4LF4C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 47
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf4C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf4C02
4K0KC 1MKYA 5FLXD 2ONFA 4JYAC 1USPB 2UXCC 4JI0C 4JI8C 5BR8C 1HNWC 4GKJC 2UU9C 1N32C 4JI3C 1XMQC 4LF5C 4DCVA 5A2QD 5LMUC 4BSZA 2JMPA 4XX2A 4DV0C 2UUBC 1L2FA 4LF8C 4JI2C 4DV1C 1K0RA 3I07A 4LF7C 4DR1C 4GKKC 2E7GA 2E8FA 4DCTA 4LF6C 4DR6C 1I94C 5IWAC 2OPLB 1LQLA 2UXBC 3AF5A 2UXDC 2BJOA 1IBLC 2DYJA 3T1YC 3R9XA 3IEUA 1ZB9A 1UKKA 3T1HC 4DCUA 5LMNC 1J5EC 4NXNC 4NOZA 2KZFA 2ZM6C 3JAMD 1HNXC 1WF3A 3J7AD 4B3SC 3OTOC 4X66C 1XMOC 4KHPC 3EERA 4DV4C 1HR0C 4DR5C 4DV6C 4LF9C 4MH4A 2VQFC 4X65C 3J81D 1ZB8A 4B3RC 4DR4C 4NXMC 3CJEA 3AF6A 1N2FA 1N33C 4YHHC 4X62C 3J80D 2D7VA 4DR2C 1IBMC 1USPA 4DV7C 1KKGA 1N34C 2VQEC 1NYEA 2PT7G 2HHHC 1XNRC 4JI5C 4X64C 4DUYC 4JI1C 4DV3C 4LFAC 1FJGC 4AQYC 1HH2P 4LFBC 2HJGA 1IBKC 2EGTA 4YY3C 4DCSA 4DUZC 3LUSA 2E8CA 1ML8A 1JOSA 2CXCA 4JI6C 2ASBA 2OPLA 4DV2C 1QWIA 4OX9C 4DV5C 4LFCC 4MTNA 4JI7C 2YCBA 4JI4C 1EGAA 2CY1A 4DR7C 4B3TC 4JV5C 1XNQC 2UUAC 3GKUA 1N36C 4LF4C 3IEVA 2E8EA 2ATWA 2QL8A 2XR1A 2UUCC 1HNZC 1WH9A 5IT9D 2F4VC 2PN2A 4DR3C 3R9WA 1PA4A 4B3MC 2E5LC 1VLAA
chains in the Genus database with same CATH superfamily
4WV3A 5FLXD 3CQ3A 2YWCA 3UX3A 3CW9A 3NI2A 3UEBA 4L7IA 3FCCA 4D4GA 1XMQC 1FUGA 4DG8A 5LCIA 4BSZA 4XX2A 4IR7A 2UUBC 3FCEA 4JI2C 1YGTA 4DV1C 1MDFA 3I07A 1VEHA 1GPMA 1WCJA 2E8FA 5T8TA 2PG1E 1LQLA 2UXBC 3AF5A 2BJOA 2JNVA 3LGXA 3LNOA 4FTFA 1UKKA 1QM4A 4DCUA 1IB8A 3H2TA 5LMNC 3EQ6A 1J5EC 2MM9A 3KXWA 1WF3A 3J7AD 3OTOC 3R44A 4DV4C 4DR5C 5E7QA 2MMAB 3ETCA 4DR4C 1MD9A 3CJEA 1P4EA 3PESA 2OBVA 4DR2C 1V26A 4K0BA 5T8SA 1N34C 2VQEC 3PROC 4WS9A 4JI5C 4DUYC 4JI1C 5BSMA 2ZZNA 1HH2P 4GXQA 1O90A 1IBKC 2EGTA 2ZTBA 3LUSA 3UZ0A 5A1GA 4OX9C 1T5HX 3DHVA 4D4IA 2YCBA 4JI4C 1P4EC 4TPSB 2P2BA 3TUFA 4JV5C 3DAYA 4LF4C 3RV2A 4HPVA 2ATWA 4G1IA 2UUCC 2F4VC 4I9FA 4DR3C 3IPLA 4L4QA 3B7WA 1P7LA 1VLAA 1O92A 4K0KC 4PUHA 5AE2A 1M6XA 4JYAC 2P2QA 2P02A 2UXCC 2D1QA 5BR8C 4GKJC 4R0MA 3NYQA 1V25A 4BBYA 4DV0C 1L2FA 4LF8C 1K0RA 1AMUA 3S82A 4G37A 4DR1C 4GKKC 4DCTA 5IWAC 2Y27A 3AY0A 2UXDC 3R9XA 3RG2A 1ZB9A 3UOWA 4PROC 3T1HC 3C5EA 4RM3A 3GPCA 4BC7A 1V60A 2P2JA 3I08A 3A4IA 2ZM6C 3JAMD 2D27A 1HNXC 4RLFA 5AE3A 5BSTA 1PU1A 4G36A 4LF9C 4MH4A 5A1IA 3J81D 2P20A 1ZB8A 5KYTA 1MXBA 1MXCA 1N33C 1RG9A 1XHJA 4YHHC 4RM2A 5GTDA 4RVOA 3J80D 2D7VA 1IBMC 1USPA 4DV7C 2PT7G 2HHHC 1XNRC 2AYAA 5IFIA 4X64C 2VZEA 1M6XC 3IMLA 2D1TA 3E7XA 4DCSA 3FM7A 2VSQA 5ADZA 2E8CA 4GS5A 4JI6C 1FLOA 2OPLA 2WD9A 1QWIA 1T5DX 4DV5C 4BCAA 4RLQA 2Y4OA 4RVNA 2DPLA 1EGAA 4DG9A 4OYCA 2QVZX 3VNRA 3IEVA 3CQ2A 2KZ0A 4PUIA 2NCLA 2XR1A 4EATA 1TH5A 3LNVA 4D57A 1PA4A 2E5LC 2Y4NA 1MDBA 3NPDA 4R1LA 1O9TA 2ONFA 1USPB 4ZLPA 4JI0C 1HNWC 2UU9C 1N32C 4I9GA 4LF5C 5CZVA 2JMPA 2WP0C 2CU6A 5A19A 1O93A 1PG3A 3A9UA 5DV9A 2E7GA 3LAXA 1I94C 2OPLB 5AE1A 2YX1A 1IBLC 3T1YC 3L95X 3IEUA 4ZJZA 4JM1A 3A9VA 5KYVA 5K8FA 4NXNC 4NOZA 4B3SC 1BA3A 4X66C 3EERA 4D56A 1HR0C 4U5YD 4DV6C 4B3RC 4NXMC 2YWBA 3AF6A 3UX2A 3CW8X 1MXAA 4X62C 3N2QA 2KDNA 2DHMA 4ISBA 3GR0A 5BSUA 4DV3C 1FJGC 3CQ1A 3L8CA 5BURA 4YY3C 2E0GA 2M5OA 1JOSA 1ML8A 3K6RA 2ASBA 3SO4A 3A26A 1XDXA 3VNSA 4LFCC 2D1RA 4MTNA 4PHTA 4JI7C 2UUAC 1XRBA 2QL8A 2QVYX 4FUQA 4L2ZA 5BUQA 2D1SA 3G7SA 1HNZC 3N54B 1WH9A 2PN2A 3R9WA 2M5HA 4KTVA 1MKYA 4BC9A 3TR3A 5BSRA 5BSWA 2Z51A 4GXRA 4JI8C 1PG4A 4JI3C 4DCVA 5A2QD 5LMUC 3E7WA 4LF7C 2V7BA 5BUSA 1YJ7A 3O2EA 4LF6C 4DR6C 2ZZMA 3PBKA 2DYJA 4IZ6A 4RMNA 1LCIA 2BH1X 4OXIA 2QW0X 2KZFA 2D28C 1XMOC 4KHPC 4R1MA 2VQFC 4X65C 4FUTA 3VNQA 2P2FA 1N2FA 4PUGA 3A25A 1KKGA 5BSVA 1RY2A 5KEIA 2QVXX 3NYRA 4NDNA 1NYEA 4LFAC 4AQYC 4LFBC 3TDEA 2HJGA 1XRAA 4DUZC 2PROA 2MCQA 4LE5A 2CXCA 5CZXA 4PZPA 5K85A 4DV2C 4KTTA 2OO4A 5JRHA 2CY1A 4DR7C 3ETOA 4B3TC 1XRCA 1XNQC 5H9UA 1XS3A 3GKUA 1N36C 2E8EA 1NY8A 3GR1A 4ODJA 5IT9D 1ULTA 4B3MC 2P2MA 1UWDA 3TQIA 3DLPX
chains in the Genus database with same CATH topology
4WV3A 5FLXD 2YWCA 3CW9A 3NI2A 4L7IA 3FCCA 4D4GA 1XMQC 1FUGA 4DG8A 4BSZA 4XX2A 4IR7A 2UUBC 3FCEA 4JI2C 4DV1C 1MDFA 3I07A 1GPMA 2E8FA 5T8TA 1LQLA 2UXBC 3AF5A 2BJOA 3LGXA 4FTFA 1UKKA 1QM4A 4DCUA 3H2TA 5LMNC 3EQ6A 1J5EC 3KXWA 1WF3A 3J7AD 3OTOC 3R44A 4DV4C 4DR5C 5E7QA 3ETCA 4DR4C 1MD9A 3CJEA 3PESA 2OBVA 4DR2C 1V26A 4K0BA 5T8SA 1N34C 2VQEC 3PROC 4WS9A 4JI5C 4DUYC 4JI1C 5BSMA 1HH2P 4GXQA 1O90A 1IBKC 2EGTA 3LUSA 3UZ0A 5A1GA 4OX9C 1T5HX 3DHVA 4D4IA 2YCBA 4JI4C 4TPSB 2P2BA 3TUFA 4JV5C 3DAYA 4LF4C 3RV2A 4HPVA 2ATWA 4G1IA 2UUCC 2F4VC 4I9FA 4DR3C 3IPLA 4L4QA 3B7WA 1P7LA 1VLAA 1O92A 4K0KC 5AE2A 4JYAC 2P2QA 2P02A 2UXCC 2D1QA 5BR8C 4GKJC 4R0MA 3NYQA 1V25A 4BBYA 4DV0C 1L2FA 4LF8C 1K0RA 1AMUA 3S82A 4G37A 4DR1C 4GKKC 4DCTA 5IWAC 2Y27A 2UXDC 3R9XA 3RG2A 1ZB9A 3UOWA 4PROC 3T1HC 3C5EA 4RM3A 3GPCA 4BC7A 2P2JA 3I08A 3A4IA 2ZM6C 3JAMD 2D27A 1HNXC 4RLFA 5AE3A 5BSTA 4G36A 4LF9C 4MH4A 5A1IA 3J81D 2P20A 1ZB8A 5KYTA 1MXBA 1MXCA 1N33C 1RG9A 4YHHC 4RM2A 5GTDA 4RVOA 3J80D 2D7VA 1IBMC 1USPA 4DV7C 2PT7G 2HHHC 1XNRC 2AYAA 5IFIA 4X64C 2VZEA 3IMLA 2D1TA 3E7XA 4DCSA 2VSQA 5ADZA 2E8CA 4GS5A 4JI6C 2OPLA 2WD9A 1QWIA 1T5DX 4DV5C 4BCAA 4RLQA 2Y4OA 4RVNA 2DPLA 1EGAA 4DG9A 4OYCA 2QVZX 3VNRA 3IEVA 2XR1A 4EATA 3LNVA 4D57A 1PA4A 2E5LC 2Y4NA 1MDBA 3NPDA 4R1LA 1O9TA 2ONFA 1USPB 4ZLPA 4JI0C 1HNWC 2UU9C 1N32C 4I9GA 4LF5C 5CZVA 2JMPA 2WP0C 5A19A 1O93A 1PG3A 3A9UA 5DV9A 2E7GA 3LAXA 1I94C 2OPLB 5AE1A 1IBLC 3T1YC 3L95X 3IEUA 4ZJZA 4JM1A 3A9VA 5KYVA 5K8FA 4NXNC 4NOZA 4B3SC 1BA3A 4X66C 3EERA 4D56A 1HR0C 4U5YD 4DV6C 4B3RC 4NXMC 2YWBA 3AF6A 3CW8X 1MXAA 4X62C 3N2QA 4ISBA 3GR0A 5BSUA 4DV3C 1FJGC 3L8CA 5BURA 4YY3C 2E0GA 1JOSA 1ML8A 2ASBA 3SO4A 3VNSA 4LFCC 2D1RA 4MTNA 4PHTA 4JI7C 2UUAC 1XRBA 2QL8A 2QVYX 4FUQA 4L2ZA 5BUQA 2D1SA 3G7SA 1HNZC 3N54B 1WH9A 2PN2A 3R9WA 4KTVA 1MKYA 4BC9A 5BSRA 5BSWA 4GXRA 4JI8C 1PG4A 4JI3C 4DCVA 5A2QD 5LMUC 3E7WA 4LF7C 2V7BA 5BUSA 1YJ7A 4LF6C 4DR6C 3PBKA 2DYJA 4IZ6A 4RMNA 1LCIA 2BH1X 4OXIA 2QW0X 2KZFA 2D28C 1XMOC 4KHPC 4R1MA 2VQFC 4X65C 4FUTA 3VNQA 2P2FA 1N2FA 1KKGA 5BSVA 1RY2A 5KEIA 2QVXX 3NYRA 4NDNA 1NYEA 4LFAC 4AQYC 4LFBC 3TDEA 2HJGA 1XRAA 4DUZC 2PROA 4LE5A 2CXCA 5CZXA 4PZPA 5K85A 4DV2C 4KTTA 2OO4A 5JRHA 2CY1A 4DR7C 3ETOA 4B3TC 1XRCA 1XNQC 5H9UA 3GKUA 1N36C 2E8EA 3GR1A 4ODJA 5IT9D 1ULTA 4B3MC 2P2MA 3TQIA 3DLPX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K C;  1MKY A;  5FLX D;  2ONF A;  4JYA C;  1USP B;  2UXC C;  4JI0 C;  4JI8 C;  5BR8 C;  1HNW C;  4GKJ C;  2UU9 C;  1N32 C;  4JI3 C;  1XMQ C;  4LF5 C;  4DCV A;  5A2Q D;  5LMU C;  4BSZ A;  2JMP A;  4XX2 A;  4DV0 C;  2UUB C;  1L2F A;  4LF8 C;  4JI2 C;  4DV1 C;  1K0R A;  3I07 A;  4LF7 C;  4DR1 C;  4GKK C;  2E7G A;  2E8F A;  4DCT A;  4LF6 C;  4DR6 C;  1I94 C;  5IWA C;  2OPL B;  1LQL A;  2UXB C;  3AF5 A;  2UXD C;  2BJO A;  1IBL C;  2DYJ A;  3T1Y C;  3R9X A;  3IEU A;  1ZB9 A;  1UKK A;  3T1H C;  4DCU A;  5LMN C;  1J5E C;  4NXN C;  4NOZ A;  2KZF A;  2ZM6 C;  3JAM D;  1HNX C;  1WF3 A;  3J7A D;  4B3S C;  3OTO C;  4X66 C;  1XMO C;  4KHP C;  3EER A;  4DV4 C;  1HR0 C;  4DR5 C;  4DV6 C;  4LF9 C;  4MH4 A;  2VQF C;  4X65 C;  3J81 D;  1ZB8 A;  4B3R C;  4DR4 C;  4NXM C;  3CJE A;  3AF6 A;  1N2F A;  1N33 C;  4YHH C;  4X62 C;  3J80 D;  2D7V A;  4DR2 C;  1IBM C;  1USP A;  4DV7 C;  1KKG A;  1N34 C;  2VQE C;  1NYE A;  2PT7 G;  2HHH C;  1XNR C;  4JI5 C;  4X64 C;  4DUY C;  4JI1 C;  4DV3 C;  4LFA C;  1FJG C;  4AQY C;  1HH2 P;  4LFB C;  2HJG A;  1IBK C;  2EGT A;  4YY3 C;  4DCS A;  4DUZ C;  3LUS A;  2E8C A;  1ML8 A;  1JOS A;  2CXC A;  4JI6 C;  2ASB A;  2OPL A;  4DV2 C;  1QWI A;  4OX9 C;  4DV5 C;  4LFC C;  4MTN A;  4JI7 C;  2YCB A;  4JI4 C;  1EGA A;  2CY1 A;  4DR7 C;  4B3T C;  4JV5 C;  1XNQ C;  2UUA C;  3GKU A;  1N36 C;  4LF4 C;  3IEV A;  2E8E A;  2ATW A;  2QL8 A;  2XR1 A;  2UUC C;  1HNZ C;  1WH9 A;  5IT9 D;  2F4V C;  2PN2 A;  4DR3 C;  3R9W A;  1PA4 A;  4B3M C;  2E5L C;  1VLA A; 
#chains in the Genus database with same CATH topology
 4WV3 A;  5FLX D;  3CQ3 A;  2YWC A;  3UX3 A;  3CW9 A;  3NI2 A;  3UEB A;  4L7I A;  3FCC A;  4D4G A;  1XMQ C;  1FUG A;  4DG8 A;  5LCI A;  4BSZ A;  4XX2 A;  4IR7 A;  2UUB C;  3FCE A;  4JI2 C;  1YGT A;  4DV1 C;  1MDF A;  3I07 A;  1VEH A;  1GPM A;  1WCJ A;  2E8F A;  5T8T A;  2PG1 E;  1LQL A;  2UXB C;  3AF5 A;  2BJO A;  2JNV A;  3LGX A;  3LNO A;  4FTF A;  1UKK A;  1QM4 A;  4DCU A;  1IB8 A;  3H2T A;  5LMN C;  3EQ6 A;  1J5E C;  2MM9 A;  3KXW A;  1WF3 A;  3J7A D;  3OTO C;  3R44 A;  4DV4 C;  4DR5 C;  5E7Q A;  2MMA B;  3ETC A;  4DR4 C;  1MD9 A;  3CJE A;  1P4E A;  3PES A;  2OBV A;  4DR2 C;  1V26 A;  4K0B A;  5T8S A;  1N34 C;  2VQE C;  3PRO C;  4WS9 A;  4JI5 C;  4DUY C;  4JI1 C;  5BSM A;  2ZZN A;  1HH2 P;  4GXQ A;  1O90 A;  1IBK C;  2EGT A;  2ZTB A;  3LUS A;  3UZ0 A;  5A1G A;  4OX9 C;  1T5H X;  3DHV A;  4D4I A;  2YCB A;  4JI4 C;  1P4E C;  4TPS B;  2P2B A;  3TUF A;  4JV5 C;  3DAY A;  4LF4 C;  3RV2 A;  4HPV A;  2ATW A;  4G1I A;  2UUC C;  2F4V C;  4I9F A;  4DR3 C;  3IPL A;  4L4Q A;  3B7W A;  1P7L A;  1VLA A;  1O92 A;  4K0K C;  4PUH A;  5AE2 A;  1M6X A;  4JYA C;  2P2Q A;  2P02 A;  2UXC C;  2D1Q A;  5BR8 C;  4GKJ C;  4R0M A;  3NYQ A;  1V25 A;  4BBY A;  4DV0 C;  1L2F A;  4LF8 C;  1K0R A;  1AMU A;  3S82 A;  4G37 A;  4DR1 C;  4GKK C;  4DCT A;  5IWA C;  2Y27 A;  3AY0 A;  2UXD C;  3R9X A;  3RG2 A;  1ZB9 A;  3UOW A;  4PRO C;  3T1H C;  3C5E A;  4RM3 A;  3GPC A;  4BC7 A;  1V60 A;  2P2J A;  3I08 A;  3A4I A;  2ZM6 C;  3JAM D;  2D27 A;  1HNX C;  4RLF A;  5AE3 A;  5BST A;  1PU1 A;  4G36 A;  4LF9 C;  4MH4 A;  5A1I A;  3J81 D;  2P20 A;  1ZB8 A;  5KYT A;  1MXB A;  1MXC A;  1N33 C;  1RG9 A;  1XHJ A;  4YHH C;  4RM2 A;  5GTD A;  4RVO A;  3J80 D;  2D7V A;  1IBM C;  1USP A;  4DV7 C;  2PT7 G;  2HHH C;  1XNR C;  2AYA A;  5IFI A;  4X64 C;  2VZE A;  1M6X C;  3IML A;  2D1T A;  3E7X A;  4DCS A;  3FM7 A;  2VSQ A;  5ADZ A;  2E8C A;  4GS5 A;  4JI6 C;  1FLO A;  2OPL A;  2WD9 A;  1QWI A;  1T5D X;  4DV5 C;  4BCA A;  4RLQ A;  2Y4O A;  4RVN A;  2DPL A;  1EGA A;  4DG9 A;  4OYC A;  2QVZ X;  3VNR A;  3IEV A;  3CQ2 A;  2KZ0 A;  4PUI A;  2NCL A;  2XR1 A;  4EAT A;  1TH5 A;  3LNV A;  4D57 A;  1PA4 A;  2E5L C;  2Y4N A;  1MDB A;  3NPD A;  4R1L A;  1O9T A;  2ONF A;  1USP B;  4ZLP A;  4JI0 C;  1HNW C;  2UU9 C;  1N32 C;  4I9G A;  4LF5 C;  5CZV A;  2JMP A;  2WP0 C;  2CU6 A;  5A19 A;  1O93 A;  1PG3 A;  3A9U A;  5DV9 A;  2E7G A;  3LAX A;  1I94 C;  2OPL B;  5AE1 A;  2YX1 A;  1IBL C;  3T1Y C;  3L95 X;  3IEU A;  4ZJZ A;  4JM1 A;  3A9V A;  5KYV A;  5K8F A;  4NXN C;  4NOZ A;  4B3S C;  1BA3 A;  4X66 C;  3EER A;  4D56 A;  1HR0 C;  4U5Y D;  4DV6 C;  4B3R C;  4NXM C;  2YWB A;  3AF6 A;  3UX2 A;  3CW8 X;  1MXA A;  4X62 C;  3N2Q A;  2KDN A;  2DHM A;  4ISB A;  3GR0 A;  5BSU A;  4DV3 C;  1FJG C;  3CQ1 A;  3L8C A;  5BUR A;  4YY3 C;  2E0G A;  2M5O A;  1JOS A;  1ML8 A;  3K6R A;  2ASB A;  3SO4 A;  3A26 A;  1XDX A;  3VNS A;  4LFC C;  2D1R A;  4MTN A;  4PHT A;  4JI7 C;  2UUA C;  1XRB A;  2QL8 A;  2QVY X;  4FUQ A;  4L2Z A;  5BUQ A;  2D1S A;  3G7S A;  1HNZ C;  3N54 B;  1WH9 A;  2PN2 A;  3R9W A;  2M5H A;  4KTV A;  1MKY A;  4BC9 A;  3TR3 A;  5BSR A;  5BSW A;  2Z51 A;  4GXR A;  4JI8 C;  1PG4 A;  4JI3 C;  4DCV A;  5A2Q D;  5LMU C;  3E7W A;  4LF7 C;  2V7B A;  5BUS A;  1YJ7 A;  3O2E A;  4LF6 C;  4DR6 C;  2ZZM A;  3PBK A;  2DYJ A;  4IZ6 A;  4RMN A;  1LCI A;  2BH1 X;  4OXI A;  2QW0 X;  2KZF A;  2D28 C;  1XMO C;  4KHP C;  4R1M A;  2VQF C;  4X65 C;  4FUT A;  3VNQ A;  2P2F A;  1N2F A;  4PUG A;  3A25 A;  1KKG A;  5BSV A;  1RY2 A;  5KEI A;  2QVX X;  3NYR A;  4NDN A;  1NYE A;  4LFA C;  4AQY C;  4LFB C;  3TDE A;  2HJG A;  1XRA A;  4DUZ C;  2PRO A;  2MCQ A;  4LE5 A;  2CXC A;  5CZX A;  4PZP A;  5K85 A;  4DV2 C;  4KTT A;  2OO4 A;  5JRH A;  2CY1 A;  4DR7 C;  3ETO A;  4B3T C;  1XRC A;  1XNQ C;  5H9U A;  1XS3 A;  3GKU A;  1N36 C;  2E8E A;  1NY8 A;  3GR1 A;  4ODJ A;  5IT9 D;  1ULT A;  4B3M C;  2P2M A;  1UWD A;  3TQI A;  3DLP X; 
#chains in the Genus database with same CATH homology
 4WV3 A;  5FLX D;  2YWC A;  3CW9 A;  3NI2 A;  4L7I A;  3FCC A;  4D4G A;  1XMQ C;  1FUG A;  4DG8 A;  4BSZ A;  4XX2 A;  4IR7 A;  2UUB C;  3FCE A;  4JI2 C;  4DV1 C;  1MDF A;  3I07 A;  1GPM A;  2E8F A;  5T8T A;  1LQL A;  2UXB C;  3AF5 A;  2BJO A;  3LGX A;  4FTF A;  1UKK A;  1QM4 A;  4DCU A;  3H2T A;  5LMN C;  3EQ6 A;  1J5E C;  3KXW A;  1WF3 A;  3J7A D;  3OTO C;  3R44 A;  4DV4 C;  4DR5 C;  5E7Q A;  3ETC A;  4DR4 C;  1MD9 A;  3CJE A;  3PES A;  2OBV A;  4DR2 C;  1V26 A;  4K0B A;  5T8S A;  1N34 C;  2VQE C;  3PRO C;  4WS9 A;  4JI5 C;  4DUY C;  4JI1 C;  5BSM A;  1HH2 P;  4GXQ A;  1O90 A;  1IBK C;  2EGT A;  3LUS A;  3UZ0 A;  5A1G A;  4OX9 C;  1T5H X;  3DHV A;  4D4I A;  2YCB A;  4JI4 C;  4TPS B;  2P2B A;  3TUF A;  4JV5 C;  3DAY A;  4LF4 C;  3RV2 A;  4HPV A;  2ATW A;  4G1I A;  2UUC C;  2F4V C;  4I9F A;  4DR3 C;  3IPL A;  4L4Q A;  3B7W A;  1P7L A;  1VLA A;  1O92 A;  4K0K C;  5AE2 A;  4JYA C;  2P2Q A;  2P02 A;  2UXC C;  2D1Q A;  5BR8 C;  4GKJ C;  4R0M A;  3NYQ A;  1V25 A;  4BBY A;  4DV0 C;  1L2F A;  4LF8 C;  1K0R A;  1AMU A;  3S82 A;  4G37 A;  4DR1 C;  4GKK C;  4DCT A;  5IWA C;  2Y27 A;  2UXD C;  3R9X A;  3RG2 A;  1ZB9 A;  3UOW A;  4PRO C;  3T1H C;  3C5E A;  4RM3 A;  3GPC A;  4BC7 A;  2P2J A;  3I08 A;  3A4I A;  2ZM6 C;  3JAM D;  2D27 A;  1HNX C;  4RLF A;  5AE3 A;  5BST A;  4G36 A;  4LF9 C;  4MH4 A;  5A1I A;  3J81 D;  2P20 A;  1ZB8 A;  5KYT A;  1MXB A;  1MXC A;  1N33 C;  1RG9 A;  4YHH C;  4RM2 A;  5GTD A;  4RVO A;  3J80 D;  2D7V A;  1IBM C;  1USP A;  4DV7 C;  2PT7 G;  2HHH C;  1XNR C;  2AYA A;  5IFI A;  4X64 C;  2VZE A;  3IML A;  2D1T A;  3E7X A;  4DCS A;  2VSQ A;  5ADZ A;  2E8C A;  4GS5 A;  4JI6 C;  2OPL A;  2WD9 A;  1QWI A;  1T5D X;  4DV5 C;  4BCA A;  4RLQ A;  2Y4O A;  4RVN A;  2DPL A;  1EGA A;  4DG9 A;  4OYC A;  2QVZ X;  3VNR A;  3IEV A;  2XR1 A;  4EAT A;  3LNV A;  4D57 A;  1PA4 A;  2E5L C;  2Y4N A;  1MDB A;  3NPD A;  4R1L A;  1O9T A;  2ONF A;  1USP B;  4ZLP A;  4JI0 C;  1HNW C;  2UU9 C;  1N32 C;  4I9G A;  4LF5 C;  5CZV A;  2JMP A;  2WP0 C;  5A19 A;  1O93 A;  1PG3 A;  3A9U A;  5DV9 A;  2E7G A;  3LAX A;  1I94 C;  2OPL B;  5AE1 A;  1IBL C;  3T1Y C;  3L95 X;  3IEU A;  4ZJZ A;  4JM1 A;  3A9V A;  5KYV A;  5K8F A;  4NXN C;  4NOZ A;  4B3S C;  1BA3 A;  4X66 C;  3EER A;  4D56 A;  1HR0 C;  4U5Y D;  4DV6 C;  4B3R C;  4NXM C;  2YWB A;  3AF6 A;  3CW8 X;  1MXA A;  4X62 C;  3N2Q A;  4ISB A;  3GR0 A;  5BSU A;  4DV3 C;  1FJG C;  3L8C A;  5BUR A;  4YY3 C;  2E0G A;  1JOS A;  1ML8 A;  2ASB A;  3SO4 A;  3VNS A;  4LFC C;  2D1R A;  4MTN A;  4PHT A;  4JI7 C;  2UUA C;  1XRB A;  2QL8 A;  2QVY X;  4FUQ A;  4L2Z A;  5BUQ A;  2D1S A;  3G7S A;  1HNZ C;  3N54 B;  1WH9 A;  2PN2 A;  3R9W A;  4KTV A;  1MKY A;  4BC9 A;  5BSR A;  5BSW A;  4GXR A;  4JI8 C;  1PG4 A;  4JI3 C;  4DCV A;  5A2Q D;  5LMU C;  3E7W A;  4LF7 C;  2V7B A;  5BUS A;  1YJ7 A;  4LF6 C;  4DR6 C;  3PBK A;  2DYJ A;  4IZ6 A;  4RMN A;  1LCI A;  2BH1 X;  4OXI A;  2QW0 X;  2KZF A;  2D28 C;  1XMO C;  4KHP C;  4R1M A;  2VQF C;  4X65 C;  4FUT A;  3VNQ A;  2P2F A;  1N2F A;  1KKG A;  5BSV A;  1RY2 A;  5KEI A;  2QVX X;  3NYR A;  4NDN A;  1NYE A;  4LFA C;  4AQY C;  4LFB C;  3TDE A;  2HJG A;  1XRA A;  4DUZ C;  2PRO A;  4LE5 A;  2CXC A;  5CZX A;  4PZP A;  5K85 A;  4DV2 C;  4KTT A;  2OO4 A;  5JRH A;  2CY1 A;  4DR7 C;  3ETO A;  4B3T C;  1XRC A;  1XNQ C;  5H9U A;  3GKU A;  1N36 C;  2E8E A;  3GR1 A;  4ODJ A;  5IT9 D;  1ULT A;  4B3M C;  2P2M A;  3TQI A;  3DLP X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...