4B3TC

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4b3tC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4b3tC02
1EGAA 4KHPC 3IEUA 2E8CA 1JOSA 1XMQC 3AF5A 4DR6C 2EGTA 4JI2C 4JI0C 2UXDC 1UKKA 2VQFC 4X66C 1K0RA 1N32C 4JYAC 3EERA 1IBMC 4DV0C 1ZB8A 4DR4C 1HNWC 1ML8A 4AQYC 1N34C 2E8FA 1L2FA 1HR0C 4JI4C 1KKGA 1I94C 4DR7C 4DR3C 1FJGC 4LFCC 4YY3C 1N36C 4DCTA 1HNZC 1USPA 4DUYC 4LF8C 2UXBC 4DUZC 5IWAC 1HNXC 1WH9A 4DV3C 3I07A 3R9WA 1IBKC 2UUAC 2PT7G 4DCUA 3R9XA 2DYJA 4DR1C 2UUCC 4X65C 1XNQC 1LQLA 1ZB9A 2E5LC 4DCVA 4B3MC 1XNRC 4XX2A 3T1YC 2KZFA 4BSZA 4LF4C 2OPLA 4YHHC 2HJGA 4LF5C 3J81D 2CY1A 4NXNC 2UUBC 1HH2P 2E8EA 1NYEA 3AF6A 2BJOA 4NXMC 4B3SC 4LFBC 2XR1A 2PN2A 1VLAA 3LUSA 4JI3C 1WF3A 2YCBA 5FLXD 4OX9C 2ONFA 5IT9D 4LFAC 3IEVA 1MKYA 2E7GA 1N33C 4LF6C 4GKKC 3J7AD 4NOZA 1J5EC 5LMNC 4X62C 2F4VC 2CXCA 2VQEC 4DR2C 4X64C 4DV2C 2ASBA 4DV1C 4DV6C 3J80D 2JMPA 2QL8A 4DCSA 3OTOC 5LMUC 4B3TC 4JI5C 4GKJC 2UXCC 3CJEA 4JI1C 2OPLB 4MTNA 1XMOC 4JV5C 4MH4A 1PA4A 5BR8C 3JAMD 4K0KC 4JI7C 3GKUA 1USPB 1IBLC 1N2FA 2UU9C 4DV4C 4LF9C 3T1HC 4DV5C 2ATWA 1QWIA 5A2QD 2ZM6C 2HHHC 4LF7C 4B3RC 4DV7C 4JI8C 4DR5C 2D7VA 4JI6C
chains in the Genus database with same CATH superfamily
1JOSA 5BSRA 1MXBA 1VEHA 3LNOA 5CZXA 5A1IA 2ZZMA 4PUIA 4JI2C 4PZPA 4X66C 1K0RA 4KTTA 3N2QA 3EERA 3UX3A 1ZB8A 4DR4C 4PUGA 2E0GA 1FUGA 4AQYC 1L2FA 2AYAA 3FCCA 4DR7C 4DR3C 1FJGC 2QVYX 4LF8C 2UXBC 1HNXC 1LCIA 4G37A 1IBKC 3NI2A 3CQ3A 1V26A 4DR1C 2D27A 4RM2A 4WS9A 4X65C 2E5LC 2BH1X 1TH5A 5KEIA 3ETOA 5BSUA 4LF4C 2OPLA 4KTVA 4U5YD 4YHHC 4LF5C 2CY1A 4G1IA 1XDXA 3K6RA 2E8EA 4OYCA 3AF6A 3DHVA 4NXMC 4B3SC 1FLOA 4RVOA 2P2JA 3PROC 2XR1A 1P7LA 3LUSA 4JI3C 2CU6A 3A9VA 2Z51A 2YWCA 1N33C 1ULTA 1J5EC 3AY0A 3A4IA 5BUSA 4D56A 4EATA 3ETCA 1O93A 4DV6C 2WD9A 2UXCC 5BSMA 3CJEA 3JAMD 4JI7C 2M5HA 1RG9A 1PG3A 3PBKA 1IBLC 3LAXA 5KYVA 4BCAA 1P4EC 2UU9C 4RVNA 4DV4C 1QWIA 3NYRA 2ZM6C 4LF7C 4B3RC 4NDNA 3TDEA 1P4EA 3CQ2A 1XMQC 2EGTA 4PROC 1XRCA 4FUTA 1O90A 1IBMC 4DV0C 1HNWC 1O92A 1HR0C 3LGXA 5BSVA 4JI4C 3VNRA 1KKGA 1I94C 3L8CA 4DG8A 4LFCC 1N36C 1HNZC 3IPLA 4DUZC 5IWAC 2PROA 3E7XA 4DV3C 2DYJA 2UUCC 3DAYA 1LQLA 4LE5A 1M6XC 2MMAB 4DCVA 1XNRC 3LNVA 2KZFA 5BSWA 4L7IA 2HJGA 2M5OA 3E7WA 4NXNC 5AE1A 1HH2P 1NYEA 4GXQA 1T5HX 2DHMA 1M6XA 4ISBA 1VLAA 3FCEA 4R0MA 2YCBA 5FLXD 3NPDA 4OX9C 4LFAC 4L4QA 5CZVA 1MDBA 4IR7A 5JRHA 4LF6C 5LMNC 4X62C 4IZ6A 2ZZNA 5AE2A 4X64C 3S82A 2D1QA 4DV1C 4ZJZA 3OTOC 4DCSA 3TUFA 4GKJC 4FUQA 1RY2A 4JI1C 4MTNA 4K0KC 4DG9A 2D28C 2KZ0A 4GS5A 3GR1A 2ATWA 5AE3A 5A2QD 3RG2A 3IMLA 3H2TA 4DV7C 4OXIA 4L2ZA 3PESA 3IEUA 3UZ0A 2D1TA 4I9FA 4WV3A 1UWDA 1XS3A 4JI0C 4I9GA 2VQFC 3UOWA 1N32C 4JYAC 4PHTA 4ZLPA 4BC7A 3B7WA 2P2FA 3FM7A 1NY8A 2QVXX 5BURA 4TPSB 4R1LA 1AMUA 3I08A 4YY3C 2YX1A 1MD9A 4DUYC 1WH9A 4PUHA 3A25A 1XRAA 1V25A 3R9WA 2UUAC 2MM9A 4DCUA 3TQIA 3R9XA 1YGTA 3G7SA 4D57A 4RLFA 4RLQA 2Y4OA 4B3MC 3C5EA 3SO4A 4BSZA 1T5DX 3A26A 2UUBC 2OBVA 2KDNA 3VNQA 2D1SA 1WCJA 2QW0X 2PN2A 5BSTA 5LCIA 1WF3A 5IT9D 4BBYA 3IEVA 1MKYA 2E7GA 2P20A 3J7AD 4NOZA 2VZEA 1XRBA 2F4VC 2CXCA 2VQEC 4DR2C 2NCLA 4DV2C 2ZTBA 2JMPA 3N54B 1XMOC 2VSQA 1YJ7A 1MDFA 1PA4A 5BR8C 4JV5C 3R44A 1MXAA 1GPMA 3TR3A 1N2FA 3CQ1A 4BC9A 4LF9C 5A1GA 4DV5C 3T1HC 1XHJA 1O9TA 4JI8C 2D7VA 4JI6C 1EGAA 4KHPC 4GXRA 2E8CA 3AF5A 4DR6C 2P2BA 4G36A 3UX2A 1BA3A 2UXDC 1UKKA 4ODJA 4K0BA 1ML8A 1N34C 3L95X 2E8FA 1IB8A 5ADZA 5H9UA 2P02A 5T8SA 4DCTA 3VNSA 1USPA 2YWBA 1PG4A 3I07A 2PT7G 3DLPX 1MXCA 5GTDA 1XNQC 4HPVA 3A9UA 5T8TA 1ZB9A 4XX2A 4D4IA 3T1YC 1QM4A 3J81D 2BJOA 4LFBC 4FTFA 2OO4A 5KYTA 3EQ6A 1PU1A 2P2QA 5K8FA 2JNVA 2V7BA 3UEBA 2QVZX 2ONFA 2D1RA 5E7QA 3GPCA 5IFIA 4RM3A 3KXWA 4GKKC 4D4GA 2DPLA 1V60A 3CW9A 5A19A 3NYQA 3O2EA 2PG1E 5K85A 2ASBA 3J80D 2QL8A 5LMUC 4JI5C 4B3TC 3RV2A 2OPLB 2WP0C 5BUQA 4MH4A 4JM1A 2Y4NA 3GKUA 1USPB 4R1MA 3CW8X 2Y27A 3GR0A 2P2MA 2HHHC 5DV9A 4RMNA 4DR5C 2MCQA
chains in the Genus database with same CATH topology
1JOSA 5BSRA 1MXBA 5CZXA 5A1IA 4JI2C 4PZPA 4X66C 1K0RA 4KTTA 3N2QA 3EERA 1ZB8A 4DR4C 2E0GA 1FUGA 4AQYC 1L2FA 2AYAA 3FCCA 4DR7C 4DR3C 1FJGC 2QVYX 4LF8C 2UXBC 1HNXC 1LCIA 4G37A 1IBKC 3NI2A 1V26A 4DR1C 2D27A 4RM2A 4WS9A 4X65C 2E5LC 2BH1X 5KEIA 3ETOA 5BSUA 4LF4C 2OPLA 4KTVA 4U5YD 4YHHC 4LF5C 2CY1A 4G1IA 2E8EA 4OYCA 3AF6A 3DHVA 4NXMC 4B3SC 4RVOA 2P2JA 3PROC 2XR1A 1P7LA 3LUSA 4JI3C 3A9VA 2YWCA 1N33C 1ULTA 1J5EC 3A4IA 5BUSA 4D56A 4EATA 3ETCA 1O93A 4DV6C 2WD9A 2UXCC 5BSMA 3CJEA 3JAMD 4JI7C 1RG9A 1PG3A 3PBKA 1IBLC 3LAXA 5KYVA 4BCAA 2UU9C 4RVNA 4DV4C 1QWIA 3NYRA 2ZM6C 4LF7C 4B3RC 4NDNA 3TDEA 1XMQC 2EGTA 4PROC 1XRCA 4FUTA 1O90A 1IBMC 4DV0C 1HNWC 1O92A 1HR0C 3LGXA 5BSVA 4JI4C 3VNRA 1KKGA 1I94C 3L8CA 4DG8A 4LFCC 1N36C 1HNZC 3IPLA 4DUZC 5IWAC 2PROA 3E7XA 4DV3C 2DYJA 2UUCC 3DAYA 1LQLA 4LE5A 4DCVA 1XNRC 3LNVA 2KZFA 5BSWA 4L7IA 2HJGA 3E7WA 4NXNC 5AE1A 1HH2P 1NYEA 4GXQA 1T5HX 4ISBA 1VLAA 3FCEA 4R0MA 2YCBA 5FLXD 3NPDA 4OX9C 4LFAC 4L4QA 5CZVA 1MDBA 4IR7A 5JRHA 4LF6C 5LMNC 4X62C 4IZ6A 5AE2A 4X64C 3S82A 2D1QA 4DV1C 4ZJZA 3OTOC 4DCSA 3TUFA 4GKJC 4FUQA 1RY2A 4JI1C 4MTNA 4K0KC 4DG9A 2D28C 4GS5A 3GR1A 2ATWA 5AE3A 5A2QD 3RG2A 3IMLA 3H2TA 4DV7C 4OXIA 4L2ZA 3PESA 3IEUA 3UZ0A 2D1TA 4I9FA 4WV3A 4JI0C 4I9GA 2VQFC 3UOWA 1N32C 4JYAC 4PHTA 4ZLPA 4BC7A 3B7WA 2P2FA 2QVXX 5BURA 4TPSB 4R1LA 1AMUA 3I08A 4YY3C 1MD9A 4DUYC 1WH9A 1XRAA 1V25A 3R9WA 2UUAC 4DCUA 3R9XA 3TQIA 3G7SA 4D57A 4RLFA 4RLQA 2Y4OA 4B3MC 3C5EA 3SO4A 4BSZA 1T5DX 2UUBC 2OBVA 3VNQA 2D1SA 2QW0X 2PN2A 5BSTA 1WF3A 5IT9D 4BBYA 3IEVA 1MKYA 2E7GA 2P20A 3J7AD 4NOZA 2VZEA 1XRBA 2F4VC 2CXCA 2VQEC 4DR2C 4DV2C 2JMPA 3N54B 1XMOC 2VSQA 1YJ7A 1MDFA 1PA4A 5BR8C 4JV5C 3R44A 1MXAA 1GPMA 1N2FA 4BC9A 4LF9C 3T1HC 5A1GA 4DV5C 1O9TA 4JI8C 2D7VA 4JI6C 1EGAA 4KHPC 4GXRA 2E8CA 3AF5A 4DR6C 2P2BA 4G36A 1BA3A 2UXDC 1UKKA 4ODJA 4K0BA 1ML8A 1N34C 3L95X 2E8FA 5ADZA 5H9UA 2P02A 5T8SA 4DCTA 3VNSA 1USPA 2YWBA 1PG4A 3I07A 2PT7G 3DLPX 1MXCA 5GTDA 1XNQC 4HPVA 3A9UA 5T8TA 1ZB9A 4XX2A 3T1YC 4D4IA 1QM4A 3J81D 2BJOA 4LFBC 4FTFA 2OO4A 5KYTA 3EQ6A 2P2QA 5K8FA 2V7BA 2QVZX 2ONFA 2D1RA 5E7QA 3GPCA 5IFIA 4RM3A 3KXWA 4GKKC 4D4GA 2DPLA 3CW9A 5A19A 3NYQA 5K85A 2ASBA 3J80D 2QL8A 5LMUC 4JI5C 4B3TC 3RV2A 2OPLB 2WP0C 5BUQA 4MH4A 4JM1A 2Y4NA 3GKUA 1USPB 4R1MA 3CW8X 2Y27A 3GR0A 2P2MA 2HHHC 5DV9A 4RMNA 4DR5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EGA A;  4KHP C;  3IEU A;  2E8C A;  1JOS A;  1XMQ C;  3AF5 A;  4DR6 C;  2EGT A;  4JI2 C;  4JI0 C;  2UXD C;  1UKK A;  2VQF C;  4X66 C;  1K0R A;  1N32 C;  4JYA C;  3EER A;  1IBM C;  4DV0 C;  1ZB8 A;  4DR4 C;  1HNW C;  1ML8 A;  4AQY C;  1N34 C;  2E8F A;  1L2F A;  1HR0 C;  4JI4 C;  1KKG A;  1I94 C;  4DR7 C;  4DR3 C;  1FJG C;  4LFC C;  4YY3 C;  1N36 C;  4DCT A;  1HNZ C;  1USP A;  4DUY C;  4LF8 C;  2UXB C;  4DUZ C;  5IWA C;  1HNX C;  1WH9 A;  4DV3 C;  3I07 A;  3R9W A;  1IBK C;  2UUA C;  2PT7 G;  4DCU A;  3R9X A;  2DYJ A;  4DR1 C;  2UUC C;  4X65 C;  1XNQ C;  1LQL A;  1ZB9 A;  2E5L C;  4DCV A;  4B3M C;  1XNR C;  4XX2 A;  3T1Y C;  2KZF A;  4BSZ A;  4LF4 C;  2OPL A;  4YHH C;  2HJG A;  4LF5 C;  3J81 D;  2CY1 A;  4NXN C;  2UUB C;  1HH2 P;  2E8E A;  1NYE A;  3AF6 A;  2BJO A;  4NXM C;  4B3S C;  4LFB C;  2XR1 A;  2PN2 A;  1VLA A;  3LUS A;  4JI3 C;  1WF3 A;  2YCB A;  5FLX D;  4OX9 C;  2ONF A;  5IT9 D;  4LFA C;  3IEV A;  1MKY A;  2E7G A;  1N33 C;  4LF6 C;  4GKK C;  3J7A D;  4NOZ A;  1J5E C;  5LMN C;  4X62 C;  2F4V C;  2CXC A;  2VQE C;  4DR2 C;  4X64 C;  4DV2 C;  2ASB A;  4DV1 C;  4DV6 C;  3J80 D;  2JMP A;  2QL8 A;  4DCS A;  3OTO C;  5LMU C;  4B3T C;  4JI5 C;  4GKJ C;  2UXC C;  3CJE A;  4JI1 C;  2OPL B;  4MTN A;  1XMO C;  4JV5 C;  4MH4 A;  1PA4 A;  5BR8 C;  3JAM D;  4K0K C;  4JI7 C;  3GKU A;  1USP B;  1IBL C;  1N2F A;  2UU9 C;  4DV4 C;  4LF9 C;  3T1H C;  4DV5 C;  2ATW A;  1QWI A;  5A2Q D;  2ZM6 C;  2HHH C;  4LF7 C;  4B3R C;  4DV7 C;  4JI8 C;  4DR5 C;  2D7V A;  4JI6 C; 
#chains in the Genus database with same CATH topology
 1JOS A;  5BSR A;  1MXB A;  1VEH A;  3LNO A;  5CZX A;  5A1I A;  2ZZM A;  4PUI A;  4JI2 C;  4PZP A;  4X66 C;  1K0R A;  4KTT A;  3N2Q A;  3EER A;  3UX3 A;  1ZB8 A;  4DR4 C;  4PUG A;  2E0G A;  1FUG A;  4AQY C;  1L2F A;  2AYA A;  3FCC A;  4DR7 C;  4DR3 C;  1FJG C;  2QVY X;  4LF8 C;  2UXB C;  1HNX C;  1LCI A;  4G37 A;  1IBK C;  3NI2 A;  3CQ3 A;  1V26 A;  4DR1 C;  2D27 A;  4RM2 A;  4WS9 A;  4X65 C;  2E5L C;  2BH1 X;  1TH5 A;  5KEI A;  3ETO A;  5BSU A;  4LF4 C;  2OPL A;  4KTV A;  4U5Y D;  4YHH C;  4LF5 C;  2CY1 A;  4G1I A;  1XDX A;  3K6R A;  2E8E A;  4OYC A;  3AF6 A;  3DHV A;  4NXM C;  4B3S C;  1FLO A;  4RVO A;  2P2J A;  3PRO C;  2XR1 A;  1P7L A;  3LUS A;  4JI3 C;  2CU6 A;  3A9V A;  2Z51 A;  2YWC A;  1N33 C;  1ULT A;  1J5E C;  3AY0 A;  3A4I A;  5BUS A;  4D56 A;  4EAT A;  3ETC A;  1O93 A;  4DV6 C;  2WD9 A;  2UXC C;  5BSM A;  3CJE A;  3JAM D;  4JI7 C;  2M5H A;  1RG9 A;  1PG3 A;  3PBK A;  1IBL C;  3LAX A;  5KYV A;  4BCA A;  1P4E C;  2UU9 C;  4RVN A;  4DV4 C;  1QWI A;  3NYR A;  2ZM6 C;  4LF7 C;  4B3R C;  4NDN A;  3TDE A;  1P4E A;  3CQ2 A;  1XMQ C;  2EGT A;  4PRO C;  1XRC A;  4FUT A;  1O90 A;  1IBM C;  4DV0 C;  1HNW C;  1O92 A;  1HR0 C;  3LGX A;  5BSV A;  4JI4 C;  3VNR A;  1KKG A;  1I94 C;  3L8C A;  4DG8 A;  4LFC C;  1N36 C;  1HNZ C;  3IPL A;  4DUZ C;  5IWA C;  2PRO A;  3E7X A;  4DV3 C;  2DYJ A;  2UUC C;  3DAY A;  1LQL A;  4LE5 A;  1M6X C;  2MMA B;  4DCV A;  1XNR C;  3LNV A;  2KZF A;  5BSW A;  4L7I A;  2HJG A;  2M5O A;  3E7W A;  4NXN C;  5AE1 A;  1HH2 P;  1NYE A;  4GXQ A;  1T5H X;  2DHM A;  1M6X A;  4ISB A;  1VLA A;  3FCE A;  4R0M A;  2YCB A;  5FLX D;  3NPD A;  4OX9 C;  4LFA C;  4L4Q A;  5CZV A;  1MDB A;  4IR7 A;  5JRH A;  4LF6 C;  5LMN C;  4X62 C;  4IZ6 A;  2ZZN A;  5AE2 A;  4X64 C;  3S82 A;  2D1Q A;  4DV1 C;  4ZJZ A;  3OTO C;  4DCS A;  3TUF A;  4GKJ C;  4FUQ A;  1RY2 A;  4JI1 C;  4MTN A;  4K0K C;  4DG9 A;  2D28 C;  2KZ0 A;  4GS5 A;  3GR1 A;  2ATW A;  5AE3 A;  5A2Q D;  3RG2 A;  3IML A;  3H2T A;  4DV7 C;  4OXI A;  4L2Z A;  3PES A;  3IEU A;  3UZ0 A;  2D1T A;  4I9F A;  4WV3 A;  1UWD A;  1XS3 A;  4JI0 C;  4I9G A;  2VQF C;  3UOW A;  1N32 C;  4JYA C;  4PHT A;  4ZLP A;  4BC7 A;  3B7W A;  2P2F A;  3FM7 A;  1NY8 A;  2QVX X;  5BUR A;  4TPS B;  4R1L A;  1AMU A;  3I08 A;  4YY3 C;  2YX1 A;  1MD9 A;  4DUY C;  1WH9 A;  4PUH A;  3A25 A;  1XRA A;  1V25 A;  3R9W A;  2UUA C;  2MM9 A;  4DCU A;  3TQI A;  3R9X A;  1YGT A;  3G7S A;  4D57 A;  4RLF A;  4RLQ A;  2Y4O A;  4B3M C;  3C5E A;  3SO4 A;  4BSZ A;  1T5D X;  3A26 A;  2UUB C;  2OBV A;  2KDN A;  3VNQ A;  2D1S A;  1WCJ A;  2QW0 X;  2PN2 A;  5BST A;  5LCI A;  1WF3 A;  5IT9 D;  4BBY A;  3IEV A;  1MKY A;  2E7G A;  2P20 A;  3J7A D;  4NOZ A;  2VZE A;  1XRB A;  2F4V C;  2CXC A;  2VQE C;  4DR2 C;  2NCL A;  4DV2 C;  2ZTB A;  2JMP A;  3N54 B;  1XMO C;  2VSQ A;  1YJ7 A;  1MDF A;  1PA4 A;  5BR8 C;  4JV5 C;  3R44 A;  1MXA A;  1GPM A;  3TR3 A;  1N2F A;  3CQ1 A;  4BC9 A;  4LF9 C;  5A1G A;  4DV5 C;  3T1H C;  1XHJ A;  1O9T A;  4JI8 C;  2D7V A;  4JI6 C;  1EGA A;  4KHP C;  4GXR A;  2E8C A;  3AF5 A;  4DR6 C;  2P2B A;  4G36 A;  3UX2 A;  1BA3 A;  2UXD C;  1UKK A;  4ODJ A;  4K0B A;  1ML8 A;  1N34 C;  3L95 X;  2E8F A;  1IB8 A;  5ADZ A;  5H9U A;  2P02 A;  5T8S A;  4DCT A;  3VNS A;  1USP A;  2YWB A;  1PG4 A;  3I07 A;  2PT7 G;  3DLP X;  1MXC A;  5GTD A;  1XNQ C;  4HPV A;  3A9U A;  5T8T A;  1ZB9 A;  4XX2 A;  4D4I A;  3T1Y C;  1QM4 A;  3J81 D;  2BJO A;  4LFB C;  4FTF A;  2OO4 A;  5KYT A;  3EQ6 A;  1PU1 A;  2P2Q A;  5K8F A;  2JNV A;  2V7B A;  3UEB A;  2QVZ X;  2ONF A;  2D1R A;  5E7Q A;  3GPC A;  5IFI A;  4RM3 A;  3KXW A;  4GKK C;  4D4G A;  2DPL A;  1V60 A;  3CW9 A;  5A19 A;  3NYQ A;  3O2E A;  2PG1 E;  5K85 A;  2ASB A;  3J80 D;  2QL8 A;  5LMU C;  4JI5 C;  4B3T C;  3RV2 A;  2OPL B;  2WP0 C;  5BUQ A;  4MH4 A;  4JM1 A;  2Y4N A;  3GKU A;  1USP B;  4R1M A;  3CW8 X;  2Y27 A;  3GR0 A;  2P2M A;  2HHH C;  5DV9 A;  4RMN A;  4DR5 C;  2MCQ A; 
#chains in the Genus database with same CATH homology
 1JOS A;  5BSR A;  1MXB A;  5CZX A;  5A1I A;  4JI2 C;  4PZP A;  4X66 C;  1K0R A;  4KTT A;  3N2Q A;  3EER A;  1ZB8 A;  4DR4 C;  2E0G A;  1FUG A;  4AQY C;  1L2F A;  2AYA A;  3FCC A;  4DR7 C;  4DR3 C;  1FJG C;  2QVY X;  4LF8 C;  2UXB C;  1HNX C;  1LCI A;  4G37 A;  1IBK C;  3NI2 A;  1V26 A;  4DR1 C;  2D27 A;  4RM2 A;  4WS9 A;  4X65 C;  2E5L C;  2BH1 X;  5KEI A;  3ETO A;  5BSU A;  4LF4 C;  2OPL A;  4KTV A;  4U5Y D;  4YHH C;  4LF5 C;  2CY1 A;  4G1I A;  2E8E A;  4OYC A;  3AF6 A;  3DHV A;  4NXM C;  4B3S C;  4RVO A;  2P2J A;  3PRO C;  2XR1 A;  1P7L A;  3LUS A;  4JI3 C;  3A9V A;  2YWC A;  1N33 C;  1ULT A;  1J5E C;  3A4I A;  5BUS A;  4D56 A;  4EAT A;  3ETC A;  1O93 A;  4DV6 C;  2WD9 A;  2UXC C;  5BSM A;  3CJE A;  3JAM D;  4JI7 C;  1RG9 A;  1PG3 A;  3PBK A;  1IBL C;  3LAX A;  5KYV A;  4BCA A;  2UU9 C;  4RVN A;  4DV4 C;  1QWI A;  3NYR A;  2ZM6 C;  4LF7 C;  4B3R C;  4NDN A;  3TDE A;  1XMQ C;  2EGT A;  4PRO C;  1XRC A;  4FUT A;  1O90 A;  1IBM C;  4DV0 C;  1HNW C;  1O92 A;  1HR0 C;  3LGX A;  5BSV A;  4JI4 C;  3VNR A;  1KKG A;  1I94 C;  3L8C A;  4DG8 A;  4LFC C;  1N36 C;  1HNZ C;  3IPL A;  4DUZ C;  5IWA C;  2PRO A;  3E7X A;  4DV3 C;  2DYJ A;  2UUC C;  3DAY A;  1LQL A;  4LE5 A;  4DCV A;  1XNR C;  3LNV A;  2KZF A;  5BSW A;  4L7I A;  2HJG A;  3E7W A;  4NXN C;  5AE1 A;  1HH2 P;  1NYE A;  4GXQ A;  1T5H X;  4ISB A;  1VLA A;  3FCE A;  4R0M A;  2YCB A;  5FLX D;  3NPD A;  4OX9 C;  4LFA C;  4L4Q A;  5CZV A;  1MDB A;  4IR7 A;  5JRH A;  4LF6 C;  5LMN C;  4X62 C;  4IZ6 A;  5AE2 A;  4X64 C;  3S82 A;  2D1Q A;  4DV1 C;  4ZJZ A;  3OTO C;  4DCS A;  3TUF A;  4GKJ C;  4FUQ A;  1RY2 A;  4JI1 C;  4MTN A;  4K0K C;  4DG9 A;  2D28 C;  4GS5 A;  3GR1 A;  2ATW A;  5AE3 A;  5A2Q D;  3RG2 A;  3IML A;  3H2T A;  4DV7 C;  4OXI A;  4L2Z A;  3PES A;  3IEU A;  3UZ0 A;  2D1T A;  4I9F A;  4WV3 A;  4JI0 C;  4I9G A;  2VQF C;  3UOW A;  1N32 C;  4JYA C;  4PHT A;  4ZLP A;  4BC7 A;  3B7W A;  2P2F A;  2QVX X;  5BUR A;  4TPS B;  4R1L A;  1AMU A;  3I08 A;  4YY3 C;  1MD9 A;  4DUY C;  1WH9 A;  1XRA A;  1V25 A;  3R9W A;  2UUA C;  4DCU A;  3R9X A;  3TQI A;  3G7S A;  4D57 A;  4RLF A;  4RLQ A;  2Y4O A;  4B3M C;  3C5E A;  3SO4 A;  4BSZ A;  1T5D X;  2UUB C;  2OBV A;  3VNQ A;  2D1S A;  2QW0 X;  2PN2 A;  5BST A;  1WF3 A;  5IT9 D;  4BBY A;  3IEV A;  1MKY A;  2E7G A;  2P20 A;  3J7A D;  4NOZ A;  2VZE A;  1XRB A;  2F4V C;  2CXC A;  2VQE C;  4DR2 C;  4DV2 C;  2JMP A;  3N54 B;  1XMO C;  2VSQ A;  1YJ7 A;  1MDF A;  1PA4 A;  5BR8 C;  4JV5 C;  3R44 A;  1MXA A;  1GPM A;  1N2F A;  4BC9 A;  4LF9 C;  3T1H C;  5A1G A;  4DV5 C;  1O9T A;  4JI8 C;  2D7V A;  4JI6 C;  1EGA A;  4KHP C;  4GXR A;  2E8C A;  3AF5 A;  4DR6 C;  2P2B A;  4G36 A;  1BA3 A;  2UXD C;  1UKK A;  4ODJ A;  4K0B A;  1ML8 A;  1N34 C;  3L95 X;  2E8F A;  5ADZ A;  5H9U A;  2P02 A;  5T8S A;  4DCT A;  3VNS A;  1USP A;  2YWB A;  1PG4 A;  3I07 A;  2PT7 G;  3DLP X;  1MXC A;  5GTD A;  1XNQ C;  4HPV A;  3A9U A;  5T8T A;  1ZB9 A;  4XX2 A;  3T1Y C;  4D4I A;  1QM4 A;  3J81 D;  2BJO A;  4LFB C;  4FTF A;  2OO4 A;  5KYT A;  3EQ6 A;  2P2Q A;  5K8F A;  2V7B A;  2QVZ X;  2ONF A;  2D1R A;  5E7Q A;  3GPC A;  5IFI A;  4RM3 A;  3KXW A;  4GKK C;  4D4G A;  2DPL A;  3CW9 A;  5A19 A;  3NYQ A;  5K85 A;  2ASB A;  3J80 D;  2QL8 A;  5LMU C;  4JI5 C;  4B3T C;  3RV2 A;  2OPL B;  2WP0 C;  5BUQ A;  4MH4 A;  4JM1 A;  2Y4N A;  3GKU A;  1USP B;  4R1M A;  3CW8 X;  2Y27 A;  3GR0 A;  2P2M A;  2HHH C;  5DV9 A;  4RMN A;  4DR5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...