1YGTA

Dynein light chain tctex-1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
SQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic dynein light chain
publication title Crystal structure of dynein light chain TcTex-1.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein transport
total genus 25
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2005-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03645 Tctex-1 Tctex-1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1140.40 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3 C-terminal domain 1ygtA01
3FM7A 1XDXA 2PG1E 1YGTA
chains in the Genus database with same CATH superfamily
4GKJC 4B3MC 4JV5C 4LF6C 1XMOC 4DR1C 4B3RC 2HHHC 1HR0C 4JI5C 2VQEC 4LFCC 5LMUC 2UXDC 1XMQC 1N36C 4B3SC 4DV1C 4GKKC 4BSZA 1XNQC 4YHHC 4X65C 4LF9C 3J7AD 1IBLC 4JI1C 3J81D 1HNXC 4LF4C 4DV6C 4DUZC 3JAMD 4DV5C 1J5EC 4DV4C 4B3TC 4DV3C 2ZM6C 4JI0C 4JI2C 2UUBC 3FM7A 4JI3C 1IBMC 2F4VC 2UUCC 4DR6C 1I94C 3T1YC 2E5LC 4JI7C 1YGTA 4AQYC 5IWAC 4DR5C 2UU9C 4X62C 1XDXA 2PG1E 4KHPC 4LFBC 5A2QD 2UXBC 4K0KC 4X66C 3OTOC 2VQFC 4YY3C 5FLXD 1XNRC 4DR2C 4LFAC 5BR8C 5LMNC 4X64C 4DV7C 2ZTBA 2UXCC 5IT9D 4DR7C 4JI6C 4DR3C 4OX9C 4DR4C 4DUYC 4JYAC 3J80D 1HNZC 4DV0C 3T1HC 1N34C 1N32C 4JI4C 4NXNC 4LF8C 1IBKC 2UUAC 4NXMC 1FJGC 4DV2C 1N33C 4LF5C 4JI8C 1HNWC 4LF7C
chains in the Genus database with same CATH topology
2PG1E 1YGTA 2ZTBA 3FM7A 1XDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FM7 A;  1XDX A;  2PG1 E;  1YGT A; 
#chains in the Genus database with same CATH topology
 4GKJ C;  4B3M C;  4JV5 C;  4LF6 C;  1XMO C;  4DR1 C;  4B3R C;  2HHH C;  1HR0 C;  4JI5 C;  2VQE C;  4LFC C;  5LMU C;  2UXD C;  1XMQ C;  1N36 C;  4B3S C;  4DV1 C;  4GKK C;  4BSZ A;  1XNQ C;  4YHH C;  4X65 C;  4LF9 C;  3J7A D;  1IBL C;  4JI1 C;  3J81 D;  1HNX C;  4LF4 C;  4DV6 C;  4DUZ C;  3JAM D;  4DV5 C;  1J5E C;  4DV4 C;  4B3T C;  4DV3 C;  2ZM6 C;  4JI0 C;  4JI2 C;  2UUB C;  3FM7 A;  4JI3 C;  1IBM C;  2F4V C;  2UUC C;  4DR6 C;  1I94 C;  3T1Y C;  2E5L C;  4JI7 C;  1YGT A;  4AQY C;  5IWA C;  4DR5 C;  2UU9 C;  4X62 C;  1XDX A;  2PG1 E;  4KHP C;  4LFB C;  5A2Q D;  2UXB C;  4K0K C;  4X66 C;  3OTO C;  2VQF C;  4YY3 C;  5FLX D;  1XNR C;  4DR2 C;  4LFA C;  5BR8 C;  5LMN C;  4X64 C;  4DV7 C;  2ZTB A;  2UXC C;  5IT9 D;  4DR7 C;  4JI6 C;  4DR3 C;  4OX9 C;  4DR4 C;  4DUY C;  4JYA C;  3J80 D;  1HNZ C;  4DV0 C;  3T1H C;  1N34 C;  1N32 C;  4JI4 C;  4NXN C;  4LF8 C;  1IBK C;  2UUA C;  4NXM C;  1FJG C;  4DV2 C;  1N33 C;  4LF5 C;  4JI8 C;  1HNW C;  4LF7 C; 
#chains in the Genus database with same CATH homology
 2PG1 E;  1YGT A;  2ZTB A;  3FM7 A;  1XDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...