4B3TC

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4b3tC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4b3tC02
2ASBA 1LQLA 3R9WA 3EERA 5LMNC 1IBKC 3I07A 4K0KC 1VLAA 2PN2A 1K0RA 2E8FA 4JI0C 2YCBA 4LF5C 4B3SC 3IEVA 3J81D 4NXMC 3OTOC 2EGTA 4DCVA 2KZFA 1ZB9A 4GKJC 4DUYC 2CY1A 4B3MC 4LF6C 1N32C 2OPLB 1XMQC 1FJGC 4X65C 2JMPA 2VQEC 4JI8C 4OX9C 3J7AD 2E8CA 4X64C 2E5LC 1ML8A 3J80D 1EGAA 5FLXD 2D7VA 3GKUA 3R9XA 2CXCA 2ATWA 1XNRC 2E7GA 4DR2C 2PT7G 4LF4C 2F4VC 4JI4C 4DV7C 1N2FA 4JI6C 4LFCC 1UKKA 3JAMD 4KHPC 1USPA 4LFAC 1HNXC 4LFBC 1N33C 4DV6C 4DV5C 4DCUA 4JI1C 1N36C 2UU9C 1XNQC 5IT9D 4NOZA 1MKYA 2UUBC 3IEUA 3AF6A 1WF3A 5A2QD 4GKKC 1IBMC 1WH9A 4JI3C 1ZB8A 4DV0C 4DCTA 3T1HC 4BSZA 4JI7C 4B3RC 4DUZC 4AQYC 1N34C 4DR7C 2XR1A 3CJEA 2UXDC 4DR4C 3T1YC 5LMUC 2E8EA 1HNZC 4JI5C 2ONFA 1I94C 1XMOC 2UXCC 1QWIA 4MTNA 1NYEA 1HNWC 2HJGA 4YHHC 2VQFC 4JYAC 2OPLA 3AF5A 4LF9C 4DR3C 4DV2C 5BR8C 1IBLC 4DV1C 1PA4A 4JV5C 2QL8A 4LF7C 4X66C 4DR5C 4DCSA 4B3TC 3LUSA 1USPB 2HHHC 1KKGA 4JI2C 4MH4A 2UXBC 4LF8C 4DR6C 1HH2P 4YY3C 2BJOA 5IWAC 4XX2A 2UUAC 4X62C 4NXNC 2UUCC 4DR1C 1L2FA 2ZM6C 4DV3C 1HR0C 4DV4C 1J5EC 2DYJA 1JOSA
chains in the Genus database with same CATH superfamily
2ASBA 4JM1A 1M6XC 1V26A 4L4QA 2PN2A 2P2BA 4JI0C 4RVOA 5CZXA 5KYTA 3J81D 1MXBA 3L8CA 3LNOA 4LF6C 2OPLB 1XMQC 4D57A 4K0BA 2VQEC 4JI8C 2E8CA 5BUSA 2E5LC 3CQ2A 3DAYA 1MXAA 1ML8A 1EGAA 2E7GA 4DR2C 2YWCA 3JAMD 1USPA 4LFAC 4RVNA 4LFBC 4DV6C 4GXRA 3FM7A 4IZ6A 5K85A 1MKYA 2UUBC 4L2ZA 3AF6A 4ZLPA 4GKKC 1IBMC 3G7SA 3UZ0A 4JI7C 4B3RC 2PG1E 3E7XA 2XR1A 4RLFA 4RLQA 3TDEA 3AY0A 3T1YC 5K8FA 1PG4A 4G1IA 1TH5A 1I94C 1XHJA 1XRAA 2UXCC 1NYEA 1HNWC 1MXCA 2DPLA 4JYAC 3GR0A 3AF5A 4RM3A 4IR7A 4DR3C 2OBVA 3VNRA 2ZTBA 5BR8C 1QM4A 4DV1C 4JV5C 1IB8A 1LCIA 2AYAA 3TQIA 3NPDA 2WP0C 4DR6C 4YY3C 2BJOA 3GPCA 2E0GA 5IWAC 3N2QA 2D1SA 4NXNC 3RG2A 4DR1C 5DV9A 1L2FA 1HR0C 4U5YD 4GS5A 1P7LA 1JOSA 3R9WA 1XRCA 5T8SA 3EERA 3I07A 4K0KC 3FCCA 5A1GA 3EQ6A 2P2QA 4G36A 3E7WA 2CU6A 4GXQA 4RM2A 1ZB9A 2KDNA 4DUYC 4RMNA 2MCQA 5AE3A 3DLPX 2Z51A 1VEHA 4I9FA 4D4GA 5CZVA 1O92A 5T8TA 1GPMA 4TPSB 2ATWA 2PT7G 4DV7C 4EATA 1MD9A 3DHVA 4BC7A 5KEIA 5A1IA 2M5HA 2D1QA 1O90A 1FLOA 2UU9C 1BA3A 1XNQC 5KYVA 1O9TA 4NOZA 4LE5A 4OYCA 2ZZMA 5A2QD 1XS3A 1WH9A 4FTFA 4DCTA 3LNVA 4AQYC 4R1MA 4DR7C 3A4IA 3UX2A 5BSVA 1O93A 1V25A 5BSMA 4DR4C 3CW8X 4BBYA 5BURA 1ULTA 1XMOC 4MTNA 3B7WA 3O2EA 4KTTA 2VQFC 3A9VA 1WCJA 1M6XA 1IBLC 1PA4A 5ADZA 4LF7C 4X66C 4D4IA 1NY8A 1USPB 3R44A 3A25A 3TUFA 1XRBA 2D1RA 4ODJA 4PUGA 4XX2A 3ETCA 5AE1A 2MM9A 2D1TA 1LQLA 1V60A 1AMUA 2QVXX 5LMNC 1IBKC 1VLAA 5E7QA 2YCBA 3LGXA 1UWDA 4LF5C 4DG8A 2ZZNA 1P4EC 4NXMC 3FCEA 4D56A 1T5DX 2KZFA 4FUTA 4B3MC 2QVZX 1N32C 1FJGC 4OXIA 2BH1X 4X65C 3KXWA 3K6RA 4X64C 2P02A 3PBKA 5FLXD 2D7VA 3GKUA 2V7BA 3R9XA 1XNRC 3CQ1A 4LFCC 1N2FA 4JI6C 1UKKA 1RY2A 4KHPC 1HNXC 2Y27A 5JRHA 4DCUA 1N36C 2P20A 4DG9A 3IMLA 3L95X 1T5HX 3NYRA 4PUHA 3PESA 4DV0C 4BSZA 1N34C 5AE2A 3H2TA 3LAXA 2QVYX 1P4EA 5LMUC 1HNZC 4JI5C 5H9UA 4G37A 2Y4OA 4BCAA 4YHHC 2MMAB 2OPLA 4PZPA 2D27A 1FUGA 2PROA 5BUQA 4DV2C 3A26A 4BC9A 4L7IA 4DCSA 3LUSA 1MDFA 2HHHC 4JI2C 5BSTA 3CW9A 4ZJZA 4LF8C 4R1LA 2UUAC 1PU1A 4X62C 5A19A 3PROC 2UUCC 2ZM6C 4DV3C 2NCLA 1J5EC 2DYJA 4B3TC 4OX9C 3N54B 5LCIA 4WS9A 2DHMA 1K0RA 4PHTA 5BSWA 2E8FA 3VNQA 1MDBA 4KTVA 3UOWA 4WV3A 1YJ7A 4B3SC 3IEVA 3OTOC 1PG3A 2EGTA 4DCVA 2M5OA 4GKJC 2CY1A 3I08A 3S82A 3VNSA 1YGTA 2JMPA 3J7AD 3SO4A 2VSQA 2KZ0A 3CQ3A 3RV2A 3J80D 4ISBA 4NDNA 4I9GA 2CXCA 4LF4C 2F4VC 4JI4C 3ETOA 3UX3A 2QW0X 1XDXA 4PROC 1N33C 4DV5C 4JI1C 2YX1A 5IT9D 5BSRA 3IEUA 2YWBA 2P2FA 2JNVA 1WF3A 5GTDA 4JI3C 1ZB8A 3T1HC 4DUZC 5BSUA 3CJEA 2UXDC 2OO4A 3A9UA 3C5EA 2Y4NA 3TR3A 2E8EA 2ONFA 4FUQA 2P2JA 1QWIA 3UEBA 2HJGA 2VZEA 4LF9C 5IFIA 1RG9A 4R0MA 2D28C 2P2MA 2QL8A 4DR5C 1KKGA 4MH4A 2UXBC 1HH2P 2WD9A 3NI2A 4HPVA 3IPLA 4PUIA 3GR1A 4DV4C 3NYQA
chains in the Genus database with same CATH topology
2ASBA 4JM1A 1V26A 4L4QA 2PN2A 2P2BA 4JI0C 4RVOA 5CZXA 5KYTA 3J81D 1MXBA 3L8CA 4LF6C 2OPLB 1XMQC 4D57A 4K0BA 2VQEC 4JI8C 2E8CA 5BUSA 2E5LC 3DAYA 1MXAA 1ML8A 1EGAA 2E7GA 4DR2C 2YWCA 3JAMD 1USPA 4LFAC 4RVNA 4LFBC 4DV6C 4GXRA 4IZ6A 5K85A 1MKYA 2UUBC 4L2ZA 3AF6A 4ZLPA 4GKKC 1IBMC 3G7SA 3UZ0A 4JI7C 4B3RC 3E7XA 2XR1A 4RLFA 4RLQA 3TDEA 3T1YC 5K8FA 1PG4A 4G1IA 1I94C 1XRAA 2UXCC 1NYEA 1HNWC 1MXCA 2DPLA 4JYAC 3GR0A 3AF5A 4RM3A 4IR7A 4DR3C 2OBVA 3VNRA 5BR8C 1QM4A 4DV1C 4JV5C 1LCIA 2AYAA 3TQIA 3NPDA 2WP0C 4DR6C 4YY3C 2BJOA 3GPCA 2E0GA 5IWAC 3N2QA 2D1SA 4NXNC 3RG2A 4DR1C 5DV9A 1L2FA 1HR0C 4U5YD 4GS5A 1P7LA 1JOSA 3R9WA 1XRCA 5T8SA 3EERA 3I07A 4K0KC 3FCCA 5A1GA 3EQ6A 2P2QA 4G36A 3E7WA 4GXQA 4RM2A 1ZB9A 4DUYC 4RMNA 5AE3A 3DLPX 4I9FA 4D4GA 5CZVA 1O92A 5T8TA 1GPMA 4TPSB 2ATWA 2PT7G 4DV7C 4EATA 1MD9A 3DHVA 4BC7A 5KEIA 5A1IA 2D1QA 1O90A 2UU9C 1BA3A 1XNQC 5KYVA 1O9TA 4NOZA 4LE5A 4OYCA 5A2QD 1WH9A 4FTFA 4DCTA 3LNVA 4AQYC 4R1MA 4DR7C 3A4IA 5BSVA 1O93A 1V25A 5BSMA 4DR4C 3CW8X 4BBYA 5BURA 1ULTA 1XMOC 4MTNA 3B7WA 4KTTA 2VQFC 3A9VA 1IBLC 1PA4A 5ADZA 4LF7C 4X66C 4D4IA 1USPB 3R44A 3TUFA 1XRBA 2D1RA 4ODJA 4XX2A 3ETCA 5AE1A 2D1TA 1LQLA 1AMUA 2QVXX 5LMNC 1IBKC 1VLAA 5E7QA 2YCBA 3LGXA 4LF5C 4DG8A 4NXMC 3FCEA 4D56A 1T5DX 2KZFA 4FUTA 4B3MC 2QVZX 1N32C 1FJGC 4OXIA 2BH1X 4X65C 3KXWA 4X64C 2P02A 3PBKA 5FLXD 2D7VA 3GKUA 2V7BA 3R9XA 1XNRC 4LFCC 1N2FA 4JI6C 1UKKA 1RY2A 4KHPC 1HNXC 2Y27A 5JRHA 4DCUA 1N36C 2P20A 4DG9A 3IMLA 3L95X 1T5HX 3NYRA 3PESA 4DV0C 4BSZA 1N34C 5AE2A 3H2TA 3LAXA 2QVYX 5LMUC 1HNZC 4JI5C 5H9UA 4G37A 2Y4OA 4BCAA 4YHHC 2OPLA 4PZPA 2D27A 1FUGA 2PROA 5BUQA 4DV2C 4BC9A 4L7IA 4DCSA 3LUSA 1MDFA 2HHHC 4JI2C 5BSTA 3CW9A 4ZJZA 4LF8C 4R1LA 2UUAC 4X62C 5A19A 3PROC 2UUCC 2ZM6C 4DV3C 1J5EC 2DYJA 4B3TC 4OX9C 3N54B 4WS9A 1K0RA 4PHTA 5BSWA 2E8FA 3VNQA 1MDBA 4KTVA 3UOWA 4WV3A 1YJ7A 4B3SC 3IEVA 3OTOC 1PG3A 2EGTA 4DCVA 4GKJC 2CY1A 3I08A 3S82A 3VNSA 2JMPA 3J7AD 3SO4A 2VSQA 3RV2A 3J80D 4ISBA 4NDNA 4I9GA 2CXCA 4LF4C 2F4VC 4JI4C 3ETOA 2QW0X 4PROC 1N33C 4DV5C 4JI1C 5IT9D 5BSRA 3IEUA 2YWBA 2P2FA 1WF3A 5GTDA 4JI3C 1ZB8A 3T1HC 4DUZC 5BSUA 3CJEA 2UXDC 2OO4A 3A9UA 3C5EA 2Y4NA 2E8EA 2ONFA 4FUQA 2P2JA 1QWIA 2HJGA 2VZEA 4LF9C 5IFIA 1RG9A 4R0MA 2D28C 2P2MA 2QL8A 4DR5C 1KKGA 4MH4A 2UXBC 1HH2P 2WD9A 3NI2A 4HPVA 3IPLA 3GR1A 4DV4C 3NYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ASB A;  1LQL A;  3R9W A;  3EER A;  5LMN C;  1IBK C;  3I07 A;  4K0K C;  1VLA A;  2PN2 A;  1K0R A;  2E8F A;  4JI0 C;  2YCB A;  4LF5 C;  4B3S C;  3IEV A;  3J81 D;  4NXM C;  3OTO C;  2EGT A;  4DCV A;  2KZF A;  1ZB9 A;  4GKJ C;  4DUY C;  2CY1 A;  4B3M C;  4LF6 C;  1N32 C;  2OPL B;  1XMQ C;  1FJG C;  4X65 C;  2JMP A;  2VQE C;  4JI8 C;  4OX9 C;  3J7A D;  2E8C A;  4X64 C;  2E5L C;  1ML8 A;  3J80 D;  1EGA A;  5FLX D;  2D7V A;  3GKU A;  3R9X A;  2CXC A;  2ATW A;  1XNR C;  2E7G A;  4DR2 C;  2PT7 G;  4LF4 C;  2F4V C;  4JI4 C;  4DV7 C;  1N2F A;  4JI6 C;  4LFC C;  1UKK A;  3JAM D;  4KHP C;  1USP A;  4LFA C;  1HNX C;  4LFB C;  1N33 C;  4DV6 C;  4DV5 C;  4DCU A;  4JI1 C;  1N36 C;  2UU9 C;  1XNQ C;  5IT9 D;  4NOZ A;  1MKY A;  2UUB C;  3IEU A;  3AF6 A;  1WF3 A;  5A2Q D;  4GKK C;  1IBM C;  1WH9 A;  4JI3 C;  1ZB8 A;  4DV0 C;  4DCT A;  3T1H C;  4BSZ A;  4JI7 C;  4B3R C;  4DUZ C;  4AQY C;  1N34 C;  4DR7 C;  2XR1 A;  3CJE A;  2UXD C;  4DR4 C;  3T1Y C;  5LMU C;  2E8E A;  1HNZ C;  4JI5 C;  2ONF A;  1I94 C;  1XMO C;  2UXC C;  1QWI A;  4MTN A;  1NYE A;  1HNW C;  2HJG A;  4YHH C;  2VQF C;  4JYA C;  2OPL A;  3AF5 A;  4LF9 C;  4DR3 C;  4DV2 C;  5BR8 C;  1IBL C;  4DV1 C;  1PA4 A;  4JV5 C;  2QL8 A;  4LF7 C;  4X66 C;  4DR5 C;  4DCS A;  4B3T C;  3LUS A;  1USP B;  2HHH C;  1KKG A;  4JI2 C;  4MH4 A;  2UXB C;  4LF8 C;  4DR6 C;  1HH2 P;  4YY3 C;  2BJO A;  5IWA C;  4XX2 A;  2UUA C;  4X62 C;  4NXN C;  2UUC C;  4DR1 C;  1L2F A;  2ZM6 C;  4DV3 C;  1HR0 C;  4DV4 C;  1J5E C;  2DYJ A;  1JOS A; 
#chains in the Genus database with same CATH topology
 2ASB A;  4JM1 A;  1M6X C;  1V26 A;  4L4Q A;  2PN2 A;  2P2B A;  4JI0 C;  4RVO A;  5CZX A;  5KYT A;  3J81 D;  1MXB A;  3L8C A;  3LNO A;  4LF6 C;  2OPL B;  1XMQ C;  4D57 A;  4K0B A;  2VQE C;  4JI8 C;  2E8C A;  5BUS A;  2E5L C;  3CQ2 A;  3DAY A;  1MXA A;  1ML8 A;  1EGA A;  2E7G A;  4DR2 C;  2YWC A;  3JAM D;  1USP A;  4LFA C;  4RVN A;  4LFB C;  4DV6 C;  4GXR A;  3FM7 A;  4IZ6 A;  5K85 A;  1MKY A;  2UUB C;  4L2Z A;  3AF6 A;  4ZLP A;  4GKK C;  1IBM C;  3G7S A;  3UZ0 A;  4JI7 C;  4B3R C;  2PG1 E;  3E7X A;  2XR1 A;  4RLF A;  4RLQ A;  3TDE A;  3AY0 A;  3T1Y C;  5K8F A;  1PG4 A;  4G1I A;  1TH5 A;  1I94 C;  1XHJ A;  1XRA A;  2UXC C;  1NYE A;  1HNW C;  1MXC A;  2DPL A;  4JYA C;  3GR0 A;  3AF5 A;  4RM3 A;  4IR7 A;  4DR3 C;  2OBV A;  3VNR A;  2ZTB A;  5BR8 C;  1QM4 A;  4DV1 C;  4JV5 C;  1IB8 A;  1LCI A;  2AYA A;  3TQI A;  3NPD A;  2WP0 C;  4DR6 C;  4YY3 C;  2BJO A;  3GPC A;  2E0G A;  5IWA C;  3N2Q A;  2D1S A;  4NXN C;  3RG2 A;  4DR1 C;  5DV9 A;  1L2F A;  1HR0 C;  4U5Y D;  4GS5 A;  1P7L A;  1JOS A;  3R9W A;  1XRC A;  5T8S A;  3EER A;  3I07 A;  4K0K C;  3FCC A;  5A1G A;  3EQ6 A;  2P2Q A;  4G36 A;  3E7W A;  2CU6 A;  4GXQ A;  4RM2 A;  1ZB9 A;  2KDN A;  4DUY C;  4RMN A;  2MCQ A;  5AE3 A;  3DLP X;  2Z51 A;  1VEH A;  4I9F A;  4D4G A;  5CZV A;  1O92 A;  5T8T A;  1GPM A;  4TPS B;  2ATW A;  2PT7 G;  4DV7 C;  4EAT A;  1MD9 A;  3DHV A;  4BC7 A;  5KEI A;  5A1I A;  2M5H A;  2D1Q A;  1O90 A;  1FLO A;  2UU9 C;  1BA3 A;  1XNQ C;  5KYV A;  1O9T A;  4NOZ A;  4LE5 A;  4OYC A;  2ZZM A;  5A2Q D;  1XS3 A;  1WH9 A;  4FTF A;  4DCT A;  3LNV A;  4AQY C;  4R1M A;  4DR7 C;  3A4I A;  3UX2 A;  5BSV A;  1O93 A;  1V25 A;  5BSM A;  4DR4 C;  3CW8 X;  4BBY A;  5BUR A;  1ULT A;  1XMO C;  4MTN A;  3B7W A;  3O2E A;  4KTT A;  2VQF C;  3A9V A;  1WCJ A;  1M6X A;  1IBL C;  1PA4 A;  5ADZ A;  4LF7 C;  4X66 C;  4D4I A;  1NY8 A;  1USP B;  3R44 A;  3A25 A;  3TUF A;  1XRB A;  2D1R A;  4ODJ A;  4PUG A;  4XX2 A;  3ETC A;  5AE1 A;  2MM9 A;  2D1T A;  1LQL A;  1V60 A;  1AMU A;  2QVX X;  5LMN C;  1IBK C;  1VLA A;  5E7Q A;  2YCB A;  3LGX A;  1UWD A;  4LF5 C;  4DG8 A;  2ZZN A;  1P4E C;  4NXM C;  3FCE A;  4D56 A;  1T5D X;  2KZF A;  4FUT A;  4B3M C;  2QVZ X;  1N32 C;  1FJG C;  4OXI A;  2BH1 X;  4X65 C;  3KXW A;  3K6R A;  4X64 C;  2P02 A;  3PBK A;  5FLX D;  2D7V A;  3GKU A;  2V7B A;  3R9X A;  1XNR C;  3CQ1 A;  4LFC C;  1N2F A;  4JI6 C;  1UKK A;  1RY2 A;  4KHP C;  1HNX C;  2Y27 A;  5JRH A;  4DCU A;  1N36 C;  2P20 A;  4DG9 A;  3IML A;  3L95 X;  1T5H X;  3NYR A;  4PUH A;  3PES A;  4DV0 C;  4BSZ A;  1N34 C;  5AE2 A;  3H2T A;  3LAX A;  2QVY X;  1P4E A;  5LMU C;  1HNZ C;  4JI5 C;  5H9U A;  4G37 A;  2Y4O A;  4BCA A;  4YHH C;  2MMA B;  2OPL A;  4PZP A;  2D27 A;  1FUG A;  2PRO A;  5BUQ A;  4DV2 C;  3A26 A;  4BC9 A;  4L7I A;  4DCS A;  3LUS A;  1MDF A;  2HHH C;  4JI2 C;  5BST A;  3CW9 A;  4ZJZ A;  4LF8 C;  4R1L A;  2UUA C;  1PU1 A;  4X62 C;  5A19 A;  3PRO C;  2UUC C;  2ZM6 C;  4DV3 C;  2NCL A;  1J5E C;  2DYJ A;  4B3T C;  4OX9 C;  3N54 B;  5LCI A;  4WS9 A;  2DHM A;  1K0R A;  4PHT A;  5BSW A;  2E8F A;  3VNQ A;  1MDB A;  4KTV A;  3UOW A;  4WV3 A;  1YJ7 A;  4B3S C;  3IEV A;  3OTO C;  1PG3 A;  2EGT A;  4DCV A;  2M5O A;  4GKJ C;  2CY1 A;  3I08 A;  3S82 A;  3VNS A;  1YGT A;  2JMP A;  3J7A D;  3SO4 A;  2VSQ A;  2KZ0 A;  3CQ3 A;  3RV2 A;  3J80 D;  4ISB A;  4NDN A;  4I9G A;  2CXC A;  4LF4 C;  2F4V C;  4JI4 C;  3ETO A;  3UX3 A;  2QW0 X;  1XDX A;  4PRO C;  1N33 C;  4DV5 C;  4JI1 C;  2YX1 A;  5IT9 D;  5BSR A;  3IEU A;  2YWB A;  2P2F A;  2JNV A;  1WF3 A;  5GTD A;  4JI3 C;  1ZB8 A;  3T1H C;  4DUZ C;  5BSU A;  3CJE A;  2UXD C;  2OO4 A;  3A9U A;  3C5E A;  2Y4N A;  3TR3 A;  2E8E A;  2ONF A;  4FUQ A;  2P2J A;  1QWI A;  3UEB A;  2HJG A;  2VZE A;  4LF9 C;  5IFI A;  1RG9 A;  4R0M A;  2D28 C;  2P2M A;  2QL8 A;  4DR5 C;  1KKG A;  4MH4 A;  2UXB C;  1HH2 P;  2WD9 A;  3NI2 A;  4HPV A;  3IPL A;  4PUI A;  3GR1 A;  4DV4 C;  3NYQ A; 
#chains in the Genus database with same CATH homology
 2ASB A;  4JM1 A;  1V26 A;  4L4Q A;  2PN2 A;  2P2B A;  4JI0 C;  4RVO A;  5CZX A;  5KYT A;  3J81 D;  1MXB A;  3L8C A;  4LF6 C;  2OPL B;  1XMQ C;  4D57 A;  4K0B A;  2VQE C;  4JI8 C;  2E8C A;  5BUS A;  2E5L C;  3DAY A;  1MXA A;  1ML8 A;  1EGA A;  2E7G A;  4DR2 C;  2YWC A;  3JAM D;  1USP A;  4LFA C;  4RVN A;  4LFB C;  4DV6 C;  4GXR A;  4IZ6 A;  5K85 A;  1MKY A;  2UUB C;  4L2Z A;  3AF6 A;  4ZLP A;  4GKK C;  1IBM C;  3G7S A;  3UZ0 A;  4JI7 C;  4B3R C;  3E7X A;  2XR1 A;  4RLF A;  4RLQ A;  3TDE A;  3T1Y C;  5K8F A;  1PG4 A;  4G1I A;  1I94 C;  1XRA A;  2UXC C;  1NYE A;  1HNW C;  1MXC A;  2DPL A;  4JYA C;  3GR0 A;  3AF5 A;  4RM3 A;  4IR7 A;  4DR3 C;  2OBV A;  3VNR A;  5BR8 C;  1QM4 A;  4DV1 C;  4JV5 C;  1LCI A;  2AYA A;  3TQI A;  3NPD A;  2WP0 C;  4DR6 C;  4YY3 C;  2BJO A;  3GPC A;  2E0G A;  5IWA C;  3N2Q A;  2D1S A;  4NXN C;  3RG2 A;  4DR1 C;  5DV9 A;  1L2F A;  1HR0 C;  4U5Y D;  4GS5 A;  1P7L A;  1JOS A;  3R9W A;  1XRC A;  5T8S A;  3EER A;  3I07 A;  4K0K C;  3FCC A;  5A1G A;  3EQ6 A;  2P2Q A;  4G36 A;  3E7W A;  4GXQ A;  4RM2 A;  1ZB9 A;  4DUY C;  4RMN A;  5AE3 A;  3DLP X;  4I9F A;  4D4G A;  5CZV A;  1O92 A;  5T8T A;  1GPM A;  4TPS B;  2ATW A;  2PT7 G;  4DV7 C;  4EAT A;  1MD9 A;  3DHV A;  4BC7 A;  5KEI A;  5A1I A;  2D1Q A;  1O90 A;  2UU9 C;  1BA3 A;  1XNQ C;  5KYV A;  1O9T A;  4NOZ A;  4LE5 A;  4OYC A;  5A2Q D;  1WH9 A;  4FTF A;  4DCT A;  3LNV A;  4AQY C;  4R1M A;  4DR7 C;  3A4I A;  5BSV A;  1O93 A;  1V25 A;  5BSM A;  4DR4 C;  3CW8 X;  4BBY A;  5BUR A;  1ULT A;  1XMO C;  4MTN A;  3B7W A;  4KTT A;  2VQF C;  3A9V A;  1IBL C;  1PA4 A;  5ADZ A;  4LF7 C;  4X66 C;  4D4I A;  1USP B;  3R44 A;  3TUF A;  1XRB A;  2D1R A;  4ODJ A;  4XX2 A;  3ETC A;  5AE1 A;  2D1T A;  1LQL A;  1AMU A;  2QVX X;  5LMN C;  1IBK C;  1VLA A;  5E7Q A;  2YCB A;  3LGX A;  4LF5 C;  4DG8 A;  4NXM C;  3FCE A;  4D56 A;  1T5D X;  2KZF A;  4FUT A;  4B3M C;  2QVZ X;  1N32 C;  1FJG C;  4OXI A;  2BH1 X;  4X65 C;  3KXW A;  4X64 C;  2P02 A;  3PBK A;  5FLX D;  2D7V A;  3GKU A;  2V7B A;  3R9X A;  1XNR C;  4LFC C;  1N2F A;  4JI6 C;  1UKK A;  1RY2 A;  4KHP C;  1HNX C;  2Y27 A;  5JRH A;  4DCU A;  1N36 C;  2P20 A;  4DG9 A;  3IML A;  3L95 X;  1T5H X;  3NYR A;  3PES A;  4DV0 C;  4BSZ A;  1N34 C;  5AE2 A;  3H2T A;  3LAX A;  2QVY X;  5LMU C;  1HNZ C;  4JI5 C;  5H9U A;  4G37 A;  2Y4O A;  4BCA A;  4YHH C;  2OPL A;  4PZP A;  2D27 A;  1FUG A;  2PRO A;  5BUQ A;  4DV2 C;  4BC9 A;  4L7I A;  4DCS A;  3LUS A;  1MDF A;  2HHH C;  4JI2 C;  5BST A;  3CW9 A;  4ZJZ A;  4LF8 C;  4R1L A;  2UUA C;  4X62 C;  5A19 A;  3PRO C;  2UUC C;  2ZM6 C;  4DV3 C;  1J5E C;  2DYJ A;  4B3T C;  4OX9 C;  3N54 B;  4WS9 A;  1K0R A;  4PHT A;  5BSW A;  2E8F A;  3VNQ A;  1MDB A;  4KTV A;  3UOW A;  4WV3 A;  1YJ7 A;  4B3S C;  3IEV A;  3OTO C;  1PG3 A;  2EGT A;  4DCV A;  4GKJ C;  2CY1 A;  3I08 A;  3S82 A;  3VNS A;  2JMP A;  3J7A D;  3SO4 A;  2VSQ A;  3RV2 A;  3J80 D;  4ISB A;  4NDN A;  4I9G A;  2CXC A;  4LF4 C;  2F4V C;  4JI4 C;  3ETO A;  2QW0 X;  4PRO C;  1N33 C;  4DV5 C;  4JI1 C;  5IT9 D;  5BSR A;  3IEU A;  2YWB A;  2P2F A;  1WF3 A;  5GTD A;  4JI3 C;  1ZB8 A;  3T1H C;  4DUZ C;  5BSU A;  3CJE A;  2UXD C;  2OO4 A;  3A9U A;  3C5E A;  2Y4N A;  2E8E A;  2ONF A;  4FUQ A;  2P2J A;  1QWI A;  2HJG A;  2VZE A;  4LF9 C;  5IFI A;  1RG9 A;  4R0M A;  2D28 C;  2P2M A;  2QL8 A;  4DR5 C;  1KKG A;  4MH4 A;  2UXB C;  1HH2 P;  2WD9 A;  3NI2 A;  4HPV A;  3IPL A;  3GR1 A;  4DV4 C;  3NYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...