1YGTA

Dynein light chain tctex-1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
SQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Cytoplasmic dynein light chain
publication title Crystal structure of dynein light chain TcTex-1.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 25
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2005-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03645 Tctex-1 Tctex-1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1140.40 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3 C-terminal domain 1ygtA01
1XDXA 3FM7A 1YGTA 2PG1E
chains in the Genus database with same CATH superfamily
1XNRC 4LF9C 4LF5C 2ZM6C 4JI0C 4YY3C 4KHPC 4DUYC 4B3SC 4AQYC 4DV3C 2F4VC 4B3TC 4JYAC 5A2QD 4JI7C 4DR6C 4B3RC 4DV6C 1I94C 4LFBC 4GKJC 4JI4C 1XDXA 5IWAC 4JI5C 4DV0C 1YGTA 2HHHC 4JI8C 4DR3C 1HNWC 3FM7A 4X62C 4GKKC 1XMQC 4YHHC 4LF4C 1HR0C 2UU9C 2E5LC 1IBKC 1FJGC 4DUZC 1HNXC 4DR7C 1HNZC 4LF7C 1N36C 4JI6C 3J7AD 2UUBC 1J5EC 4LFAC 4DR1C 2UXCC 4DR4C 4JI1C 4NXNC 1IBMC 1N34C 4NXMC 4JI3C 4OX9C 2VQFC 4DV2C 1XNQC 2UUAC 4LFCC 1N32C 1XMOC 5LMNC 2UUCC 4LF8C 4DV5C 3T1HC 1IBLC 4JV5C 4DV4C 4LF6C 2UXDC 5IT9D 4DV1C 4DV7C 3T1YC 5BR8C 2PG1E 2ZTBA 4X64C 4X65C 4X66C 4DR2C 3J80D 2UXBC 3OTOC 1N33C 4K0KC 3J81D 2VQEC 4B3MC 4BSZA 4DR5C 5FLXD 3JAMD 5LMUC 4JI2C
chains in the Genus database with same CATH topology
3FM7A 2PG1E 2ZTBA 1XDXA 1YGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XDX A;  3FM7 A;  1YGT A;  2PG1 E; 
#chains in the Genus database with same CATH topology
 1XNR C;  4LF9 C;  4LF5 C;  2ZM6 C;  4JI0 C;  4YY3 C;  4KHP C;  4DUY C;  4B3S C;  4AQY C;  4DV3 C;  2F4V C;  4B3T C;  4JYA C;  5A2Q D;  4JI7 C;  4DR6 C;  4B3R C;  4DV6 C;  1I94 C;  4LFB C;  4GKJ C;  4JI4 C;  1XDX A;  5IWA C;  4JI5 C;  4DV0 C;  1YGT A;  2HHH C;  4JI8 C;  4DR3 C;  1HNW C;  3FM7 A;  4X62 C;  4GKK C;  1XMQ C;  4YHH C;  4LF4 C;  1HR0 C;  2UU9 C;  2E5L C;  1IBK C;  1FJG C;  4DUZ C;  1HNX C;  4DR7 C;  1HNZ C;  4LF7 C;  1N36 C;  4JI6 C;  3J7A D;  2UUB C;  1J5E C;  4LFA C;  4DR1 C;  2UXC C;  4DR4 C;  4JI1 C;  4NXN C;  1IBM C;  1N34 C;  4NXM C;  4JI3 C;  4OX9 C;  2VQF C;  4DV2 C;  1XNQ C;  2UUA C;  4LFC C;  1N32 C;  1XMO C;  5LMN C;  2UUC C;  4LF8 C;  4DV5 C;  3T1H C;  1IBL C;  4JV5 C;  4DV4 C;  4LF6 C;  2UXD C;  5IT9 D;  4DV1 C;  4DV7 C;  3T1Y C;  5BR8 C;  2PG1 E;  2ZTB A;  4X64 C;  4X65 C;  4X66 C;  4DR2 C;  3J80 D;  2UXB C;  3OTO C;  1N33 C;  4K0K C;  3J81 D;  2VQE C;  4B3M C;  4BSZ A;  4DR5 C;  5FLX D;  3JAM D;  5LMU C;  4JI2 C; 
#chains in the Genus database with same CATH homology
 3FM7 A;  2PG1 E;  2ZTB A;  1XDX A;  1YGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...