4B3TC

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4b3tC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4b3tC02
2XR1A 4DCVA 4LF6C 1ML8A 1USPA 4DV0C 1N34C 4KHPC 4AQYC 2PN2A 5IWAC 1WF3A 4DV6C 1IBMC 4OX9C 1L2FA 2UU9C 4JYAC 1XMQC 2ATWA 4MH4A 3IEVA 1PA4A 4DR2C 1N32C 5FLXD 4B3TC 4K0KC 2JMPA 4DUYC 2OPLB 2E8EA 4X64C 4DCTA 2OPLA 2UXBC 4DR3C 2E8FA 1VLAA 2UUBC 2UUCC 4DV1C 4JI7C 1NYEA 1XNRC 2EGTA 2E8CA 4YHHC 5LMUC 5IT9D 3J80D 4MTNA 4DV2C 1JOSA 1HNZC 1KKGA 3OTOC 4DCSA 1N2FA 3I07A 4DCUA 2VQFC 4DV4C 1XMOC 4YY3C 2ZM6C 4LF7C 4LF5C 4JI1C 3LUSA 3GKUA 1QWIA 1FJGC 4JI4C 2ASBA 2UUAC 2UXDC 2PT7G 2QL8A 3R9WA 4JI0C 3CJEA 4DUZC 1HNXC 4LF8C 2D7VA 4DR4C 4BSZA 3J81D 1N33C 4XX2A 2E5LC 3AF6A 4B3SC 4B3MC 4LFCC 3R9XA 3J7AD 4JI8C 4DR7C 5BR8C 4X65C 2BJOA 2F4VC 1J5EC 2ONFA 4DV5C 1HR0C 4JI6C 4LF9C 4JI2C 2UXCC 4LFAC 1MKYA 3AF5A 4X66C 4NXNC 1HH2P 4JI5C 4X62C 1ZB9A 4DR5C 1USPB 1IBLC 4GKKC 1UKKA 3IEUA 4NXMC 2CXCA 2E7GA 3T1HC 1EGAA 4B3RC 5A2QD 4DV7C 4GKJC 1WH9A 2YCBA 1HNWC 3T1YC 1N36C 4NOZA 1LQLA 4JV5C 2DYJA 2HHHC 1K0RA 3EERA 3JAMD 1IBKC 4DR6C 4DV3C 1I94C 4LFBC 1XNQC 5LMNC 2KZFA 1ZB8A 2VQEC 2CY1A 4DR1C 2HJGA 4JI3C 4LF4C
chains in the Genus database with same CATH superfamily
4LF6C 1O93A 1ML8A 1USPA 1N34C 2D1QA 2D1SA 2PN2A 2P2MA 4ISBA 4RVOA 1IBMC 5JRHA 4MH4A 5BURA 4DR2C 1IB8A 3UOWA 2JMPA 1RG9A 2ZTBA 4X64C 2D1RA 4DR3C 1VLAA 2UUCC 4RLQA 2Y27A 1WCJA 2Y4OA 1NYEA 3IMLA 2EGTA 4PROC 4ZLPA 5LMUC 5IT9D 3A25A 3RV2A 4I9FA 3DAYA 1RY2A 4L4QA 2VQFC 2ZM6C 1P7LA 4GXRA 1QWIA 5BSTA 3GPCA 4JI4C 5GTDA 2UUAC 2UXDC 1FUGA 1XRCA 4U5YD 4DR4C 1V26A 4XX2A 3TR3A 5BSRA 2E5LC 4PUHA 4L2ZA 4FUQA 3TUFA 5IFIA 5AE3A 4KTVA 2KDNA 3L95X 1MKYA 4X66C 4NXNC 5AE1A 5BSUA 3CQ3A 3H2TA 3T1HC 3R44A 5A2QD 4DG8A 4DV7C 1MXCA 3S82A 4G36A 4IR7A 1LQLA 4R0MA 4JV5C 3UZ0A 1M6XA 1UWDA 5T8SA 1AMUA 4OYCA 1I94C 1XNQC 4I9GA 2VQEC 4KHPC 4AQYC 3SO4A 3DHVA 5T8TA 4OX9C 3LNOA 2D1TA 1PA4A 1N32C 1MXBA 3N2QA 2E0GA 4GXQA 4R1LA 4D4GA 2E8EA 2OPLA 2UXBC 5BSMA 2DPLA 2VZEA 4PZPA 4WS9A 2DHMA 5K85A 4YHHC 4ZJZA 2P2FA 4FUTA 4DV2C 1JOSA 2ZZNA 2MCQA 2QVZX 3I07A 1PG4A 1XMOC 4YY3C 4BCAA 4L7IA 2V7BA 4JI1C 4BBYA 2PG1E 5BUSA 1MDBA 2QL8A 4JI0C 4PUGA 4LF8C 3FM7A 1YJ7A 4B3MC 4RM2A 3R9XA 1GPMA 3ETCA 1FLOA 1LCIA 2P2JA 4DR7C 2ONFA 3LGXA 1HR0C 4PHTA 4JI6C 4LF9C 4JI2C 4KTTA 5KEIA 3AF5A 2P2BA 1XS3A 5BUQA 4DR5C 1UKKA 3IEUA 5CZXA 4LE5A 4NXMC 2E7GA 3RG2A 2OO4A 4ODJA 3A9UA 2MMAB 2YWCA 1P4EA 3T1YC 1N36C 2ZZMA 3VNSA 2HHHC 2BH1X 2YWBA 3CQ2A 3EERA 1IBKC 4BC9A 4RMNA 3NPDA 3UEBA 3LAXA 2XR1A 4DV0C 2NCLA 5IWAC 1WF3A 5A1IA 2QVYX 4D57A 3G7SA 4G1IA 2UU9C 4JYAC 4FTFA 1XRBA 1P4EC 3FCCA 1MDFA 2WP0C 4B3TC 3EQ6A 2P20A 4HPVA 4K0KC 4R1MA 5LCIA 2OPLB 4DCTA 2E8FA 2UUBC 2AYAA 4JI7C 2E8CA 3VNRA 3J80D 2YX1A 1HNZC 2Y4NA 4DCSA 3A4IA 3VNQA 4LF5C 5A1GA 3LUSA 3GKUA 3K6RA 1FJGC 3LNVA 3TDEA 2PT7G 3CJEA 4DUZC 1HNXC 2D7VA 1N33C 2OBVA 3J81D 2VSQA 3AF6A 4RLFA 3J7AD 4GS5A 4JI8C 5BR8C 4X65C 3O2EA 5DV9A 4EATA 2D28C 1MD9A 3L8CA 5AE2A 4DV5C 3A9VA 5KYVA 2UXCC 1HH2P 4JI5C 4RM3A 1ZB9A 3I08A 5BSWA 4GKKC 4D4IA 4D56A 3PBKA 2YCBA 1HNWC 4NOZA 4RVNA 4DR6C 4DG9A 1PG3A 4DV3C 3DLPX 3PESA 2D27A 4DR1C 2HJGA 4DCVA 1MXAA 1VEHA 3B7WA 3FCEA 4G37A 1O9TA 2CU6A 5KYTA 1NY8A 4DV6C 1L2FA 2PROA 5E7QA 4IZ6A 2M5OA 1O92A 1XMQC 2ATWA 2MM9A 3IEVA 3PROC 1V60A 5FLXD 1M6XC 4TPSB 4DUYC 4NDNA 3CW8X 1YGTA 4WV3A 1XDXA 4DV1C 3CQ1A 1XNRC 3C5EA 4MTNA 1QM4A 2WD9A 1KKGA 3OTOC 1N2FA 3E7WA 4DCUA 4DV4C 5BSVA 4LF7C 3NYQA 1PU1A 5K8FA 2QVXX 2ASBA 3R9WA 2M5HA 3UX3A 2QW0X 3N54B 4JM1A 4BSZA 4B3SC 4LFCC 4OXIA 1TH5A 3TQIA 2BJOA 3KXWA 2F4VC 1J5EC 3NI2A 5CZVA 1T5HX 3AY0A 4LFAC 1O90A 1XHJA 4K0BA 3IPLA 3ETOA 4X62C 1IBLC 1USPB 3GR1A 2KZ0A 5H9UA 2CXCA 1T5DX 1EGAA 4PUIA 2JNVA 4B3RC 2P02A 2P2QA 1XRAA 3GR0A 4BC7A 3E7XA 4GKJC 1WH9A 2Z51A 3NYRA 1ULTA 1BA3A 2DYJA 1K0RA 3CW9A 3JAMD 5A19A 1V25A 4LFBC 5LMNC 3UX2A 3A26A 2KZFA 1ZB8A 2CY1A 5ADZA 4JI3C 4LF4C
chains in the Genus database with same CATH topology
4LF6C 1O93A 1ML8A 1USPA 1N34C 2D1QA 2D1SA 2PN2A 2P2MA 4ISBA 4RVOA 1IBMC 5JRHA 4MH4A 5BURA 4DR2C 3UOWA 2JMPA 1RG9A 4X64C 2D1RA 4DR3C 1VLAA 2UUCC 4RLQA 2Y27A 2Y4OA 1NYEA 3IMLA 2EGTA 4PROC 4ZLPA 5LMUC 5IT9D 3RV2A 4I9FA 3DAYA 1RY2A 4L4QA 2VQFC 2ZM6C 1P7LA 4GXRA 1QWIA 5BSTA 3GPCA 4JI4C 5GTDA 2UUAC 2UXDC 1FUGA 1XRCA 4U5YD 4DR4C 1V26A 4XX2A 2E5LC 5BSRA 4L2ZA 4FUQA 3TUFA 5IFIA 5AE3A 4KTVA 3L95X 1MKYA 4X66C 4NXNC 5AE1A 5BSUA 3H2TA 3T1HC 3R44A 5A2QD 4DG8A 4DV7C 1MXCA 3S82A 4G36A 4IR7A 1LQLA 4R0MA 4JV5C 3UZ0A 5T8SA 1AMUA 4OYCA 1I94C 1XNQC 4I9GA 2VQEC 4KHPC 4AQYC 3SO4A 3DHVA 5T8TA 4OX9C 2D1TA 1PA4A 1N32C 1MXBA 3N2QA 2E0GA 4GXQA 4R1LA 4D4GA 2E8EA 2OPLA 2UXBC 5BSMA 2DPLA 2VZEA 4PZPA 4WS9A 5K85A 4YHHC 4ZJZA 2P2FA 4FUTA 4DV2C 1JOSA 2QVZX 3I07A 1PG4A 1XMOC 4YY3C 4BCAA 4L7IA 2V7BA 4JI1C 4BBYA 5BUSA 1MDBA 2QL8A 4JI0C 4LF8C 1YJ7A 4B3MC 4RM2A 3R9XA 1GPMA 3ETCA 1LCIA 2P2JA 4DR7C 2ONFA 3LGXA 1HR0C 4PHTA 4JI6C 4LF9C 4JI2C 4KTTA 5KEIA 3AF5A 2P2BA 5BUQA 4DR5C 1UKKA 3IEUA 5CZXA 4LE5A 4NXMC 2E7GA 3RG2A 2OO4A 4ODJA 3A9UA 2YWCA 3T1YC 1N36C 3VNSA 2HHHC 2BH1X 2YWBA 3EERA 1IBKC 4BC9A 4RMNA 3NPDA 3LAXA 2XR1A 4DV0C 5IWAC 1WF3A 5A1IA 2QVYX 4D57A 3G7SA 4G1IA 2UU9C 4JYAC 4FTFA 1XRBA 3FCCA 1MDFA 2WP0C 4B3TC 3EQ6A 2P20A 4HPVA 4K0KC 4R1MA 2OPLB 4DCTA 2E8FA 2UUBC 2AYAA 4JI7C 2E8CA 3VNRA 3J80D 1HNZC 2Y4NA 4DCSA 3A4IA 3VNQA 4LF5C 5A1GA 3LUSA 3GKUA 1FJGC 3LNVA 3TDEA 2PT7G 3CJEA 4DUZC 1HNXC 2D7VA 1N33C 2OBVA 3J81D 2VSQA 3AF6A 4RLFA 3J7AD 4GS5A 4JI8C 5BR8C 4X65C 5DV9A 4EATA 2D28C 1MD9A 3L8CA 5AE2A 4DV5C 3A9VA 5KYVA 2UXCC 1HH2P 4JI5C 4RM3A 1ZB9A 3I08A 5BSWA 4GKKC 4D4IA 4D56A 3PBKA 2YCBA 1HNWC 4NOZA 4RVNA 4DR6C 4DG9A 1PG3A 4DV3C 3DLPX 3PESA 2D27A 4DR1C 2HJGA 4DCVA 1MXAA 3B7WA 3FCEA 4G37A 1O9TA 5KYTA 4DV6C 1L2FA 2PROA 5E7QA 4IZ6A 1O92A 1XMQC 2ATWA 3IEVA 3PROC 5FLXD 4TPSB 4DUYC 4NDNA 3CW8X 4WV3A 4DV1C 1XNRC 3C5EA 4MTNA 1QM4A 2WD9A 1KKGA 3OTOC 1N2FA 3E7WA 4DCUA 4DV4C 5BSVA 4LF7C 3NYQA 5K8FA 2QVXX 2ASBA 3R9WA 2QW0X 3N54B 4JM1A 4BSZA 4B3SC 4LFCC 4OXIA 3TQIA 2BJOA 3KXWA 2F4VC 1J5EC 3NI2A 5CZVA 1T5HX 4LFAC 1O90A 4K0BA 3IPLA 3ETOA 4X62C 1IBLC 1USPB 3GR1A 5H9UA 2CXCA 1T5DX 1EGAA 4B3RC 2P02A 2P2QA 1XRAA 3GR0A 4BC7A 3E7XA 4GKJC 1WH9A 3NYRA 1ULTA 1BA3A 2DYJA 1K0RA 3CW9A 3JAMD 5A19A 1V25A 4LFBC 5LMNC 2KZFA 1ZB8A 2CY1A 5ADZA 4JI3C 4LF4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XR1 A;  4DCV A;  4LF6 C;  1ML8 A;  1USP A;  4DV0 C;  1N34 C;  4KHP C;  4AQY C;  2PN2 A;  5IWA C;  1WF3 A;  4DV6 C;  1IBM C;  4OX9 C;  1L2F A;  2UU9 C;  4JYA C;  1XMQ C;  2ATW A;  4MH4 A;  3IEV A;  1PA4 A;  4DR2 C;  1N32 C;  5FLX D;  4B3T C;  4K0K C;  2JMP A;  4DUY C;  2OPL B;  2E8E A;  4X64 C;  4DCT A;  2OPL A;  2UXB C;  4DR3 C;  2E8F A;  1VLA A;  2UUB C;  2UUC C;  4DV1 C;  4JI7 C;  1NYE A;  1XNR C;  2EGT A;  2E8C A;  4YHH C;  5LMU C;  5IT9 D;  3J80 D;  4MTN A;  4DV2 C;  1JOS A;  1HNZ C;  1KKG A;  3OTO C;  4DCS A;  1N2F A;  3I07 A;  4DCU A;  2VQF C;  4DV4 C;  1XMO C;  4YY3 C;  2ZM6 C;  4LF7 C;  4LF5 C;  4JI1 C;  3LUS A;  3GKU A;  1QWI A;  1FJG C;  4JI4 C;  2ASB A;  2UUA C;  2UXD C;  2PT7 G;  2QL8 A;  3R9W A;  4JI0 C;  3CJE A;  4DUZ C;  1HNX C;  4LF8 C;  2D7V A;  4DR4 C;  4BSZ A;  3J81 D;  1N33 C;  4XX2 A;  2E5L C;  3AF6 A;  4B3S C;  4B3M C;  4LFC C;  3R9X A;  3J7A D;  4JI8 C;  4DR7 C;  5BR8 C;  4X65 C;  2BJO A;  2F4V C;  1J5E C;  2ONF A;  4DV5 C;  1HR0 C;  4JI6 C;  4LF9 C;  4JI2 C;  2UXC C;  4LFA C;  1MKY A;  3AF5 A;  4X66 C;  4NXN C;  1HH2 P;  4JI5 C;  4X62 C;  1ZB9 A;  4DR5 C;  1USP B;  1IBL C;  4GKK C;  1UKK A;  3IEU A;  4NXM C;  2CXC A;  2E7G A;  3T1H C;  1EGA A;  4B3R C;  5A2Q D;  4DV7 C;  4GKJ C;  1WH9 A;  2YCB A;  1HNW C;  3T1Y C;  1N36 C;  4NOZ A;  1LQL A;  4JV5 C;  2DYJ A;  2HHH C;  1K0R A;  3EER A;  3JAM D;  1IBK C;  4DR6 C;  4DV3 C;  1I94 C;  4LFB C;  1XNQ C;  5LMN C;  2KZF A;  1ZB8 A;  2VQE C;  2CY1 A;  4DR1 C;  2HJG A;  4JI3 C;  4LF4 C; 
#chains in the Genus database with same CATH topology
 4LF6 C;  1O93 A;  1ML8 A;  1USP A;  1N34 C;  2D1Q A;  2D1S A;  2PN2 A;  2P2M A;  4ISB A;  4RVO A;  1IBM C;  5JRH A;  4MH4 A;  5BUR A;  4DR2 C;  1IB8 A;  3UOW A;  2JMP A;  1RG9 A;  2ZTB A;  4X64 C;  2D1R A;  4DR3 C;  1VLA A;  2UUC C;  4RLQ A;  2Y27 A;  1WCJ A;  2Y4O A;  1NYE A;  3IML A;  2EGT A;  4PRO C;  4ZLP A;  5LMU C;  5IT9 D;  3A25 A;  3RV2 A;  4I9F A;  3DAY A;  1RY2 A;  4L4Q A;  2VQF C;  2ZM6 C;  1P7L A;  4GXR A;  1QWI A;  5BST A;  3GPC A;  4JI4 C;  5GTD A;  2UUA C;  2UXD C;  1FUG A;  1XRC A;  4U5Y D;  4DR4 C;  1V26 A;  4XX2 A;  3TR3 A;  5BSR A;  2E5L C;  4PUH A;  4L2Z A;  4FUQ A;  3TUF A;  5IFI A;  5AE3 A;  4KTV A;  2KDN A;  3L95 X;  1MKY A;  4X66 C;  4NXN C;  5AE1 A;  5BSU A;  3CQ3 A;  3H2T A;  3T1H C;  3R44 A;  5A2Q D;  4DG8 A;  4DV7 C;  1MXC A;  3S82 A;  4G36 A;  4IR7 A;  1LQL A;  4R0M A;  4JV5 C;  3UZ0 A;  1M6X A;  1UWD A;  5T8S A;  1AMU A;  4OYC A;  1I94 C;  1XNQ C;  4I9G A;  2VQE C;  4KHP C;  4AQY C;  3SO4 A;  3DHV A;  5T8T A;  4OX9 C;  3LNO A;  2D1T A;  1PA4 A;  1N32 C;  1MXB A;  3N2Q A;  2E0G A;  4GXQ A;  4R1L A;  4D4G A;  2E8E A;  2OPL A;  2UXB C;  5BSM A;  2DPL A;  2VZE A;  4PZP A;  4WS9 A;  2DHM A;  5K85 A;  4YHH C;  4ZJZ A;  2P2F A;  4FUT A;  4DV2 C;  1JOS A;  2ZZN A;  2MCQ A;  2QVZ X;  3I07 A;  1PG4 A;  1XMO C;  4YY3 C;  4BCA A;  4L7I A;  2V7B A;  4JI1 C;  4BBY A;  2PG1 E;  5BUS A;  1MDB A;  2QL8 A;  4JI0 C;  4PUG A;  4LF8 C;  3FM7 A;  1YJ7 A;  4B3M C;  4RM2 A;  3R9X A;  1GPM A;  3ETC A;  1FLO A;  1LCI A;  2P2J A;  4DR7 C;  2ONF A;  3LGX A;  1HR0 C;  4PHT A;  4JI6 C;  4LF9 C;  4JI2 C;  4KTT A;  5KEI A;  3AF5 A;  2P2B A;  1XS3 A;  5BUQ A;  4DR5 C;  1UKK A;  3IEU A;  5CZX A;  4LE5 A;  4NXM C;  2E7G A;  3RG2 A;  2OO4 A;  4ODJ A;  3A9U A;  2MMA B;  2YWC A;  1P4E A;  3T1Y C;  1N36 C;  2ZZM A;  3VNS A;  2HHH C;  2BH1 X;  2YWB A;  3CQ2 A;  3EER A;  1IBK C;  4BC9 A;  4RMN A;  3NPD A;  3UEB A;  3LAX A;  2XR1 A;  4DV0 C;  2NCL A;  5IWA C;  1WF3 A;  5A1I A;  2QVY X;  4D57 A;  3G7S A;  4G1I A;  2UU9 C;  4JYA C;  4FTF A;  1XRB A;  1P4E C;  3FCC A;  1MDF A;  2WP0 C;  4B3T C;  3EQ6 A;  2P20 A;  4HPV A;  4K0K C;  4R1M A;  5LCI A;  2OPL B;  4DCT A;  2E8F A;  2UUB C;  2AYA A;  4JI7 C;  2E8C A;  3VNR A;  3J80 D;  2YX1 A;  1HNZ C;  2Y4N A;  4DCS A;  3A4I A;  3VNQ A;  4LF5 C;  5A1G A;  3LUS A;  3GKU A;  3K6R A;  1FJG C;  3LNV A;  3TDE A;  2PT7 G;  3CJE A;  4DUZ C;  1HNX C;  2D7V A;  1N33 C;  2OBV A;  3J81 D;  2VSQ A;  3AF6 A;  4RLF A;  3J7A D;  4GS5 A;  4JI8 C;  5BR8 C;  4X65 C;  3O2E A;  5DV9 A;  4EAT A;  2D28 C;  1MD9 A;  3L8C A;  5AE2 A;  4DV5 C;  3A9V A;  5KYV A;  2UXC C;  1HH2 P;  4JI5 C;  4RM3 A;  1ZB9 A;  3I08 A;  5BSW A;  4GKK C;  4D4I A;  4D56 A;  3PBK A;  2YCB A;  1HNW C;  4NOZ A;  4RVN A;  4DR6 C;  4DG9 A;  1PG3 A;  4DV3 C;  3DLP X;  3PES A;  2D27 A;  4DR1 C;  2HJG A;  4DCV A;  1MXA A;  1VEH A;  3B7W A;  3FCE A;  4G37 A;  1O9T A;  2CU6 A;  5KYT A;  1NY8 A;  4DV6 C;  1L2F A;  2PRO A;  5E7Q A;  4IZ6 A;  2M5O A;  1O92 A;  1XMQ C;  2ATW A;  2MM9 A;  3IEV A;  3PRO C;  1V60 A;  5FLX D;  1M6X C;  4TPS B;  4DUY C;  4NDN A;  3CW8 X;  1YGT A;  4WV3 A;  1XDX A;  4DV1 C;  3CQ1 A;  1XNR C;  3C5E A;  4MTN A;  1QM4 A;  2WD9 A;  1KKG A;  3OTO C;  1N2F A;  3E7W A;  4DCU A;  4DV4 C;  5BSV A;  4LF7 C;  3NYQ A;  1PU1 A;  5K8F A;  2QVX X;  2ASB A;  3R9W A;  2M5H A;  3UX3 A;  2QW0 X;  3N54 B;  4JM1 A;  4BSZ A;  4B3S C;  4LFC C;  4OXI A;  1TH5 A;  3TQI A;  2BJO A;  3KXW A;  2F4V C;  1J5E C;  3NI2 A;  5CZV A;  1T5H X;  3AY0 A;  4LFA C;  1O90 A;  1XHJ A;  4K0B A;  3IPL A;  3ETO A;  4X62 C;  1IBL C;  1USP B;  3GR1 A;  2KZ0 A;  5H9U A;  2CXC A;  1T5D X;  1EGA A;  4PUI A;  2JNV A;  4B3R C;  2P02 A;  2P2Q A;  1XRA A;  3GR0 A;  4BC7 A;  3E7X A;  4GKJ C;  1WH9 A;  2Z51 A;  3NYR A;  1ULT A;  1BA3 A;  2DYJ A;  1K0R A;  3CW9 A;  3JAM D;  5A19 A;  1V25 A;  4LFB C;  5LMN C;  3UX2 A;  3A26 A;  2KZF A;  1ZB8 A;  2CY1 A;  5ADZ A;  4JI3 C;  4LF4 C; 
#chains in the Genus database with same CATH homology
 4LF6 C;  1O93 A;  1ML8 A;  1USP A;  1N34 C;  2D1Q A;  2D1S A;  2PN2 A;  2P2M A;  4ISB A;  4RVO A;  1IBM C;  5JRH A;  4MH4 A;  5BUR A;  4DR2 C;  3UOW A;  2JMP A;  1RG9 A;  4X64 C;  2D1R A;  4DR3 C;  1VLA A;  2UUC C;  4RLQ A;  2Y27 A;  2Y4O A;  1NYE A;  3IML A;  2EGT A;  4PRO C;  4ZLP A;  5LMU C;  5IT9 D;  3RV2 A;  4I9F A;  3DAY A;  1RY2 A;  4L4Q A;  2VQF C;  2ZM6 C;  1P7L A;  4GXR A;  1QWI A;  5BST A;  3GPC A;  4JI4 C;  5GTD A;  2UUA C;  2UXD C;  1FUG A;  1XRC A;  4U5Y D;  4DR4 C;  1V26 A;  4XX2 A;  2E5L C;  5BSR A;  4L2Z A;  4FUQ A;  3TUF A;  5IFI A;  5AE3 A;  4KTV A;  3L95 X;  1MKY A;  4X66 C;  4NXN C;  5AE1 A;  5BSU A;  3H2T A;  3T1H C;  3R44 A;  5A2Q D;  4DG8 A;  4DV7 C;  1MXC A;  3S82 A;  4G36 A;  4IR7 A;  1LQL A;  4R0M A;  4JV5 C;  3UZ0 A;  5T8S A;  1AMU A;  4OYC A;  1I94 C;  1XNQ C;  4I9G A;  2VQE C;  4KHP C;  4AQY C;  3SO4 A;  3DHV A;  5T8T A;  4OX9 C;  2D1T A;  1PA4 A;  1N32 C;  1MXB A;  3N2Q A;  2E0G A;  4GXQ A;  4R1L A;  4D4G A;  2E8E A;  2OPL A;  2UXB C;  5BSM A;  2DPL A;  2VZE A;  4PZP A;  4WS9 A;  5K85 A;  4YHH C;  4ZJZ A;  2P2F A;  4FUT A;  4DV2 C;  1JOS A;  2QVZ X;  3I07 A;  1PG4 A;  1XMO C;  4YY3 C;  4BCA A;  4L7I A;  2V7B A;  4JI1 C;  4BBY A;  5BUS A;  1MDB A;  2QL8 A;  4JI0 C;  4LF8 C;  1YJ7 A;  4B3M C;  4RM2 A;  3R9X A;  1GPM A;  3ETC A;  1LCI A;  2P2J A;  4DR7 C;  2ONF A;  3LGX A;  1HR0 C;  4PHT A;  4JI6 C;  4LF9 C;  4JI2 C;  4KTT A;  5KEI A;  3AF5 A;  2P2B A;  5BUQ A;  4DR5 C;  1UKK A;  3IEU A;  5CZX A;  4LE5 A;  4NXM C;  2E7G A;  3RG2 A;  2OO4 A;  4ODJ A;  3A9U A;  2YWC A;  3T1Y C;  1N36 C;  3VNS A;  2HHH C;  2BH1 X;  2YWB A;  3EER A;  1IBK C;  4BC9 A;  4RMN A;  3NPD A;  3LAX A;  2XR1 A;  4DV0 C;  5IWA C;  1WF3 A;  5A1I A;  2QVY X;  4D57 A;  3G7S A;  4G1I A;  2UU9 C;  4JYA C;  4FTF A;  1XRB A;  3FCC A;  1MDF A;  2WP0 C;  4B3T C;  3EQ6 A;  2P20 A;  4HPV A;  4K0K C;  4R1M A;  2OPL B;  4DCT A;  2E8F A;  2UUB C;  2AYA A;  4JI7 C;  2E8C A;  3VNR A;  3J80 D;  1HNZ C;  2Y4N A;  4DCS A;  3A4I A;  3VNQ A;  4LF5 C;  5A1G A;  3LUS A;  3GKU A;  1FJG C;  3LNV A;  3TDE A;  2PT7 G;  3CJE A;  4DUZ C;  1HNX C;  2D7V A;  1N33 C;  2OBV A;  3J81 D;  2VSQ A;  3AF6 A;  4RLF A;  3J7A D;  4GS5 A;  4JI8 C;  5BR8 C;  4X65 C;  5DV9 A;  4EAT A;  2D28 C;  1MD9 A;  3L8C A;  5AE2 A;  4DV5 C;  3A9V A;  5KYV A;  2UXC C;  1HH2 P;  4JI5 C;  4RM3 A;  1ZB9 A;  3I08 A;  5BSW A;  4GKK C;  4D4I A;  4D56 A;  3PBK A;  2YCB A;  1HNW C;  4NOZ A;  4RVN A;  4DR6 C;  4DG9 A;  1PG3 A;  4DV3 C;  3DLP X;  3PES A;  2D27 A;  4DR1 C;  2HJG A;  4DCV A;  1MXA A;  3B7W A;  3FCE A;  4G37 A;  1O9T A;  5KYT A;  4DV6 C;  1L2F A;  2PRO A;  5E7Q A;  4IZ6 A;  1O92 A;  1XMQ C;  2ATW A;  3IEV A;  3PRO C;  5FLX D;  4TPS B;  4DUY C;  4NDN A;  3CW8 X;  4WV3 A;  4DV1 C;  1XNR C;  3C5E A;  4MTN A;  1QM4 A;  2WD9 A;  1KKG A;  3OTO C;  1N2F A;  3E7W A;  4DCU A;  4DV4 C;  5BSV A;  4LF7 C;  3NYQ A;  5K8F A;  2QVX X;  2ASB A;  3R9W A;  2QW0 X;  3N54 B;  4JM1 A;  4BSZ A;  4B3S C;  4LFC C;  4OXI A;  3TQI A;  2BJO A;  3KXW A;  2F4V C;  1J5E C;  3NI2 A;  5CZV A;  1T5H X;  4LFA C;  1O90 A;  4K0B A;  3IPL A;  3ETO A;  4X62 C;  1IBL C;  1USP B;  3GR1 A;  5H9U A;  2CXC A;  1T5D X;  1EGA A;  4B3R C;  2P02 A;  2P2Q A;  1XRA A;  3GR0 A;  4BC7 A;  3E7X A;  4GKJ C;  1WH9 A;  3NYR A;  1ULT A;  1BA3 A;  2DYJ A;  1K0R A;  3CW9 A;  3JAM D;  5A19 A;  1V25 A;  4LFB C;  5LMN C;  2KZF A;  1ZB8 A;  2CY1 A;  5ADZ A;  4JI3 C;  4LF4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...