3FM7A

Quaternary structure of drosophila melanogaster ic/tctex-1/lc8; allosteric interactions of dynein light chains with dynein intermediate chain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
QFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multivalency in the assembly of intrinsically disordered Dynein intermediate chain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Contractile protein
molecule keywords Dynein light chain Tctex-type
total genus 19
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03645 Tctex-1 Tctex-1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1140.40 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3 C-terminal domain 3fm7A01
1XDXA 1YGTA 3FM7A 2PG1E
chains in the Genus database with same CATH superfamily
1YGTA 1IBLC 2ZTBA 5IT9D 4LFBC 1IBMC 4DV2C 4LF4C 2VQEC 4JI6C 2UUBC 4GKKC 4YHHC 4BSZA 4DV3C 4X65C 4YY3C 5IWAC 2ZM6C 4DR6C 4DV7C 4B3SC 5BR8C 4JI0C 1N34C 4DR1C 4KHPC 1XDXA 4DV4C 1XNQC 4JI4C 3T1YC 4JI5C 2VQFC 4DUZC 4B3RC 3J80D 4DR4C 1N32C 4JI7C 1FJGC 2UU9C 4NXMC 4LF9C 2UXCC 3JAMD 4NXNC 4DR7C 4AQYC 2HHHC 4GKJC 4DV0C 4DR3C 1XMOC 2PG1E 4DV5C 4LF8C 3J7AD 4X64C 4LF7C 4OX9C 4DR2C 1N36C 4JI2C 4DR5C 4LFCC 1I94C 4B3MC 1HNXC 3FM7A 1HNZC 5LMUC 2F4VC 4K0KC 3OTOC 4LF6C 4DUYC 4B3TC 1HR0C 4JI1C 2UXBC 1J5EC 4LFAC 2E5LC 2UXDC 4X62C 4JV5C 2UUAC 4X66C 1N33C 5LMNC 3J81D 2UUCC 5FLXD 5A2QD 3T1HC 4JYAC 4JI8C 1XMQC 1HNWC 4DV1C 1XNRC 4LF5C 1IBKC 4JI3C 4DV6C
chains in the Genus database with same CATH topology
1XDXA 1YGTA 2ZTBA 3FM7A 2PG1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XDX A;  1YGT A;  3FM7 A;  2PG1 E; 
#chains in the Genus database with same CATH topology
 1YGT A;  1IBL C;  2ZTB A;  5IT9 D;  4LFB C;  1IBM C;  4DV2 C;  4LF4 C;  2VQE C;  4JI6 C;  2UUB C;  4GKK C;  4YHH C;  4BSZ A;  4DV3 C;  4X65 C;  4YY3 C;  5IWA C;  2ZM6 C;  4DR6 C;  4DV7 C;  4B3S C;  5BR8 C;  4JI0 C;  1N34 C;  4DR1 C;  4KHP C;  1XDX A;  4DV4 C;  1XNQ C;  4JI4 C;  3T1Y C;  4JI5 C;  2VQF C;  4DUZ C;  4B3R C;  3J80 D;  4DR4 C;  1N32 C;  4JI7 C;  1FJG C;  2UU9 C;  4NXM C;  4LF9 C;  2UXC C;  3JAM D;  4NXN C;  4DR7 C;  4AQY C;  2HHH C;  4GKJ C;  4DV0 C;  4DR3 C;  1XMO C;  2PG1 E;  4DV5 C;  4LF8 C;  3J7A D;  4X64 C;  4LF7 C;  4OX9 C;  4DR2 C;  1N36 C;  4JI2 C;  4DR5 C;  4LFC C;  1I94 C;  4B3M C;  1HNX C;  3FM7 A;  1HNZ C;  5LMU C;  2F4V C;  4K0K C;  3OTO C;  4LF6 C;  4DUY C;  4B3T C;  1HR0 C;  4JI1 C;  2UXB C;  1J5E C;  4LFA C;  2E5L C;  2UXD C;  4X62 C;  4JV5 C;  2UUA C;  4X66 C;  1N33 C;  5LMN C;  3J81 D;  2UUC C;  5FLX D;  5A2Q D;  3T1H C;  4JYA C;  4JI8 C;  1XMQ C;  1HNW C;  4DV1 C;  1XNR C;  4LF5 C;  1IBK C;  4JI3 C;  4DV6 C; 
#chains in the Genus database with same CATH homology
 1XDX A;  1YGT A;  2ZTB A;  3FM7 A;  2PG1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...