2UXB C;  1WF3 A;  1QWI A;  4NXN C;  1RG9 A;  2Y4N A;  4JI4 C;  1USP A;  5AE1 A;  2QVZ X;  5K8F A;  4ZLP A;  1ZB8 A;  5AE2 A;  4JV5 C;  1V26 A;  1MXC A;  3CJE A;  4JI8 C;  2D27 A;  4BCA A;  4RVN A;  5BSU A;  2VZE A;  5A1G A;  4LFB C;  4RVO A;  4DR2 C;  1XRB A;  5A1I A;  4DV4 C;  3AF5 A;  3C5E A;  3EQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...