4X66C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4x66C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4x66C02
1N32C 4X65C 2VQFC 2UXCC 1K0RA 1HNWC 4B3MC 2XR1A 4NXMC 3IEVA 3CJEA 1USPA 4DUYC 4DCUA 2YCBA 4GKKC 4JI3C 2PT7G 4YHHC 1HNXC 2E7GA 2HHHC 1HH2P 1IBKC 1JOSA 3R9WA 4LF4C 3IEUA 2UUAC 3J7AD 4MH4A 4DV1C 4JYAC 3LUSA 2EGTA 1XMOC 4DV7C 3EERA 4JI4C 1XNQC 5LMUC 4MTNA 4YY3C 4LF9C 4AQYC 4KHPC 1N36C 4DV6C 1ZB8A 3J80D 3T1YC 1MKYA 5A2QD 1I94C 1WF3A 2BJOA 4NXNC 1WH9A 2KZFA 2JMPA 4DR7C 2OPLB 2VQEC 1UKKA 4X62C 2E5LC 3R9XA 1XMQC 1NYEA 4B3TC 4DV3C 2UXDC 2ZM6C 2ASBA 2UUCC 4LFCC 4B3RC 5IT9D 4JI1C 2ATWA 2HJGA 4JI7C 3I07A 3OTOC 1ZB9A 2OPLA 3GKUA 1ML8A 4DR2C 1VLAA 4LF8C 4K0KC 4LFAC 5LMNC 1HR0C 4JV5C 2PN2A 4DCSA 2QL8A 4DUZC 3J81D 3AF6A 4JI5C 4LF7C 4XX2A 2UUBC 1KKGA 1N33C 4OX9C 2ONFA 4BSZA 1QWIA 2E8EA 4JI8C 1USPB 2F4VC 2CXCA 2UU9C 2DYJA 3JAMD 1IBLC 4B3SC 4JI2C 2E8CA 4JI0C 1N34C 1J5EC 4NOZA 5FLXD 1EGAA 3T1HC 2CY1A 4LF6C 1PA4A 5BR8C 1N2FA 1LQLA 4DV4C 4DR3C 4DR5C 4JI6C 3AF5A 4DCTA 1FJGC 4LF5C 1XNRC 4LFBC 2UXBC 4DR6C 4GKJC 2D7VA 5IWAC 4X66C 4DV2C 4X64C 2E8FA 1L2FA 1HNZC 4DR1C 4DR4C 4DV0C 4DCVA 1IBMC 4DV5C
chains in the Genus database with same CATH superfamily
1N32C 1TH5A 1K0RA 1HNWC 1USPA 2YCBA 4JI3C 4RM3A 2MMAB 4PUHA 5AE1A 1IBKC 4IZ6A 3A4IA 2D27A 3N54B 1M6XA 3LUSA 2EGTA 1XMOC 3E7XA 3EERA 4JI4C 2WD9A 4NDNA 2PG1E 4LF9C 2YX1A 3DHVA 4AQYC 3GR0A 4DV6C 1XRAA 1MKYA 1WF3A 3LAXA 5CZVA 4RVOA 5A1IA 2JMPA 4DG8A 3C5EA 1VEHA 1NYEA 4TPSB 3LNVA 1XHJA 4B3RC 4D4IA 3OTOC 3A25A 4ODJA 1VLAA 4LFAC 3EQ6A 1HR0C 2M5OA 4JI5C 2P2BA 4LF7C 3DLPX 1V60A 2P20A 3UZ0A 2D1TA 2CXCA 5BSTA 1IBLC 1IB8A 1N34C 3NPDA 5FLXD 5JRHA 2CY1A 4JI6C 4DV4C 4DR3C 2BH1X 3AF5A 4L7IA 4HPVA 4GKJC 2D7VA 4D4GA 1PU1A 4BBYA 4X64C 3ETOA 1L2FA 4DR1C 1V26A 4PROC 2M5HA 1AMUA 3NYRA 5AE3A 2UXCC 3H2TA 1ULTA 4B3MC 3IEVA 4FUTA 3CJEA 4DUYC 4DCUA 1UWDA 2PT7G 1HNXC 4KTTA 2HHHC 5T8TA 4JM1A 1MXCA 3RV2A 2QVZX 3R9WA 2DPLA 4GXQA 3AY0A 5BUQA 4JYAC 5BSWA 4DG9A 3E7WA 1P7LA 5CZXA 4ZLPA 1P4EA 1V25A 5ADZA 5DV9A 4MTNA 4YY3C 3RG2A 5BSUA 5K85A 3CW9A 5A2QD 1O93A 2MM9A 2VQEC 1UKKA 5BUSA 3CQ1A 2E5LC 1NY8A 3R9XA 1XMQC 2E0GA 4BCAA 1PG4A 2D28C 4DV3C 2UXDC 1T5HX 4K0BA 2ZM6C 4LFCC 4JI1C 2HJGA 4JI7C 3I07A 3UEBA 5H9UA 4G37A 1T5DX 3GKUA 2Y4OA 4D57A 5KYTA 4JV5C 5A19A 4DCSA 1MDFA 3J81D 4DUZC 4XX2A 2OBVA 1KKGA 4D56A 5BSRA 5GTDA 3LNOA 2E8CA 1XRCA 1BA3A 3S82A 4R1LA 3G7SA 4WS9A 2JNVA 2Z51A 5IFIA 4LFBC 2NCLA 2UXBC 4DR6C 3PROC 4EATA 1GPMA 4PHTA 4RMNA 3TR3A 2WP0C 4DV0C 5BURA 1IBMC 4X65C 3FCCA 4NXMC 3CQ2A 4RM2A 2YWBA 4GKKC 1P4EC 4YHHC 1MXAA 5AE2A 1HH2P 3ETCA 4OXIA 4PZPA 3NYQA 4LF4C 2MCQA 3J7AD 4MH4A 3LGXA 2QVYX 2P02A 3NI2A 4LE5A 3IMLA 2DHMA 1YGTA 4DV7C 3TUFA 3PESA 1O9TA 4U5YD 1XDXA 3FCEA 2KDNA 1N36C 1ZB8A 5KEIA 3J80D 1WCJA 2YWCA 1I94C 4BC9A 3A26A 2BJOA 4NXNC 2ZZMA 1WH9A 2KZFA 3N2QA 1XRBA 2OPLB 4X62C 4WV3A 4B3TC 2UUCC 4BC7A 2D1RA 2ATWA 3O2EA 1ZB9A 3IPLA 3UOWA 2P2QA 4FUQA 1ML8A 3CQ3A 2P2FA 3VNRA 2PN2A 2QL8A 2D1QA 2UUBC 3VNQA 5K8FA 4OX9C 4BSZA 2E8EA 4JI8C 4FTFA 1USPB 2DYJA 3JAMD 4B3SC 4RLFA 4L4QA 4JI0C 1J5EC 4GS5A 1FLOA 4NOZA 1EGAA 3K6RA 4LF6C 3DAYA 1PA4A 1N2FA 1LQLA 4DCTA 1FJGC 3SO4A 4LF5C 1XNRC 2VSQA 4X66C 2E8FA 3FM7A 1XS3A 2Y27A 2V7BA 3PBKA 4DV5C 2Y4NA 1LCIA 1RG9A 4G36A 2VQFC 3GPCA 3TQIA 2XR1A 1O92A 3I08A 2E7GA 2PROA 1FUGA 3B7WA 1JOSA 3IEUA 4G1IA 2UUAC 2CU6A 3TDEA 4DV1C 5A1GA 4ISBA 1YJ7A 3KXWA 1QM4A 2VZEA 2OO4A 4I9GA 1XNQC 2AYAA 4ZJZA 3CW8X 3VNSA 5LMUC 4L2ZA 3UX2A 5BSVA 4KHPC 2KZ0A 4GXRA 3T1YC 2QW0X 1M6XC 1RY2A 5T8SA 3UX3A 4DR7C 3GR1A 3L95X 2D1SA 4IR7A 2ASBA 5IT9D 4PUGA 5E7QA 2ZZNA 1MD9A 5BSMA 2OPLA 2P2JA 4DR2C 2QVXX 4LF8C 2P2MA 1MXBA 1PG3A 4K0KC 4R0MA 5LMNC 4I9FA 4RLQA 3AF6A 4RVNA 5LCIA 3A9VA 1N33C 2ONFA 1QWIA 3A9UA 4KTVA 4OYCA 4R1MA 1O90A 2F4VC 2UU9C 4JI2C 3L8CA 3T1HC 2ZTBA 5BR8C 4DR5C 3R44A 5IWAC 4DV2C 1HNZC 4PUIA 4DR4C 1MDBA 4DCVA 5KYVA
chains in the Genus database with same CATH topology
1N32C 1K0RA 1HNWC 1USPA 2YCBA 4JI3C 4RM3A 5AE1A 1IBKC 4IZ6A 3A4IA 2D27A 3N54B 3LUSA 2EGTA 1XMOC 3E7XA 3EERA 4JI4C 2WD9A 4NDNA 4LF9C 3DHVA 4AQYC 3GR0A 4DV6C 1XRAA 1MKYA 1WF3A 3LAXA 5CZVA 4RVOA 5A1IA 2JMPA 4DG8A 3C5EA 1NYEA 4TPSB 3LNVA 4B3RC 4D4IA 3OTOC 4ODJA 1VLAA 4LFAC 3EQ6A 1HR0C 4LF7C 4JI5C 2P2BA 3DLPX 2P20A 3UZ0A 2D1TA 2CXCA 5BSTA 1IBLC 1N34C 3NPDA 5FLXD 5JRHA 2CY1A 4JI6C 4DV4C 4DR3C 2BH1X 3AF5A 4L7IA 4HPVA 4GKJC 2D7VA 4D4GA 4BBYA 4X64C 3ETOA 1L2FA 4DR1C 1V26A 4PROC 1AMUA 3NYRA 5AE3A 2UXCC 3H2TA 1ULTA 4B3MC 3IEVA 4FUTA 3CJEA 4DUYC 4DCUA 2PT7G 1HNXC 4KTTA 2HHHC 5T8TA 4JM1A 1MXCA 3RV2A 2QVZX 3R9WA 2DPLA 4GXQA 5BUQA 4JYAC 5BSWA 4DG9A 3E7WA 1P7LA 5CZXA 4ZLPA 1V25A 5ADZA 5DV9A 4MTNA 4YY3C 3RG2A 5BSUA 5K85A 3CW9A 5A2QD 1O93A 2VQEC 1UKKA 5BUSA 2E5LC 3R9XA 1XMQC 2E0GA 4BCAA 1PG4A 2D28C 4DV3C 2UXDC 1T5HX 4K0BA 2ZM6C 4LFCC 4JI1C 2HJGA 4JI7C 3I07A 5H9UA 4G37A 1T5DX 3GKUA 2Y4OA 4D57A 5KYTA 4JV5C 5A19A 4DCSA 1MDFA 3J81D 4DUZC 4XX2A 2OBVA 1KKGA 5BSRA 4D56A 5GTDA 2E8CA 1XRCA 1BA3A 3S82A 4R1LA 3G7SA 4WS9A 5IFIA 4LFBC 2UXBC 4DR6C 3PROC 4EATA 1GPMA 4PHTA 4RMNA 2WP0C 4DV0C 5BURA 1IBMC 4X65C 3FCCA 4NXMC 4RM2A 2YWBA 4GKKC 4YHHC 1MXAA 5AE2A 1HH2P 3ETCA 4OXIA 4PZPA 3NYQA 4LF4C 3J7AD 4MH4A 3LGXA 2QVYX 2P02A 3NI2A 4LE5A 3IMLA 4DV7C 3TUFA 3PESA 1O9TA 4U5YD 3FCEA 1N36C 1ZB8A 5KEIA 3J80D 2YWCA 1I94C 4BC9A 2BJOA 4NXNC 1WH9A 2KZFA 3N2QA 1XRBA 2OPLB 4X62C 4WV3A 4B3TC 2UUCC 4BC7A 2D1RA 2ATWA 1ZB9A 3IPLA 3UOWA 2P2QA 4FUQA 1ML8A 2P2FA 3VNRA 2PN2A 2QL8A 2D1QA 2UUBC 3VNQA 5K8FA 4OX9C 4BSZA 2E8EA 4JI8C 4FTFA 1USPB 2DYJA 3JAMD 4B3SC 4RLFA 4L4QA 4JI0C 1J5EC 4GS5A 4NOZA 1EGAA 4LF6C 3DAYA 1PA4A 1N2FA 1LQLA 4DCTA 1FJGC 3SO4A 4LF5C 1XNRC 2VSQA 4X66C 2E8FA 2Y27A 2V7BA 3PBKA 4DV5C 2Y4NA 1LCIA 1RG9A 4G36A 2VQFC 3GPCA 3TQIA 2XR1A 1O92A 3I08A 2E7GA 2PROA 1FUGA 3B7WA 1JOSA 3IEUA 4G1IA 2UUAC 3TDEA 4DV1C 5A1GA 4ISBA 1YJ7A 3KXWA 1QM4A 2VZEA 2OO4A 4I9GA 1XNQC 2AYAA 4ZJZA 3CW8X 3VNSA 5LMUC 4L2ZA 5BSVA 4KHPC 4GXRA 3T1YC 2QW0X 1RY2A 5T8SA 4DR7C 3GR1A 3L95X 2D1SA 4IR7A 2ASBA 5IT9D 5E7QA 1MD9A 5BSMA 2OPLA 2P2JA 4DR2C 2QVXX 4LF8C 2P2MA 1MXBA 1PG3A 4K0KC 4R0MA 5LMNC 4I9FA 4RLQA 3AF6A 4RVNA 3A9VA 1N33C 2ONFA 1QWIA 3A9UA 4KTVA 4OYCA 4R1MA 1O90A 2F4VC 2UU9C 4JI2C 3L8CA 3T1HC 5BR8C 4DR5C 3R44A 5IWAC 4DV2C 1HNZC 4DR4C 1MDBA 4DCVA 5KYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 C;  4X65 C;  2VQF C;  2UXC C;  1K0R A;  1HNW C;  4B3M C;  2XR1 A;  4NXM C;  3IEV A;  3CJE A;  1USP A;  4DUY C;  4DCU A;  2YCB A;  4GKK C;  4JI3 C;  2PT7 G;  4YHH C;  1HNX C;  2E7G A;  2HHH C;  1HH2 P;  1IBK C;  1JOS A;  3R9W A;  4LF4 C;  3IEU A;  2UUA C;  3J7A D;  4MH4 A;  4DV1 C;  4JYA C;  3LUS A;  2EGT A;  1XMO C;  4DV7 C;  3EER A;  4JI4 C;  1XNQ C;  5LMU C;  4MTN A;  4YY3 C;  4LF9 C;  4AQY C;  4KHP C;  1N36 C;  4DV6 C;  1ZB8 A;  3J80 D;  3T1Y C;  1MKY A;  5A2Q D;  1I94 C;  1WF3 A;  2BJO A;  4NXN C;  1WH9 A;  2KZF A;  2JMP A;  4DR7 C;  2OPL B;  2VQE C;  1UKK A;  4X62 C;  2E5L C;  3R9X A;  1XMQ C;  1NYE A;  4B3T C;  4DV3 C;  2UXD C;  2ZM6 C;  2ASB A;  2UUC C;  4LFC C;  4B3R C;  5IT9 D;  4JI1 C;  2ATW A;  2HJG A;  4JI7 C;  3I07 A;  3OTO C;  1ZB9 A;  2OPL A;  3GKU A;  1ML8 A;  4DR2 C;  1VLA A;  4LF8 C;  4K0K C;  4LFA C;  5LMN C;  1HR0 C;  4JV5 C;  2PN2 A;  4DCS A;  2QL8 A;  4DUZ C;  3J81 D;  3AF6 A;  4JI5 C;  4LF7 C;  4XX2 A;  2UUB C;  1KKG A;  1N33 C;  4OX9 C;  2ONF A;  4BSZ A;  1QWI A;  2E8E A;  4JI8 C;  1USP B;  2F4V C;  2CXC A;  2UU9 C;  2DYJ A;  3JAM D;  1IBL C;  4B3S C;  4JI2 C;  2E8C A;  4JI0 C;  1N34 C;  1J5E C;  4NOZ A;  5FLX D;  1EGA A;  3T1H C;  2CY1 A;  4LF6 C;  1PA4 A;  5BR8 C;  1N2F A;  1LQL A;  4DV4 C;  4DR3 C;  4DR5 C;  4JI6 C;  3AF5 A;  4DCT A;  1FJG C;  4LF5 C;  1XNR C;  4LFB C;  2UXB C;  4DR6 C;  4GKJ C;  2D7V A;  5IWA C;  4X66 C;  4DV2 C;  4X64 C;  2E8F A;  1L2F A;  1HNZ C;  4DR1 C;  4DR4 C;  4DV0 C;  4DCV A;  1IBM C;  4DV5 C; 
#chains in the Genus database with same CATH topology
 1N32 C;  1TH5 A;  1K0R A;  1HNW C;  1USP A;  2YCB A;  4JI3 C;  4RM3 A;  2MMA B;  4PUH A;  5AE1 A;  1IBK C;  4IZ6 A;  3A4I A;  2D27 A;  3N54 B;  1M6X A;  3LUS A;  2EGT A;  1XMO C;  3E7X A;  3EER A;  4JI4 C;  2WD9 A;  4NDN A;  2PG1 E;  4LF9 C;  2YX1 A;  3DHV A;  4AQY C;  3GR0 A;  4DV6 C;  1XRA A;  1MKY A;  1WF3 A;  3LAX A;  5CZV A;  4RVO A;  5A1I A;  2JMP A;  4DG8 A;  3C5E A;  1VEH A;  1NYE A;  4TPS B;  3LNV A;  1XHJ A;  4B3R C;  4D4I A;  3OTO C;  3A25 A;  4ODJ A;  1VLA A;  4LFA C;  3EQ6 A;  1HR0 C;  2M5O A;  4JI5 C;  2P2B A;  4LF7 C;  3DLP X;  1V60 A;  2P20 A;  3UZ0 A;  2D1T A;  2CXC A;  5BST A;  1IBL C;  1IB8 A;  1N34 C;  3NPD A;  5FLX D;  5JRH A;  2CY1 A;  4JI6 C;  4DV4 C;  4DR3 C;  2BH1 X;  3AF5 A;  4L7I A;  4HPV A;  4GKJ C;  2D7V A;  4D4G A;  1PU1 A;  4BBY A;  4X64 C;  3ETO A;  1L2F A;  4DR1 C;  1V26 A;  4PRO C;  2M5H A;  1AMU A;  3NYR A;  5AE3 A;  2UXC C;  3H2T A;  1ULT A;  4B3M C;  3IEV A;  4FUT A;  3CJE A;  4DUY C;  4DCU A;  1UWD A;  2PT7 G;  1HNX C;  4KTT A;  2HHH C;  5T8T A;  4JM1 A;  1MXC A;  3RV2 A;  2QVZ X;  3R9W A;  2DPL A;  4GXQ A;  3AY0 A;  5BUQ A;  4JYA C;  5BSW A;  4DG9 A;  3E7W A;  1P7L A;  5CZX A;  4ZLP A;  1P4E A;  1V25 A;  5ADZ A;  5DV9 A;  4MTN A;  4YY3 C;  3RG2 A;  5BSU A;  5K85 A;  3CW9 A;  5A2Q D;  1O93 A;  2MM9 A;  2VQE C;  1UKK A;  5BUS A;  3CQ1 A;  2E5L C;  1NY8 A;  3R9X A;  1XMQ C;  2E0G A;  4BCA A;  1PG4 A;  2D28 C;  4DV3 C;  2UXD C;  1T5H X;  4K0B A;  2ZM6 C;  4LFC C;  4JI1 C;  2HJG A;  4JI7 C;  3I07 A;  3UEB A;  5H9U A;  4G37 A;  1T5D X;  3GKU A;  2Y4O A;  4D57 A;  5KYT A;  4JV5 C;  5A19 A;  4DCS A;  1MDF A;  3J81 D;  4DUZ C;  4XX2 A;  2OBV A;  1KKG A;  4D56 A;  5BSR A;  5GTD A;  3LNO A;  2E8C A;  1XRC A;  1BA3 A;  3S82 A;  4R1L A;  3G7S A;  4WS9 A;  2JNV A;  2Z51 A;  5IFI A;  4LFB C;  2NCL A;  2UXB C;  4DR6 C;  3PRO C;  4EAT A;  1GPM A;  4PHT A;  4RMN A;  3TR3 A;  2WP0 C;  4DV0 C;  5BUR A;  1IBM C;  4X65 C;  3FCC A;  4NXM C;  3CQ2 A;  4RM2 A;  2YWB A;  4GKK C;  1P4E C;  4YHH C;  1MXA A;  5AE2 A;  1HH2 P;  3ETC A;  4OXI A;  4PZP A;  3NYQ A;  4LF4 C;  2MCQ A;  3J7A D;  4MH4 A;  3LGX A;  2QVY X;  2P02 A;  3NI2 A;  4LE5 A;  3IML A;  2DHM A;  1YGT A;  4DV7 C;  3TUF A;  3PES A;  1O9T A;  4U5Y D;  1XDX A;  3FCE A;  2KDN A;  1N36 C;  1ZB8 A;  5KEI A;  3J80 D;  1WCJ A;  2YWC A;  1I94 C;  4BC9 A;  3A26 A;  2BJO A;  4NXN C;  2ZZM A;  1WH9 A;  2KZF A;  3N2Q A;  1XRB A;  2OPL B;  4X62 C;  4WV3 A;  4B3T C;  2UUC C;  4BC7 A;  2D1R A;  2ATW A;  3O2E A;  1ZB9 A;  3IPL A;  3UOW A;  2P2Q A;  4FUQ A;  1ML8 A;  3CQ3 A;  2P2F A;  3VNR A;  2PN2 A;  2QL8 A;  2D1Q A;  2UUB C;  3VNQ A;  5K8F A;  4OX9 C;  4BSZ A;  2E8E A;  4JI8 C;  4FTF A;  1USP B;  2DYJ A;  3JAM D;  4B3S C;  4RLF A;  4L4Q A;  4JI0 C;  1J5E C;  4GS5 A;  1FLO A;  4NOZ A;  1EGA A;  3K6R A;  4LF6 C;  3DAY A;  1PA4 A;  1N2F A;  1LQL A;  4DCT A;  1FJG C;  3SO4 A;  4LF5 C;  1XNR C;  2VSQ A;  4X66 C;  2E8F A;  3FM7 A;  1XS3 A;  2Y27 A;  2V7B A;  3PBK A;  4DV5 C;  2Y4N A;  1LCI A;  1RG9 A;  4G36 A;  2VQF C;  3GPC A;  3TQI A;  2XR1 A;  1O92 A;  3I08 A;  2E7G A;  2PRO A;  1FUG A;  3B7W A;  1JOS A;  3IEU A;  4G1I A;  2UUA C;  2CU6 A;  3TDE A;  4DV1 C;  5A1G A;  4ISB A;  1YJ7 A;  3KXW A;  1QM4 A;  2VZE A;  2OO4 A;  4I9G A;  1XNQ C;  2AYA A;  4ZJZ A;  3CW8 X;  3VNS A;  5LMU C;  4L2Z A;  3UX2 A;  5BSV A;  4KHP C;  2KZ0 A;  4GXR A;  3T1Y C;  2QW0 X;  1M6X C;  1RY2 A;  5T8S A;  3UX3 A;  4DR7 C;  3GR1 A;  3L95 X;  2D1S A;  4IR7 A;  2ASB A;  5IT9 D;  4PUG A;  5E7Q A;  2ZZN A;  1MD9 A;  5BSM A;  2OPL A;  2P2J A;  4DR2 C;  2QVX X;  4LF8 C;  2P2M A;  1MXB A;  1PG3 A;  4K0K C;  4R0M A;  5LMN C;  4I9F A;  4RLQ A;  3AF6 A;  4RVN A;  5LCI A;  3A9V A;  1N33 C;  2ONF A;  1QWI A;  3A9U A;  4KTV A;  4OYC A;  4R1M A;  1O90 A;  2F4V C;  2UU9 C;  4JI2 C;  3L8C A;  3T1H C;  2ZTB A;  5BR8 C;  4DR5 C;  3R44 A;  5IWA C;  4DV2 C;  1HNZ C;  4PUI A;  4DR4 C;  1MDB A;  4DCV A;  5KYV A; 
#chains in the Genus database with same CATH homology
 1N32 C;  1K0R A;  1HNW C;  1USP A;  2YCB A;  4JI3 C;  4RM3 A;  5AE1 A;  1IBK C;  4IZ6 A;  3A4I A;  2D27 A;  3N54 B;  3LUS A;  2EGT A;  1XMO C;  3E7X A;  3EER A;  4JI4 C;  2WD9 A;  4NDN A;  4LF9 C;  3DHV A;  4AQY C;  3GR0 A;  4DV6 C;  1XRA A;  1MKY A;  1WF3 A;  3LAX A;  5CZV A;  4RVO A;  5A1I A;  2JMP A;  4DG8 A;  3C5E A;  1NYE A;  4TPS B;  3LNV A;  4B3R C;  4D4I A;  3OTO C;  4ODJ A;  1VLA A;  4LFA C;  3EQ6 A;  1HR0 C;  4LF7 C;  4JI5 C;  2P2B A;  3DLP X;  2P20 A;  3UZ0 A;  2D1T A;  2CXC A;  5BST A;  1IBL C;  1N34 C;  3NPD A;  5FLX D;  5JRH A;  2CY1 A;  4JI6 C;  4DV4 C;  4DR3 C;  2BH1 X;  3AF5 A;  4L7I A;  4HPV A;  4GKJ C;  2D7V A;  4D4G A;  4BBY A;  4X64 C;  3ETO A;  1L2F A;  4DR1 C;  1V26 A;  4PRO C;  1AMU A;  3NYR A;  5AE3 A;  2UXC C;  3H2T A;  1ULT A;  4B3M C;  3IEV A;  4FUT A;  3CJE A;  4DUY C;  4DCU A;  2PT7 G;  1HNX C;  4KTT A;  2HHH C;  5T8T A;  4JM1 A;  1MXC A;  3RV2 A;  2QVZ X;  3R9W A;  2DPL A;  4GXQ A;  5BUQ A;  4JYA C;  5BSW A;  4DG9 A;  3E7W A;  1P7L A;  5CZX A;  4ZLP A;  1V25 A;  5ADZ A;  5DV9 A;  4MTN A;  4YY3 C;  3RG2 A;  5BSU A;  5K85 A;  3CW9 A;  5A2Q D;  1O93 A;  2VQE C;  1UKK A;  5BUS A;  2E5L C;  3R9X A;  1XMQ C;  2E0G A;  4BCA A;  1PG4 A;  2D28 C;  4DV3 C;  2UXD C;  1T5H X;  4K0B A;  2ZM6 C;  4LFC C;  4JI1 C;  2HJG A;  4JI7 C;  3I07 A;  5H9U A;  4G37 A;  1T5D X;  3GKU A;  2Y4O A;  4D57 A;  5KYT A;  4JV5 C;  5A19 A;  4DCS A;  1MDF A;  3J81 D;  4DUZ C;  4XX2 A;  2OBV A;  1KKG A;  5BSR A;  4D56 A;  5GTD A;  2E8C A;  1XRC A;  1BA3 A;  3S82 A;  4R1L A;  3G7S A;  4WS9 A;  5IFI A;  4LFB C;  2UXB C;  4DR6 C;  3PRO C;  4EAT A;  1GPM A;  4PHT A;  4RMN A;  2WP0 C;  4DV0 C;  5BUR A;  1IBM C;  4X65 C;  3FCC A;  4NXM C;  4RM2 A;  2YWB A;  4GKK C;  4YHH C;  1MXA A;  5AE2 A;  1HH2 P;  3ETC A;  4OXI A;  4PZP A;  3NYQ A;  4LF4 C;  3J7A D;  4MH4 A;  3LGX A;  2QVY X;  2P02 A;  3NI2 A;  4LE5 A;  3IML A;  4DV7 C;  3TUF A;  3PES A;  1O9T A;  4U5Y D;  3FCE A;  1N36 C;  1ZB8 A;  5KEI A;  3J80 D;  2YWC A;  1I94 C;  4BC9 A;  2BJO A;  4NXN C;  1WH9 A;  2KZF A;  3N2Q A;  1XRB A;  2OPL B;  4X62 C;  4WV3 A;  4B3T C;  2UUC C;  4BC7 A;  2D1R A;  2ATW A;  1ZB9 A;  3IPL A;  3UOW A;  2P2Q A;  4FUQ A;  1ML8 A;  2P2F A;  3VNR A;  2PN2 A;  2QL8 A;  2D1Q A;  2UUB C;  3VNQ A;  5K8F A;  4OX9 C;  4BSZ A;  2E8E A;  4JI8 C;  4FTF A;  1USP B;  2DYJ A;  3JAM D;  4B3S C;  4RLF A;  4L4Q A;  4JI0 C;  1J5E C;  4GS5 A;  4NOZ A;  1EGA A;  4LF6 C;  3DAY A;  1PA4 A;  1N2F A;  1LQL A;  4DCT A;  1FJG C;  3SO4 A;  4LF5 C;  1XNR C;  2VSQ A;  4X66 C;  2E8F A;  2Y27 A;  2V7B A;  3PBK A;  4DV5 C;  2Y4N A;  1LCI A;  1RG9 A;  4G36 A;  2VQF C;  3GPC A;  3TQI A;  2XR1 A;  1O92 A;  3I08 A;  2E7G A;  2PRO A;  1FUG A;  3B7W A;  1JOS A;  3IEU A;  4G1I A;  2UUA C;  3TDE A;  4DV1 C;  5A1G A;  4ISB A;  1YJ7 A;  3KXW A;  1QM4 A;  2VZE A;  2OO4 A;  4I9G A;  1XNQ C;  2AYA A;  4ZJZ A;  3CW8 X;  3VNS A;  5LMU C;  4L2Z A;  5BSV A;  4KHP C;  4GXR A;  3T1Y C;  2QW0 X;  1RY2 A;  5T8S A;  4DR7 C;  3GR1 A;  3L95 X;  2D1S A;  4IR7 A;  2ASB A;  5IT9 D;  5E7Q A;  1MD9 A;  5BSM A;  2OPL A;  2P2J A;  4DR2 C;  2QVX X;  4LF8 C;  2P2M A;  1MXB A;  1PG3 A;  4K0K C;  4R0M A;  5LMN C;  4I9F A;  4RLQ A;  3AF6 A;  4RVN A;  3A9V A;  1N33 C;  2ONF A;  1QWI A;  3A9U A;  4KTV A;  4OYC A;  4R1M A;  1O90 A;  2F4V C;  2UU9 C;  4JI2 C;  3L8C A;  3T1H C;  5BR8 C;  4DR5 C;  3R44 A;  5IWA C;  4DV2 C;  1HNZ C;  4DR4 C;  1MDB A;  4DCV A;  5KYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...