3FM7A

Quaternary structure of drosophila melanogaster ic/tctex-1/lc8; allosteric interactions of dynein light chains with dynein intermediate chain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
QFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynein light chain Tctex-type
publication title Multivalency in the assembly of intrinsically disordered Dynein intermediate chain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Contractile protein
total genus 19
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03645 Tctex-1 Tctex-1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1140.40 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3 C-terminal domain 3fm7A01
2PG1E 1XDXA 1YGTA 3FM7A
chains in the Genus database with same CATH superfamily
2HHHC 4X64C 3OTOC 1XMOC 1J5EC 4DV2C 1HR0C 4LF7C 4LFBC 4LF5C 4NXNC 2E5LC 3JAMD 1XNQC 2UUAC 2PG1E 4DR1C 4DV5C 4B3RC 4NXMC 1YGTA 2UUBC 4DR7C 4JYAC 4DUYC 5A2QD 2ZTBA 1I94C 1N32C 1XDXA 2VQFC 4DR6C 4LF4C 4JV5C 4DR3C 4AQYC 4K0KC 4JI4C 4DV4C 4LF6C 3T1YC 5IT9D 4JI6C 4KHPC 4LFCC 4JI1C 5LMNC 2UXDC 4DV7C 5LMUC 1HNWC 2ZM6C 3T1HC 4DV1C 2VQEC 4DR2C 4LF8C 2F4VC 4DV0C 4JI8C 1HNXC 4X65C 1N34C 2UU9C 4B3MC 5IWAC 2UUCC 2UXCC 4JI3C 1XNRC 4JI0C 4LF9C 4GKJC 4DR4C 1IBKC 3J80D 1XMQC 1HNZC 1N36C 5FLXD 1FJGC 4JI7C 4YHHC 1IBMC 4DV3C 1N33C 4B3TC 4BSZA 4DV6C 5BR8C 3J81D 3FM7A 1IBLC 4YY3C 4DR5C 4JI5C 2UXBC 4GKKC 4X62C 4OX9C 4X66C 4LFAC 4B3SC 4DUZC 3J7AD 4JI2C
chains in the Genus database with same CATH topology
2ZTBA 3FM7A 1XDXA 1YGTA 2PG1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PG1 E;  1XDX A;  1YGT A;  3FM7 A; 
#chains in the Genus database with same CATH topology
 2HHH C;  4X64 C;  3OTO C;  1XMO C;  1J5E C;  4DV2 C;  1HR0 C;  4LF7 C;  4LFB C;  4LF5 C;  4NXN C;  2E5L C;  3JAM D;  1XNQ C;  2UUA C;  2PG1 E;  4DR1 C;  4DV5 C;  4B3R C;  4NXM C;  1YGT A;  2UUB C;  4DR7 C;  4JYA C;  4DUY C;  5A2Q D;  2ZTB A;  1I94 C;  1N32 C;  1XDX A;  2VQF C;  4DR6 C;  4LF4 C;  4JV5 C;  4DR3 C;  4AQY C;  4K0K C;  4JI4 C;  4DV4 C;  4LF6 C;  3T1Y C;  5IT9 D;  4JI6 C;  4KHP C;  4LFC C;  4JI1 C;  5LMN C;  2UXD C;  4DV7 C;  5LMU C;  1HNW C;  2ZM6 C;  3T1H C;  4DV1 C;  2VQE C;  4DR2 C;  4LF8 C;  2F4V C;  4DV0 C;  4JI8 C;  1HNX C;  4X65 C;  1N34 C;  2UU9 C;  4B3M C;  5IWA C;  2UUC C;  2UXC C;  4JI3 C;  1XNR C;  4JI0 C;  4LF9 C;  4GKJ C;  4DR4 C;  1IBK C;  3J80 D;  1XMQ C;  1HNZ C;  1N36 C;  5FLX D;  1FJG C;  4JI7 C;  4YHH C;  1IBM C;  4DV3 C;  1N33 C;  4B3T C;  4BSZ A;  4DV6 C;  5BR8 C;  3J81 D;  3FM7 A;  1IBL C;  4YY3 C;  4DR5 C;  4JI5 C;  2UXB C;  4GKK C;  4X62 C;  4OX9 C;  4X66 C;  4LFA C;  4B3S C;  4DUZ C;  3J7A D;  4JI2 C; 
#chains in the Genus database with same CATH homology
 2ZTB A;  3FM7 A;  1XDX A;  1YGT A;  2PG1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...