1YGTA

Dynein light chain tctex-1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
SQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of dynein light chain TcTex-1.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein transport
molecule keywords Cytoplasmic dynein light chain
total genus 25
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2005-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03645 Tctex-1 Tctex-1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1140.40 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3 C-terminal domain 1ygtA01
2PG1E 3FM7A 1YGTA 1XDXA
chains in the Genus database with same CATH superfamily
4DV3C 1YGTA 4YY3C 5BR8C 4JV5C 4DV2C 4OX9C 4LF6C 5IT9D 4LF7C 4B3RC 1FJGC 4DUYC 2UXBC 1HNZC 3J80D 3T1HC 4JI8C 1XNQC 5LMUC 4DR3C 4AQYC 1N32C 1XMOC 1IBLC 4BSZA 2UUCC 1N33C 4LF5C 4X64C 5LMNC 4DR2C 2F4VC 1N36C 4DR1C 1HR0C 4JI7C 4X62C 4GKJC 3OTOC 1XNRC 2ZM6C 1XDXA 4JI0C 2PG1E 4NXMC 3J7AD 4LF8C 4LFBC 5FLXD 5IWAC 5A2QD 4JI3C 4DV5C 1I94C 4DR7C 1HNXC 4K0KC 4JI6C 4DR4C 1HNWC 4LF4C 2UUBC 4JI1C 1J5EC 4X65C 2VQEC 2UUAC 2VQFC 4X66C 1IBMC 2UXDC 4DV6C 4LFAC 1N34C 3J81D 4B3MC 4DR5C 1IBKC 4JYAC 4JI2C 2ZTBA 4NXNC 4JI4C 4B3TC 4LFCC 3JAMD 4YHHC 3T1YC 4GKKC 3FM7A 4DV7C 1XMQC 4LF9C 4DV1C 4B3SC 4DV4C 2UU9C 4DR6C 2E5LC 2UXCC 4JI5C 4KHPC 4DUZC 2HHHC 4DV0C
chains in the Genus database with same CATH topology
1YGTA 2PG1E 2ZTBA 1XDXA 3FM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PG1 E;  3FM7 A;  1YGT A;  1XDX A; 
#chains in the Genus database with same CATH topology
 4DV3 C;  1YGT A;  4YY3 C;  5BR8 C;  4JV5 C;  4DV2 C;  4OX9 C;  4LF6 C;  5IT9 D;  4LF7 C;  4B3R C;  1FJG C;  4DUY C;  2UXB C;  1HNZ C;  3J80 D;  3T1H C;  4JI8 C;  1XNQ C;  5LMU C;  4DR3 C;  4AQY C;  1N32 C;  1XMO C;  1IBL C;  4BSZ A;  2UUC C;  1N33 C;  4LF5 C;  4X64 C;  5LMN C;  4DR2 C;  2F4V C;  1N36 C;  4DR1 C;  1HR0 C;  4JI7 C;  4X62 C;  4GKJ C;  3OTO C;  1XNR C;  2ZM6 C;  1XDX A;  4JI0 C;  2PG1 E;  4NXM C;  3J7A D;  4LF8 C;  4LFB C;  5FLX D;  5IWA C;  5A2Q D;  4JI3 C;  4DV5 C;  1I94 C;  4DR7 C;  1HNX C;  4K0K C;  4JI6 C;  4DR4 C;  1HNW C;  4LF4 C;  2UUB C;  4JI1 C;  1J5E C;  4X65 C;  2VQE C;  2UUA C;  2VQF C;  4X66 C;  1IBM C;  2UXD C;  4DV6 C;  4LFA C;  1N34 C;  3J81 D;  4B3M C;  4DR5 C;  1IBK C;  4JYA C;  4JI2 C;  2ZTB A;  4NXN C;  4JI4 C;  4B3T C;  4LFC C;  3JAM D;  4YHH C;  3T1Y C;  4GKK C;  3FM7 A;  4DV7 C;  1XMQ C;  4LF9 C;  4DV1 C;  4B3S C;  4DV4 C;  2UU9 C;  4DR6 C;  2E5L C;  2UXC C;  4JI5 C;  4KHP C;  4DUZ C;  2HHH C;  4DV0 C; 
#chains in the Genus database with same CATH homology
 1YGT A;  2PG1 E;  2ZTB A;  1XDX A;  3FM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...