3FM7A

Quaternary structure of drosophila melanogaster ic/tctex-1/lc8; allosteric interactions of dynein light chains with dynein intermediate chain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
b'QFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynein light chain Tctex-type
publication title Multivalency in the assembly of intrinsically disordered Dynein intermediate chain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Contractile protein
total genus 19
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03645 Tctex-1 Tctex-1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1140.40 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3 C-terminal domain 3fm7A01
2PG1E 1YGTA 1XDXA 3FM7A
chains in the Genus database with same CATH superfamily
4KHPC 3J80D 5IWAC 4X62C 5BR8C 4LF7C 4X64C 5LMUC 4B3TC 2VQFC 1HR0C 4JI1C 3FM7A 5IT9D 3OTOC 1I94C 4JI6C 4JI7C 4B3RC 2UU9C 4NXNC 3JAMD 1N34C 4B3SC 5A2QD 1XNQC 1IBLC 3J7AD 4JI8C 4JI3C 4DR3C 1XNRC 1N33C 4LF4C 3T1HC 1XDXA 4DUYC 1FJGC 2PG1E 4LF9C 1HNWC 2UXCC 4AQYC 4X65C 1N36C 4DV0C 2VQEC 2UUBC 4DR4C 1YGTA 4DV5C 2F4VC 4OX9C 4YY3C 4DV2C 1HNZC 2E5LC 4NXMC 1HNXC 4DUZC 2UXBC 4DR7C 4DR1C 2UXDC 2UUAC 4BSZA 4JV5C 1IBMC 3J81D 4DV4C 4DV1C 4DR5C 4LFBC 4JI5C 4LF5C 1IBKC 2HHHC 1N32C 2ZM6C 4LF6C 4JI0C 4GKKC 4LFCC 4GKJC 4DV3C 4DR6C 3T1YC 4K0KC 4LF8C 5FLXD 1J5EC 5LMNC 4YHHC 4DV7C 4LFAC 4JI2C 2ZTBA 4B3MC 4JYAC 4DR2C 2UUCC 4DV6C 1XMOC 4JI4C 4X66C 1XMQC
chains in the Genus database with same CATH topology
2PG1E 1YGTA 2ZTBA 3FM7A 1XDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PG1 E;  1YGT A;  1XDX A;  3FM7 A; 
#chains in the Genus database with same CATH topology
 4KHP C;  3J80 D;  5IWA C;  4X62 C;  5BR8 C;  4LF7 C;  4X64 C;  5LMU C;  4B3T C;  2VQF C;  1HR0 C;  4JI1 C;  3FM7 A;  5IT9 D;  3OTO C;  1I94 C;  4JI6 C;  4JI7 C;  4B3R C;  2UU9 C;  4NXN C;  3JAM D;  1N34 C;  4B3S C;  5A2Q D;  1XNQ C;  1IBL C;  3J7A D;  4JI8 C;  4JI3 C;  4DR3 C;  1XNR C;  1N33 C;  4LF4 C;  3T1H C;  1XDX A;  4DUY C;  1FJG C;  2PG1 E;  4LF9 C;  1HNW C;  2UXC C;  4AQY C;  4X65 C;  1N36 C;  4DV0 C;  2VQE C;  2UUB C;  4DR4 C;  1YGT A;  4DV5 C;  2F4V C;  4OX9 C;  4YY3 C;  4DV2 C;  1HNZ C;  2E5L C;  4NXM C;  1HNX C;  4DUZ C;  2UXB C;  4DR7 C;  4DR1 C;  2UXD C;  2UUA C;  4BSZ A;  4JV5 C;  1IBM C;  3J81 D;  4DV4 C;  4DV1 C;  4DR5 C;  4LFB C;  4JI5 C;  4LF5 C;  1IBK C;  2HHH C;  1N32 C;  2ZM6 C;  4LF6 C;  4JI0 C;  4GKK C;  4LFC C;  4GKJ C;  4DV3 C;  4DR6 C;  3T1Y C;  4K0K C;  4LF8 C;  5FLX D;  1J5E C;  5LMN C;  4YHH C;  4DV7 C;  4LFA C;  4JI2 C;  2ZTB A;  4B3M C;  4JYA C;  4DR2 C;  2UUC C;  4DV6 C;  1XMO C;  4JI4 C;  4X66 C;  1XMQ C; 
#chains in the Genus database with same CATH homology
 2PG1 E;  1YGT A;  2ZTB A;  3FM7 A;  1XDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...