4B3TC

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4b3tC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4b3tC02
4JI8C 2UXDC 1USPB 4NXMC 4DR3C 3J7AD 1XNRC 5IT9D 3I07A 1UKKA 4NOZA 2VQEC 4B3RC 4GKKC 1XMOC 5IWAC 2PT7G 4LFAC 1IBMC 4DV2C 4DR5C 1FJGC 1MKYA 3J80D 2D7VA 4AQYC 1KKGA 4JI3C 2ZM6C 4JI1C 4X66C 5A2QD 1N33C 4LFBC 4X65C 1XMQC 1HNZC 3R9WA 4DV6C 1JOSA 4LF6C 5LMUC 1I94C 2F4VC 4X62C 2E7GA 4JI6C 4YHHC 1L2FA 2UUAC 4MTNA 2VQFC 2E5LC 4DCSA 4DUZC 4DV4C 4LF7C 4DCUA 4B3SC 1N2FA 4X64C 2KZFA 2PN2A 4DCVA 2E8EA 4DR6C 1WH9A 1NYEA 5FLXD 1J5EC 4K0KC 1PA4A 4DCTA 5BR8C 2UXCC 3CJEA 3J81D 3LUSA 4DV0C 1IBKC 2YCBA 4DV5C 4JV5C 1QWIA 1VLAA 3T1HC 4JI7C 1XNQC 4MH4A 4JI5C 4DV7C 3T1YC 4NXNC 2UUBC 2ATWA 4DUYC 4BSZA 2JMPA 4DR7C 2HJGA 2ONFA 3AF5A 4DV1C 1IBLC 2UUCC 4DR4C 2E8CA 1ZB9A 2CXCA 2EGTA 3EERA 4JI4C 3OTOC 1USPA 4YY3C 4OX9C 1ML8A 3GKUA 1N34C 1LQLA 3IEUA 1K0RA 1HH2P 1EGAA 4LF9C 4LF4C 4B3MC 2QL8A 5LMNC 2ASBA 3IEVA 2HHHC 2E8FA 2UXBC 4XX2A 3AF6A 4KHPC 4JI0C 4GKJC 4JI2C 4JYAC 1HNXC 4LFCC 2DYJA 2CY1A 3R9XA 4DR1C 2UU9C 4B3TC 1HR0C 1ZB8A 4LF8C 2OPLA 4DV3C 4LF5C 1N32C 3JAMD 1HNWC 4DR2C 1WF3A 2OPLB 2BJOA 1N36C 2XR1A
chains in the Genus database with same CATH superfamily
1V25A 4NXMC 4DR3C 2ZZMA 1TH5A 5IT9D 2VQEC 4DG9A 4L7IA 5BSMA 3TDEA 1PG3A 4WS9A 2D7VA 4AQYC 2ZM6C 2P2FA 4JI1C 2YWBA 4X65C 1XMQC 1RY2A 2NCLA 4BBYA 4ZLPA 4K0BA 2QW0X 5KYVA 1I94C 2E7GA 4RM2A 5A1IA 4DUZC 4LF7C 3N2QA 4GXQA 3NPDA 2MCQA 5AE2A 4DR6C 2MMAB 4K0KC 4R1MA 4DG8A 4PUGA 3CJEA 3TQIA 2E0GA 5T8TA 4RVNA 5ADZA 4JV5C 1QWIA 4JI7C 1XNQC 2YX1A 5BSTA 5BSVA 2DHMA 1YJ7A 3T1YC 1O92A 3FCCA 3E7WA 3UZ0A 4DUYC 2JMPA 2PROA 1FLOA 2HJGA 3RG2A 2UUCC 4DR4C 3VNQA 2E8CA 2CXCA 3EERA 3A9UA 4I9FA 3OTOC 1USPA 3IEUA 5T8SA 5BURA 3LNVA 1GPMA 3RV2A 1BA3A 4B3MC 2QL8A 2D1SA 1MDBA 4RLQA 4BC9A 1HNXC 5E7QA 3G7SA 1FUGA 2Z51A 2D28C 5BSUA 3NYRA 2M5HA 5LCIA 3E7XA 2BJOA 4PUIA 1N36C 4JI8C 4TPSB 3DAYA 1XNRC 1UKKA 2KDNA 4GKKC 1YGTA 5H9UA 3AY0A 3H2TA 3TUFA 3A25A 1IBMC 4DR5C 1MKYA 3VNRA 4ZJZA 3J80D 5BSWA 5A1GA 5BSRA 4X66C 5A2QD 1XRBA 1XS3A 4FTFA 1N33C 3R9WA 4NDNA 5KYTA 1UWDA 2QVXX 4BC7A 2D1QA 2F4VC 4YHHC 1L2FA 5BUQA 5K8FA 2P2QA 4X64C 2M5OA 5IFIA 1J5EC 5BR8C 1MXCA 1V26A 4JM1A 2UXCC 3J81D 3B7WA 3LNOA 2KZ0A 3LUSA 4IR7A 3C5EA 4G1IA 3IMLA 4PUHA 3L95X 2V7BA 4NXNC 3ETCA 1WCJA 3CQ1A 2ONFA 5CZVA 1IBLC 1MXAA 3UX3A 2EGTA 1IB8A 1LQLA 1AMUA 1MDFA 4LF9C 5GTDA 4RVOA 3IEVA 1NY8A 4KHPC 2ZTBA 4FUTA 4JYAC 4D57A 4LFCC 4GS5A 4DR1C 4KTTA 4B3TC 4PHTA 3ETOA 3CW9A 3JAMD 2VSQA 1WF3A 4R0MA 1QM4A 2UXDC 1USPB 2CU6A 3J7AD 3L8CA 3PESA 3I07A 3A4IA 4NOZA 4WV3A 3CQ3A 1O90A 4ISBA 5IWAC 2PT7G 4LFAC 4R1LA 3O2EA 1FJGC 1XDXA 1LCIA 2WD9A 4RM3A 5JRHA 4LE5A 1MXBA 3A26A 5AE1A 2MM9A 1KKGA 4JI3C 4PROC 2JNVA 4LFBC 3NYQA 5K85A 4LF6C 5LMUC 2UUAC 2P2MA 4MTNA 2QVZX 4I9GA 4DCSA 4DV4C 4DCUA 4B3SC 2KZFA 1M6XC 2PN2A 4DCVA 3KXWA 1WH9A 5FLXD 1PA4A 4DCTA 1O93A 4IZ6A 1XHJA 4HPVA 4RLFA 3LGXA 4FUQA 4BCAA 5BUSA 4DV5C 5CZXA 1P4EC 3FM7A 3GPCA 3UEBA 4JI5C 4G37A 2UUBC 2ATWA 2YWCA 3S82A 4GXRA 4DR7C 3AF5A 1ULTA 4DV1C 3UOWA 1ZB9A 4U5YD 4OX9C 1ML8A 3GKUA 4KTVA 1K0RA 2BH1X 5LMNC 2P02A 2HHHC 4XX2A 3AF6A 5A19A 3GR1A 3K6RA 4GKJC 4JI2C 3UX2A 1HR0C 4LF8C 2PG1E 3EQ6A 4DV3C 4LF5C 4D4GA 1N32C 4DR2C 1XRCA 2DPLA 4PZPA 2D1RA 4RMNA 4B3RC 2Y4OA 1XMOC 3CQ2A 3I08A 2D27A 4ODJA 4DV2C 2Y27A 5AE3A 3NI2A 3DHVA 1PG4A 4OXIA 1T5DX 3VNSA 1HNZC 4DV6C 5KEIA 3CW8X 1JOSA 1T5HX 3SO4A 4X62C 4JI6C 5DV9A 2VQFC 3A9VA 2E5LC 4G36A 1N2FA 2P20A 3PBKA 2E8EA 1NYEA 2AYAA 2Y4NA 3FCEA 3N54B 2OO4A 2WP0C 4EATA 1MD9A 4DV0C 1IBKC 2YCBA 4D4IA 2VZEA 3GR0A 1O9TA 1VLAA 3T1HC 2ZZNA 4MH4A 4DV7C 1VEHA 4BSZA 1P7LA 3R44A 4D56A 2P2JA 4OYCA 4JI4C 4YY3C 2QVYX 1N34C 1PU1A 1M6XA 1RG9A 1HH2P 2P2BA 4L2ZA 1EGAA 4LF4C 2ASBA 2D1TA 2E8FA 2UXBC 4JI0C 3TR3A 2DYJA 2CY1A 3PROC 3R9XA 1V60A 2UU9C 1P4EA 1ZB8A 3DLPX 2OPLA 3LAXA 2OBVA 4L4QA 1HNWC 2OPLB 3IPLA 1XRAA 2XR1A
chains in the Genus database with same CATH topology
1V25A 4NXMC 4DR3C 5IT9D 2VQEC 4DG9A 4L7IA 5BSMA 3TDEA 1PG3A 4WS9A 2D7VA 4AQYC 2ZM6C 2P2FA 4JI1C 2YWBA 4X65C 1XMQC 1RY2A 4BBYA 4ZLPA 4K0BA 2QW0X 5KYVA 1I94C 2E7GA 4RM2A 5A1IA 4DUZC 4LF7C 3N2QA 4GXQA 3NPDA 5AE2A 4DR6C 4K0KC 4R1MA 4DG8A 3CJEA 3TQIA 2E0GA 5T8TA 4RVNA 5ADZA 4JV5C 1QWIA 4JI7C 1XNQC 5BSTA 5BSVA 1YJ7A 3T1YC 1O92A 3FCCA 3E7WA 3UZ0A 4DUYC 2JMPA 2PROA 2HJGA 3RG2A 2UUCC 4DR4C 3VNQA 2E8CA 2CXCA 3EERA 3A9UA 4I9FA 3OTOC 1USPA 3IEUA 5T8SA 5BURA 3LNVA 1GPMA 3RV2A 1BA3A 4B3MC 2QL8A 2D1SA 1MDBA 4RLQA 4BC9A 1HNXC 5E7QA 3G7SA 1FUGA 2D28C 5BSUA 3NYRA 3E7XA 2BJOA 1N36C 4JI8C 4TPSB 3DAYA 1XNRC 1UKKA 4GKKC 5H9UA 3H2TA 3TUFA 1IBMC 4DR5C 1MKYA 3VNRA 4ZJZA 3J80D 5BSWA 5A1GA 5BSRA 4X66C 5A2QD 1XRBA 4FTFA 1N33C 3R9WA 4NDNA 5KYTA 2QVXX 4BC7A 2D1QA 2F4VC 4YHHC 1L2FA 5BUQA 5K8FA 2P2QA 4X64C 5IFIA 1J5EC 5BR8C 1MXCA 1V26A 4JM1A 2UXCC 3J81D 3B7WA 3LUSA 4IR7A 3C5EA 4G1IA 3IMLA 3L95X 2V7BA 4NXNC 3ETCA 2ONFA 5CZVA 1IBLC 1MXAA 2EGTA 1LQLA 1AMUA 1MDFA 4LF9C 5GTDA 4RVOA 3IEVA 4KHPC 4FUTA 4JYAC 4D57A 4LFCC 4GS5A 4DR1C 4KTTA 4B3TC 4PHTA 3ETOA 3CW9A 3JAMD 2VSQA 1WF3A 4R0MA 1QM4A 2UXDC 1USPB 3J7AD 3L8CA 3PESA 3I07A 3A4IA 4NOZA 4WV3A 1O90A 4ISBA 5IWAC 2PT7G 4LFAC 4R1LA 1FJGC 1LCIA 2WD9A 4RM3A 5JRHA 4LE5A 1MXBA 5AE1A 1KKGA 4JI3C 4PROC 4LFBC 3NYQA 5K85A 4LF6C 5LMUC 2UUAC 2P2MA 4MTNA 2QVZX 4I9GA 4DCSA 4DV4C 4DCUA 4B3SC 2KZFA 2PN2A 4DCVA 3KXWA 1WH9A 5FLXD 1PA4A 4DCTA 1O93A 4IZ6A 4HPVA 4RLFA 3LGXA 4FUQA 4BCAA 5BUSA 4DV5C 5CZXA 3GPCA 4JI5C 4G37A 2UUBC 2ATWA 2YWCA 3S82A 4GXRA 4DR7C 3AF5A 1ULTA 4DV1C 3UOWA 1ZB9A 4U5YD 4OX9C 1ML8A 3GKUA 4KTVA 1K0RA 2BH1X 5LMNC 2P02A 2HHHC 4XX2A 3AF6A 5A19A 3GR1A 4GKJC 4JI2C 1HR0C 4LF8C 3EQ6A 4DV3C 4LF5C 4D4GA 1N32C 4DR2C 1XRCA 2DPLA 4PZPA 2D1RA 4RMNA 4B3RC 2Y4OA 1XMOC 3I08A 2D27A 4ODJA 4DV2C 2Y27A 5AE3A 3NI2A 3DHVA 1PG4A 4OXIA 1T5DX 3VNSA 1HNZC 4DV6C 5KEIA 3CW8X 1JOSA 1T5HX 3SO4A 4X62C 4JI6C 5DV9A 2VQFC 3A9VA 2E5LC 4G36A 1N2FA 2P20A 3PBKA 2E8EA 1NYEA 2AYAA 2Y4NA 3FCEA 3N54B 2OO4A 2WP0C 4EATA 1MD9A 4DV0C 1IBKC 2YCBA 4D4IA 2VZEA 3GR0A 1O9TA 1VLAA 3T1HC 4MH4A 4DV7C 4BSZA 1P7LA 3R44A 4D56A 2P2JA 4OYCA 4JI4C 4YY3C 2QVYX 1N34C 1RG9A 1HH2P 2P2BA 4L2ZA 1EGAA 4LF4C 2ASBA 2D1TA 2E8FA 2UXBC 4JI0C 2DYJA 2CY1A 3PROC 3R9XA 2UU9C 1ZB8A 3DLPX 2OPLA 3LAXA 2OBVA 4L4QA 1HNWC 2OPLB 3IPLA 1XRAA 2XR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 C;  2UXD C;  1USP B;  4NXM C;  4DR3 C;  3J7A D;  1XNR C;  5IT9 D;  3I07 A;  1UKK A;  4NOZ A;  2VQE C;  4B3R C;  4GKK C;  1XMO C;  5IWA C;  2PT7 G;  4LFA C;  1IBM C;  4DV2 C;  4DR5 C;  1FJG C;  1MKY A;  3J80 D;  2D7V A;  4AQY C;  1KKG A;  4JI3 C;  2ZM6 C;  4JI1 C;  4X66 C;  5A2Q D;  1N33 C;  4LFB C;  4X65 C;  1XMQ C;  1HNZ C;  3R9W A;  4DV6 C;  1JOS A;  4LF6 C;  5LMU C;  1I94 C;  2F4V C;  4X62 C;  2E7G A;  4JI6 C;  4YHH C;  1L2F A;  2UUA C;  4MTN A;  2VQF C;  2E5L C;  4DCS A;  4DUZ C;  4DV4 C;  4LF7 C;  4DCU A;  4B3S C;  1N2F A;  4X64 C;  2KZF A;  2PN2 A;  4DCV A;  2E8E A;  4DR6 C;  1WH9 A;  1NYE A;  5FLX D;  1J5E C;  4K0K C;  1PA4 A;  4DCT A;  5BR8 C;  2UXC C;  3CJE A;  3J81 D;  3LUS A;  4DV0 C;  1IBK C;  2YCB A;  4DV5 C;  4JV5 C;  1QWI A;  1VLA A;  3T1H C;  4JI7 C;  1XNQ C;  4MH4 A;  4JI5 C;  4DV7 C;  3T1Y C;  4NXN C;  2UUB C;  2ATW A;  4DUY C;  4BSZ A;  2JMP A;  4DR7 C;  2HJG A;  2ONF A;  3AF5 A;  4DV1 C;  1IBL C;  2UUC C;  4DR4 C;  2E8C A;  1ZB9 A;  2CXC A;  2EGT A;  3EER A;  4JI4 C;  3OTO C;  1USP A;  4YY3 C;  4OX9 C;  1ML8 A;  3GKU A;  1N34 C;  1LQL A;  3IEU A;  1K0R A;  1HH2 P;  1EGA A;  4LF9 C;  4LF4 C;  4B3M C;  2QL8 A;  5LMN C;  2ASB A;  3IEV A;  2HHH C;  2E8F A;  2UXB C;  4XX2 A;  3AF6 A;  4KHP C;  4JI0 C;  4GKJ C;  4JI2 C;  4JYA C;  1HNX C;  4LFC C;  2DYJ A;  2CY1 A;  3R9X A;  4DR1 C;  2UU9 C;  4B3T C;  1HR0 C;  1ZB8 A;  4LF8 C;  2OPL A;  4DV3 C;  4LF5 C;  1N32 C;  3JAM D;  1HNW C;  4DR2 C;  1WF3 A;  2OPL B;  2BJO A;  1N36 C;  2XR1 A; 
#chains in the Genus database with same CATH topology
 1V25 A;  4NXM C;  4DR3 C;  2ZZM A;  1TH5 A;  5IT9 D;  2VQE C;  4DG9 A;  4L7I A;  5BSM A;  3TDE A;  1PG3 A;  4WS9 A;  2D7V A;  4AQY C;  2ZM6 C;  2P2F A;  4JI1 C;  2YWB A;  4X65 C;  1XMQ C;  1RY2 A;  2NCL A;  4BBY A;  4ZLP A;  4K0B A;  2QW0 X;  5KYV A;  1I94 C;  2E7G A;  4RM2 A;  5A1I A;  4DUZ C;  4LF7 C;  3N2Q A;  4GXQ A;  3NPD A;  2MCQ A;  5AE2 A;  4DR6 C;  2MMA B;  4K0K C;  4R1M A;  4DG8 A;  4PUG A;  3CJE A;  3TQI A;  2E0G A;  5T8T A;  4RVN A;  5ADZ A;  4JV5 C;  1QWI A;  4JI7 C;  1XNQ C;  2YX1 A;  5BST A;  5BSV A;  2DHM A;  1YJ7 A;  3T1Y C;  1O92 A;  3FCC A;  3E7W A;  3UZ0 A;  4DUY C;  2JMP A;  2PRO A;  1FLO A;  2HJG A;  3RG2 A;  2UUC C;  4DR4 C;  3VNQ A;  2E8C A;  2CXC A;  3EER A;  3A9U A;  4I9F A;  3OTO C;  1USP A;  3IEU A;  5T8S A;  5BUR A;  3LNV A;  1GPM A;  3RV2 A;  1BA3 A;  4B3M C;  2QL8 A;  2D1S A;  1MDB A;  4RLQ A;  4BC9 A;  1HNX C;  5E7Q A;  3G7S A;  1FUG A;  2Z51 A;  2D28 C;  5BSU A;  3NYR A;  2M5H A;  5LCI A;  3E7X A;  2BJO A;  4PUI A;  1N36 C;  4JI8 C;  4TPS B;  3DAY A;  1XNR C;  1UKK A;  2KDN A;  4GKK C;  1YGT A;  5H9U A;  3AY0 A;  3H2T A;  3TUF A;  3A25 A;  1IBM C;  4DR5 C;  1MKY A;  3VNR A;  4ZJZ A;  3J80 D;  5BSW A;  5A1G A;  5BSR A;  4X66 C;  5A2Q D;  1XRB A;  1XS3 A;  4FTF A;  1N33 C;  3R9W A;  4NDN A;  5KYT A;  1UWD A;  2QVX X;  4BC7 A;  2D1Q A;  2F4V C;  4YHH C;  1L2F A;  5BUQ A;  5K8F A;  2P2Q A;  4X64 C;  2M5O A;  5IFI A;  1J5E C;  5BR8 C;  1MXC A;  1V26 A;  4JM1 A;  2UXC C;  3J81 D;  3B7W A;  3LNO A;  2KZ0 A;  3LUS A;  4IR7 A;  3C5E A;  4G1I A;  3IML A;  4PUH A;  3L95 X;  2V7B A;  4NXN C;  3ETC A;  1WCJ A;  3CQ1 A;  2ONF A;  5CZV A;  1IBL C;  1MXA A;  3UX3 A;  2EGT A;  1IB8 A;  1LQL A;  1AMU A;  1MDF A;  4LF9 C;  5GTD A;  4RVO A;  3IEV A;  1NY8 A;  4KHP C;  2ZTB A;  4FUT A;  4JYA C;  4D57 A;  4LFC C;  4GS5 A;  4DR1 C;  4KTT A;  4B3T C;  4PHT A;  3ETO A;  3CW9 A;  3JAM D;  2VSQ A;  1WF3 A;  4R0M A;  1QM4 A;  2UXD C;  1USP B;  2CU6 A;  3J7A D;  3L8C A;  3PES A;  3I07 A;  3A4I A;  4NOZ A;  4WV3 A;  3CQ3 A;  1O90 A;  4ISB A;  5IWA C;  2PT7 G;  4LFA C;  4R1L A;  3O2E A;  1FJG C;  1XDX A;  1LCI A;  2WD9 A;  4RM3 A;  5JRH A;  4LE5 A;  1MXB A;  3A26 A;  5AE1 A;  2MM9 A;  1KKG A;  4JI3 C;  4PRO C;  2JNV A;  4LFB C;  3NYQ A;  5K85 A;  4LF6 C;  5LMU C;  2UUA C;  2P2M A;  4MTN A;  2QVZ X;  4I9G A;  4DCS A;  4DV4 C;  4DCU A;  4B3S C;  2KZF A;  1M6X C;  2PN2 A;  4DCV A;  3KXW A;  1WH9 A;  5FLX D;  1PA4 A;  4DCT A;  1O93 A;  4IZ6 A;  1XHJ A;  4HPV A;  4RLF A;  3LGX A;  4FUQ A;  4BCA A;  5BUS A;  4DV5 C;  5CZX A;  1P4E C;  3FM7 A;  3GPC A;  3UEB A;  4JI5 C;  4G37 A;  2UUB C;  2ATW A;  2YWC A;  3S82 A;  4GXR A;  4DR7 C;  3AF5 A;  1ULT A;  4DV1 C;  3UOW A;  1ZB9 A;  4U5Y D;  4OX9 C;  1ML8 A;  3GKU A;  4KTV A;  1K0R A;  2BH1 X;  5LMN C;  2P02 A;  2HHH C;  4XX2 A;  3AF6 A;  5A19 A;  3GR1 A;  3K6R A;  4GKJ C;  4JI2 C;  3UX2 A;  1HR0 C;  4LF8 C;  2PG1 E;  3EQ6 A;  4DV3 C;  4LF5 C;  4D4G A;  1N32 C;  4DR2 C;  1XRC A;  2DPL A;  4PZP A;  2D1R A;  4RMN A;  4B3R C;  2Y4O A;  1XMO C;  3CQ2 A;  3I08 A;  2D27 A;  4ODJ A;  4DV2 C;  2Y27 A;  5AE3 A;  3NI2 A;  3DHV A;  1PG4 A;  4OXI A;  1T5D X;  3VNS A;  1HNZ C;  4DV6 C;  5KEI A;  3CW8 X;  1JOS A;  1T5H X;  3SO4 A;  4X62 C;  4JI6 C;  5DV9 A;  2VQF C;  3A9V A;  2E5L C;  4G36 A;  1N2F A;  2P20 A;  3PBK A;  2E8E A;  1NYE A;  2AYA A;  2Y4N A;  3FCE A;  3N54 B;  2OO4 A;  2WP0 C;  4EAT A;  1MD9 A;  4DV0 C;  1IBK C;  2YCB A;  4D4I A;  2VZE A;  3GR0 A;  1O9T A;  1VLA A;  3T1H C;  2ZZN A;  4MH4 A;  4DV7 C;  1VEH A;  4BSZ A;  1P7L A;  3R44 A;  4D56 A;  2P2J A;  4OYC A;  4JI4 C;  4YY3 C;  2QVY X;  1N34 C;  1PU1 A;  1M6X A;  1RG9 A;  1HH2 P;  2P2B A;  4L2Z A;  1EGA A;  4LF4 C;  2ASB A;  2D1T A;  2E8F A;  2UXB C;  4JI0 C;  3TR3 A;  2DYJ A;  2CY1 A;  3PRO C;  3R9X A;  1V60 A;  2UU9 C;  1P4E A;  1ZB8 A;  3DLP X;  2OPL A;  3LAX A;  2OBV A;  4L4Q A;  1HNW C;  2OPL B;  3IPL A;  1XRA A;  2XR1 A; 
#chains in the Genus database with same CATH homology
 1V25 A;  4NXM C;  4DR3 C;  5IT9 D;  2VQE C;  4DG9 A;  4L7I A;  5BSM A;  3TDE A;  1PG3 A;  4WS9 A;  2D7V A;  4AQY C;  2ZM6 C;  2P2F A;  4JI1 C;  2YWB A;  4X65 C;  1XMQ C;  1RY2 A;  4BBY A;  4ZLP A;  4K0B A;  2QW0 X;  5KYV A;  1I94 C;  2E7G A;  4RM2 A;  5A1I A;  4DUZ C;  4LF7 C;  3N2Q A;  4GXQ A;  3NPD A;  5AE2 A;  4DR6 C;  4K0K C;  4R1M A;  4DG8 A;  3CJE A;  3TQI A;  2E0G A;  5T8T A;  4RVN A;  5ADZ A;  4JV5 C;  1QWI A;  4JI7 C;  1XNQ C;  5BST A;  5BSV A;  1YJ7 A;  3T1Y C;  1O92 A;  3FCC A;  3E7W A;  3UZ0 A;  4DUY C;  2JMP A;  2PRO A;  2HJG A;  3RG2 A;  2UUC C;  4DR4 C;  3VNQ A;  2E8C A;  2CXC A;  3EER A;  3A9U A;  4I9F A;  3OTO C;  1USP A;  3IEU A;  5T8S A;  5BUR A;  3LNV A;  1GPM A;  3RV2 A;  1BA3 A;  4B3M C;  2QL8 A;  2D1S A;  1MDB A;  4RLQ A;  4BC9 A;  1HNX C;  5E7Q A;  3G7S A;  1FUG A;  2D28 C;  5BSU A;  3NYR A;  3E7X A;  2BJO A;  1N36 C;  4JI8 C;  4TPS B;  3DAY A;  1XNR C;  1UKK A;  4GKK C;  5H9U A;  3H2T A;  3TUF A;  1IBM C;  4DR5 C;  1MKY A;  3VNR A;  4ZJZ A;  3J80 D;  5BSW A;  5A1G A;  5BSR A;  4X66 C;  5A2Q D;  1XRB A;  4FTF A;  1N33 C;  3R9W A;  4NDN A;  5KYT A;  2QVX X;  4BC7 A;  2D1Q A;  2F4V C;  4YHH C;  1L2F A;  5BUQ A;  5K8F A;  2P2Q A;  4X64 C;  5IFI A;  1J5E C;  5BR8 C;  1MXC A;  1V26 A;  4JM1 A;  2UXC C;  3J81 D;  3B7W A;  3LUS A;  4IR7 A;  3C5E A;  4G1I A;  3IML A;  3L95 X;  2V7B A;  4NXN C;  3ETC A;  2ONF A;  5CZV A;  1IBL C;  1MXA A;  2EGT A;  1LQL A;  1AMU A;  1MDF A;  4LF9 C;  5GTD A;  4RVO A;  3IEV A;  4KHP C;  4FUT A;  4JYA C;  4D57 A;  4LFC C;  4GS5 A;  4DR1 C;  4KTT A;  4B3T C;  4PHT A;  3ETO A;  3CW9 A;  3JAM D;  2VSQ A;  1WF3 A;  4R0M A;  1QM4 A;  2UXD C;  1USP B;  3J7A D;  3L8C A;  3PES A;  3I07 A;  3A4I A;  4NOZ A;  4WV3 A;  1O90 A;  4ISB A;  5IWA C;  2PT7 G;  4LFA C;  4R1L A;  1FJG C;  1LCI A;  2WD9 A;  4RM3 A;  5JRH A;  4LE5 A;  1MXB A;  5AE1 A;  1KKG A;  4JI3 C;  4PRO C;  4LFB C;  3NYQ A;  5K85 A;  4LF6 C;  5LMU C;  2UUA C;  2P2M A;  4MTN A;  2QVZ X;  4I9G A;  4DCS A;  4DV4 C;  4DCU A;  4B3S C;  2KZF A;  2PN2 A;  4DCV A;  3KXW A;  1WH9 A;  5FLX D;  1PA4 A;  4DCT A;  1O93 A;  4IZ6 A;  4HPV A;  4RLF A;  3LGX A;  4FUQ A;  4BCA A;  5BUS A;  4DV5 C;  5CZX A;  3GPC A;  4JI5 C;  4G37 A;  2UUB C;  2ATW A;  2YWC A;  3S82 A;  4GXR A;  4DR7 C;  3AF5 A;  1ULT A;  4DV1 C;  3UOW A;  1ZB9 A;  4U5Y D;  4OX9 C;  1ML8 A;  3GKU A;  4KTV A;  1K0R A;  2BH1 X;  5LMN C;  2P02 A;  2HHH C;  4XX2 A;  3AF6 A;  5A19 A;  3GR1 A;  4GKJ C;  4JI2 C;  1HR0 C;  4LF8 C;  3EQ6 A;  4DV3 C;  4LF5 C;  4D4G A;  1N32 C;  4DR2 C;  1XRC A;  2DPL A;  4PZP A;  2D1R A;  4RMN A;  4B3R C;  2Y4O A;  1XMO C;  3I08 A;  2D27 A;  4ODJ A;  4DV2 C;  2Y27 A;  5AE3 A;  3NI2 A;  3DHV A;  1PG4 A;  4OXI A;  1T5D X;  3VNS A;  1HNZ C;  4DV6 C;  5KEI A;  3CW8 X;  1JOS A;  1T5H X;  3SO4 A;  4X62 C;  4JI6 C;  5DV9 A;  2VQF C;  3A9V A;  2E5L C;  4G36 A;  1N2F A;  2P20 A;  3PBK A;  2E8E A;  1NYE A;  2AYA A;  2Y4N A;  3FCE A;  3N54 B;  2OO4 A;  2WP0 C;  4EAT A;  1MD9 A;  4DV0 C;  1IBK C;  2YCB A;  4D4I A;  2VZE A;  3GR0 A;  1O9T A;  1VLA A;  3T1H C;  4MH4 A;  4DV7 C;  4BSZ A;  1P7L A;  3R44 A;  4D56 A;  2P2J A;  4OYC A;  4JI4 C;  4YY3 C;  2QVY X;  1N34 C;  1RG9 A;  1HH2 P;  2P2B A;  4L2Z A;  1EGA A;  4LF4 C;  2ASB A;  2D1T A;  2E8F A;  2UXB C;  4JI0 C;  2DYJ A;  2CY1 A;  3PRO C;  3R9X A;  2UU9 C;  1ZB8 A;  3DLP X;  2OPL A;  3LAX A;  2OBV A;  4L4Q A;  1HNW C;  2OPL B;  3IPL A;  1XRA A;  2XR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...