4LF4C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 47
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf4C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf4C02
4LFAC 2JMPA 3AF6A 4X64C 1L2FA 1VLAA 3IEUA 1IBLC 5FLXD 4LF5C 4LF9C 1ML8A 1USPB 2VQEC 4NOZA 2E8EA 2HJGA 3J7AD 4JI7C 1XMOC 4DV2C 4K0KC 4DV0C 3T1HC 4JI0C 3JAMD 2UUCC 2PN2A 3T1YC 2ASBA 2VQFC 2KZFA 4X62C 4LFBC 4DCTA 1IBKC 1ZB8A 1XNQC 1PA4A 1KKGA 5BR8C 4B3RC 2OPLA 4X65C 4DCSA 4DR5C 1HH2P 4DV1C 4DV7C 3J81D 5IT9D 2E7GA 4LF6C 4DR4C 2UXDC 4JI8C 4KHPC 4DCUA 4JI3C 4DV5C 4DCVA 2D7VA 3J80D 1EGAA 1FJGC 4X66C 4OX9C 2ATWA 4NXNC 2HHHC 4MH4A 3AF5A 4DR7C 4YY3C 1IBMC 1JOSA 4LF8C 1I94C 5IWAC 2UXCC 1UKKA 2E8FA 3EERA 4NXMC 1XMQC 3R9XA 2CY1A 3I07A 1N32C 4B3MC 4JYAC 5LMNC 1HR0C 4JI6C 4DR6C 1USPA 5A2QD 2XR1A 3IEVA 1WF3A 1N33C 4DUYC 4DUZC 4JI4C 2UUBC 2EGTA 2UUAC 4MTNA 2F4VC 1NYEA 4LF4C 1HNWC 4JI5C 3GKUA 1ZB9A 4AQYC 4LFCC 1XNRC 2PT7G 4BSZA 1K0RA 3R9WA 2QL8A 2DYJA 4DR2C 1HNXC 1N34C 4JI2C 2OPLB 2ONFA 4JV5C 4DV6C 4DR1C 2E8CA 4DV4C 1HNZC 1QWIA 4LF7C 4GKJC 1J5EC 4YHHC 4DV3C 4GKKC 1N2FA 3OTOC 5LMUC 2ZM6C 1MKYA 1WH9A 3LUSA 1N36C 2CXCA 2E5LC 2UU9C 4XX2A 2YCBA 4B3SC 1LQLA 2BJOA 2UXBC 4B3TC 3CJEA 4JI1C 4DR3C
chains in the Genus database with same CATH superfamily
3I08A 2QVYX 1YGTA 3AF6A 1L2FA 3IEUA 5DV9A 1IBLC 4LF5C 5KYTA 1P4EA 4NOZA 2D28C 1T5HX 1XMOC 2Y27A 4BC9A 4DV2C 3K6RA 3VNQA 3T1YC 4G37A 2VQFC 3S82A 4DCTA 5H9UA 5AE3A 1WCJA 1IBKC 5BR8C 4B3RC 3A4IA 4OXIA 5K8FA 4DV1C 1T5DX 3FCEA 3A26A 4DR4C 2VSQA 1QM4A 4DV5C 4R1MA 3TDEA 5BSMA 3E7XA 4PROC 4GXRA 2MM9A 2ATWA 2ZTBA 4HPVA 1JOSA 3VNSA 1I94C 1V25A 2E8FA 4IR7A 4GXQA 3R9XA 4PHTA 3I07A 3IPLA 4JYAC 2WD9A 4D4GA 1FLOA 4ISBA 2KZ0A 2UUBC 2F4VC 4JI5C 3GKUA 1XNRC 2PT7G 1K0RA 4ZJZA 2D27A 3L8CA 2ONFA 3PBKA 2Z51A 4DV4C 3G7SA 3CQ3A 1XRAA 5CZXA 1O90A 1J5EC 1MXBA 1FUGA 5AE1A 1XS3A 4DG9A 1MKYA 3PESA 1MD9A 5BSTA 3EQ6A 3LUSA 5T8SA 1XDXA 3A9VA 2BJOA 5KYVA 3NI2A 4B3TC 4JI1C 4DR3C 3R9WA 4R0MA 4RLFA 2PROA 4OYCA 1MXAA 5A1GA 1XHJA 2VQEC 3NYRA 2HJGA 1M6XA 2CU6A 1PG3A 4JI0C 2UUCC 3KXWA 2ASBA 3GPCA 4PUGA 5A19A 4LFBC 1V60A 4ZLPA 1ZB8A 1XNQC 3UEBA 1TH5A 5CZVA 5BURA 2P02A 1HH2P 3NYQA 4RMNA 4BCAA 4BC7A 4DV7C 3FCCA 2E7GA 3B7WA 5IT9D 2UXDC 4JI8C 4KHPC 4JI3C 4DCVA 3IMLA 1LCIA 3J80D 1FJGC 3GR0A 3CQ1A 4WV3A 1M6XC 4ODJA 4DR7C 4LF8C 3UX3A 5IWAC 3CW8X 5K85A 3EERA 3SO4A 3H2TA 4NXMC 2CY1A 3VNRA 4B3MC 2ZZNA 3PROC 4D57A 5LMNC 1HR0C 4JM1A 5BUQA 4JI6C 3R44A 2AYAA 4RVNA 3IEVA 4DUYC 1O93A 5BSUA 4JI4C 1P4EC 2UUAC 2Y4OA 3TR3A 4PZPA 1NYEA 3UX2A 1HNWC 2P2JA 4RVOA 4AQYC 4KTVA 2QL8A 5A1IA 4DR2C 2OPLB 4LE5A 1MDBA 3UOWA 5E7QA 1HNZC 4FTFA 2M5HA 4LF7C 4GKJC 4D56A 4DV3C 4FUTA 2E0GA 4GKKC 1N2FA 5LMUC 5AE2A 4IZ6A 3ETCA 2E5LC 2UU9C 4B3SC 2YCBA 3AY0A 3FM7A 4FUQA 2NCLA 2P2BA 4X64C 4PUIA 1VLAA 4DG8A 3LAXA 4L4QA 4U5YD 1ML8A 1USPB 2E8EA 3J7AD 4JI7C 4K0KC 4DV0C 3JAMD 1YJ7A 2KZFA 2DPLA 2P2QA 3NPDA 1KKGA 4DR5C 2YWBA 1P7LA 3J81D 4LF6C 4DCUA 2D7VA 1O9TA 5IFIA 4NXNC 2HHHC 4MH4A 1MXCA 1MDFA 4RM3A 1V26A 5GTDA 1XRBA 2OO4A 1UKKA 2P20A 3GR1A 4L2ZA 1XMQC 2JNVA 2MMAB 4RM2A 1IB8A 4DR6C 5A2QD 5JRHA 1N33C 4WS9A 3A9UA 4DUZC 5BUSA 2EGTA 3C5EA 4PUHA 3TQIA 4LFCC 4BSZA 1PG4A 1HNXC 4JI2C 4DV6C 4I9GA 5LCIA 2E8CA 3N2QA 5BSVA 3O2EA 3DAYA 3OTOC 5BSRA 2ZM6C 1O92A 2QVZX 2V7BA 4XX2A 1ULTA 4BBYA 3RG2A 5T8TA 1XRCA 3CJEA 3N54B 5KEIA 4LFAC 2JMPA 5FLXD 4TPSB 2YX1A 4LF9C 3DHVA 4RLQA 3T1HC 4NDNA 3LNVA 3CQ2A 2PN2A 3CW9A 2WP0C 4X62C 1PA4A 2OPLA 4DCSA 4X65C 2D1QA 3TUFA 3ETOA 2KDNA 2DHMA 1EGAA 4X66C 5BSWA 4OX9C 5ADZA 2D1SA 2QW0X 3AF5A 3DLPX 4YY3C 1IBMC 2PG1E 2UXCC 2ZZMA 4D4IA 4I9FA 2Y4NA 3A25A 3E7WA 3L95X 1RY2A 4EATA 1N32C 4GS5A 4KTTA 1USPA 2XR1A 4R1LA 1WF3A 2BH1X 1AMUA 4G36A 1BA3A 4L7IA 4MTNA 4LF4C 1ZB9A 2P2FA 2OBVA 2P2MA 4G1IA 2QVXX 3LNOA 2DYJA 1N34C 2VZEA 3UZ0A 4JV5C 4DR1C 4K0BA 1QWIA 1NY8A 1PU1A 4YHHC 3RV2A 1GPMA 1RG9A 1UWDA 1WH9A 1N36C 2CXCA 2MCQA 1LQLA 2D1TA 2UXBC 1VEHA 2D1RA 2YWCA 3LGXA 2M5OA
chains in the Genus database with same CATH topology
3I08A 2QVYX 3AF6A 1L2FA 3IEUA 5DV9A 1IBLC 4LF5C 5KYTA 4NOZA 2D28C 1T5HX 1XMOC 2Y27A 4BC9A 4DV2C 3VNQA 3T1YC 4G37A 2VQFC 3S82A 4DCTA 5H9UA 5AE3A 1IBKC 5BR8C 4B3RC 3A4IA 4OXIA 5K8FA 4DV1C 1T5DX 3FCEA 4DR4C 2VSQA 1QM4A 4DV5C 4R1MA 3TDEA 5BSMA 3E7XA 4PROC 4GXRA 2ATWA 4HPVA 1JOSA 3VNSA 1I94C 1V25A 2E8FA 4IR7A 4GXQA 3R9XA 4PHTA 3I07A 3IPLA 4JYAC 2WD9A 4D4GA 4ISBA 2UUBC 2F4VC 4JI5C 3GKUA 1XNRC 2PT7G 1K0RA 4ZJZA 2D27A 3L8CA 2ONFA 3PBKA 4DV4C 3G7SA 1XRAA 5CZXA 1O90A 1J5EC 1MXBA 1FUGA 5AE1A 4DG9A 1MKYA 3PESA 1MD9A 5BSTA 3EQ6A 3LUSA 5T8SA 3A9VA 2BJOA 5KYVA 3NI2A 4B3TC 4JI1C 4DR3C 3R9WA 4R0MA 4RLFA 2PROA 4OYCA 1MXAA 5A1GA 2VQEC 3NYRA 2HJGA 1PG3A 4JI0C 2UUCC 3KXWA 2ASBA 3GPCA 5A19A 4LFBC 4ZLPA 1ZB8A 1XNQC 5CZVA 5BURA 2P02A 1HH2P 3NYQA 4RMNA 4BCAA 4BC7A 4DV7C 3FCCA 2E7GA 3B7WA 5IT9D 2UXDC 4JI8C 4KHPC 4JI3C 4DCVA 3IMLA 1LCIA 3J80D 1FJGC 3GR0A 4WV3A 4ODJA 4DR7C 4LF8C 5IWAC 3CW8X 5K85A 3EERA 3SO4A 3H2TA 4NXMC 2CY1A 3VNRA 4B3MC 3PROC 4D57A 5LMNC 1HR0C 4JM1A 5BUQA 4JI6C 3R44A 2AYAA 4RVNA 3IEVA 4DUYC 1O93A 5BSUA 4JI4C 2UUAC 2Y4OA 4PZPA 1NYEA 1HNWC 2P2JA 4RVOA 4AQYC 4KTVA 2QL8A 5A1IA 4DR2C 2OPLB 4LE5A 1MDBA 3UOWA 5E7QA 1HNZC 4FTFA 4LF7C 4GKJC 4D56A 4DV3C 4FUTA 2E0GA 4GKKC 1N2FA 5LMUC 5AE2A 4IZ6A 3ETCA 4B3SC 2E5LC 2UU9C 2YCBA 4FUQA 2P2BA 4X64C 1VLAA 4DG8A 3LAXA 4L4QA 4U5YD 1ML8A 1USPB 2E8EA 3J7AD 4JI7C 4K0KC 4DV0C 3JAMD 1YJ7A 2KZFA 2DPLA 2P2QA 3NPDA 1KKGA 4DR5C 2YWBA 1P7LA 3J81D 4LF6C 4DCUA 2D7VA 1O9TA 5IFIA 4NXNC 2HHHC 4MH4A 1MXCA 1MDFA 4RM3A 1V26A 5GTDA 1XRBA 2OO4A 1UKKA 2P20A 3GR1A 4L2ZA 1XMQC 4RM2A 4DR6C 5A2QD 5JRHA 1N33C 4WS9A 3A9UA 4DUZC 5BUSA 2EGTA 3C5EA 3TQIA 4LFCC 4BSZA 1PG4A 1HNXC 4JI2C 4DV6C 4I9GA 2E8CA 3N2QA 5BSVA 3DAYA 3OTOC 5BSRA 2ZM6C 1O92A 2QVZX 2V7BA 4XX2A 1ULTA 4BBYA 3RG2A 5T8TA 1XRCA 3CJEA 3N54B 5KEIA 4LFAC 2JMPA 5FLXD 4TPSB 4LF9C 3DHVA 4RLQA 3T1HC 4NDNA 3LNVA 2PN2A 3CW9A 2WP0C 4X62C 1PA4A 2OPLA 4DCSA 4X65C 2D1QA 3TUFA 3ETOA 1EGAA 4X66C 5BSWA 4OX9C 5ADZA 2D1SA 2QW0X 3AF5A 3DLPX 4YY3C 1IBMC 2UXCC 4D4IA 4I9FA 2Y4NA 3E7WA 3L95X 1RY2A 4EATA 1N32C 4GS5A 4KTTA 1USPA 2XR1A 4R1LA 1WF3A 2BH1X 1AMUA 4G36A 1BA3A 4L7IA 4MTNA 4LF4C 1ZB9A 2P2FA 2OBVA 2P2MA 4G1IA 2QVXX 2DYJA 1N34C 2VZEA 3UZ0A 4JV5C 4DR1C 4K0BA 1QWIA 4YHHC 3RV2A 1GPMA 1RG9A 1WH9A 1N36C 2CXCA 1LQLA 2D1TA 2UXBC 2D1RA 2YWCA 3LGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA C;  2JMP A;  3AF6 A;  4X64 C;  1L2F A;  1VLA A;  3IEU A;  1IBL C;  5FLX D;  4LF5 C;  4LF9 C;  1ML8 A;  1USP B;  2VQE C;  4NOZ A;  2E8E A;  2HJG A;  3J7A D;  4JI7 C;  1XMO C;  4DV2 C;  4K0K C;  4DV0 C;  3T1H C;  4JI0 C;  3JAM D;  2UUC C;  2PN2 A;  3T1Y C;  2ASB A;  2VQF C;  2KZF A;  4X62 C;  4LFB C;  4DCT A;  1IBK C;  1ZB8 A;  1XNQ C;  1PA4 A;  1KKG A;  5BR8 C;  4B3R C;  2OPL A;  4X65 C;  4DCS A;  4DR5 C;  1HH2 P;  4DV1 C;  4DV7 C;  3J81 D;  5IT9 D;  2E7G A;  4LF6 C;  4DR4 C;  2UXD C;  4JI8 C;  4KHP C;  4DCU A;  4JI3 C;  4DV5 C;  4DCV A;  2D7V A;  3J80 D;  1EGA A;  1FJG C;  4X66 C;  4OX9 C;  2ATW A;  4NXN C;  2HHH C;  4MH4 A;  3AF5 A;  4DR7 C;  4YY3 C;  1IBM C;  1JOS A;  4LF8 C;  1I94 C;  5IWA C;  2UXC C;  1UKK A;  2E8F A;  3EER A;  4NXM C;  1XMQ C;  3R9X A;  2CY1 A;  3I07 A;  1N32 C;  4B3M C;  4JYA C;  5LMN C;  1HR0 C;  4JI6 C;  4DR6 C;  1USP A;  5A2Q D;  2XR1 A;  3IEV A;  1WF3 A;  1N33 C;  4DUY C;  4DUZ C;  4JI4 C;  2UUB C;  2EGT A;  2UUA C;  4MTN A;  2F4V C;  1NYE A;  4LF4 C;  1HNW C;  4JI5 C;  3GKU A;  1ZB9 A;  4AQY C;  4LFC C;  1XNR C;  2PT7 G;  4BSZ A;  1K0R A;  3R9W A;  2QL8 A;  2DYJ A;  4DR2 C;  1HNX C;  1N34 C;  4JI2 C;  2OPL B;  2ONF A;  4JV5 C;  4DV6 C;  4DR1 C;  2E8C A;  4DV4 C;  1HNZ C;  1QWI A;  4LF7 C;  4GKJ C;  1J5E C;  4YHH C;  4DV3 C;  4GKK C;  1N2F A;  3OTO C;  5LMU C;  2ZM6 C;  1MKY A;  1WH9 A;  3LUS A;  1N36 C;  2CXC A;  2E5L C;  2UU9 C;  4XX2 A;  2YCB A;  4B3S C;  1LQL A;  2BJO A;  2UXB C;  4B3T C;  3CJE A;  4JI1 C;  4DR3 C; 
#chains in the Genus database with same CATH topology
 3I08 A;  2QVY X;  1YGT A;  3AF6 A;  1L2F A;  3IEU A;  5DV9 A;  1IBL C;  4LF5 C;  5KYT A;  1P4E A;  4NOZ A;  2D28 C;  1T5H X;  1XMO C;  2Y27 A;  4BC9 A;  4DV2 C;  3K6R A;  3VNQ A;  3T1Y C;  4G37 A;  2VQF C;  3S82 A;  4DCT A;  5H9U A;  5AE3 A;  1WCJ A;  1IBK C;  5BR8 C;  4B3R C;  3A4I A;  4OXI A;  5K8F A;  4DV1 C;  1T5D X;  3FCE A;  3A26 A;  4DR4 C;  2VSQ A;  1QM4 A;  4DV5 C;  4R1M A;  3TDE A;  5BSM A;  3E7X A;  4PRO C;  4GXR A;  2MM9 A;  2ATW A;  2ZTB A;  4HPV A;  1JOS A;  3VNS A;  1I94 C;  1V25 A;  2E8F A;  4IR7 A;  4GXQ A;  3R9X A;  4PHT A;  3I07 A;  3IPL A;  4JYA C;  2WD9 A;  4D4G A;  1FLO A;  4ISB A;  2KZ0 A;  2UUB C;  2F4V C;  4JI5 C;  3GKU A;  1XNR C;  2PT7 G;  1K0R A;  4ZJZ A;  2D27 A;  3L8C A;  2ONF A;  3PBK A;  2Z51 A;  4DV4 C;  3G7S A;  3CQ3 A;  1XRA A;  5CZX A;  1O90 A;  1J5E C;  1MXB A;  1FUG A;  5AE1 A;  1XS3 A;  4DG9 A;  1MKY A;  3PES A;  1MD9 A;  5BST A;  3EQ6 A;  3LUS A;  5T8S A;  1XDX A;  3A9V A;  2BJO A;  5KYV A;  3NI2 A;  4B3T C;  4JI1 C;  4DR3 C;  3R9W A;  4R0M A;  4RLF A;  2PRO A;  4OYC A;  1MXA A;  5A1G A;  1XHJ A;  2VQE C;  3NYR A;  2HJG A;  1M6X A;  2CU6 A;  1PG3 A;  4JI0 C;  2UUC C;  3KXW A;  2ASB A;  3GPC A;  4PUG A;  5A19 A;  4LFB C;  1V60 A;  4ZLP A;  1ZB8 A;  1XNQ C;  3UEB A;  1TH5 A;  5CZV A;  5BUR A;  2P02 A;  1HH2 P;  3NYQ A;  4RMN A;  4BCA A;  4BC7 A;  4DV7 C;  3FCC A;  2E7G A;  3B7W A;  5IT9 D;  2UXD C;  4JI8 C;  4KHP C;  4JI3 C;  4DCV A;  3IML A;  1LCI A;  3J80 D;  1FJG C;  3GR0 A;  3CQ1 A;  4WV3 A;  1M6X C;  4ODJ A;  4DR7 C;  4LF8 C;  3UX3 A;  5IWA C;  3CW8 X;  5K85 A;  3EER A;  3SO4 A;  3H2T A;  4NXM C;  2CY1 A;  3VNR A;  4B3M C;  2ZZN A;  3PRO C;  4D57 A;  5LMN C;  1HR0 C;  4JM1 A;  5BUQ A;  4JI6 C;  3R44 A;  2AYA A;  4RVN A;  3IEV A;  4DUY C;  1O93 A;  5BSU A;  4JI4 C;  1P4E C;  2UUA C;  2Y4O A;  3TR3 A;  4PZP A;  1NYE A;  3UX2 A;  1HNW C;  2P2J A;  4RVO A;  4AQY C;  4KTV A;  2QL8 A;  5A1I A;  4DR2 C;  2OPL B;  4LE5 A;  1MDB A;  3UOW A;  5E7Q A;  1HNZ C;  4FTF A;  2M5H A;  4LF7 C;  4GKJ C;  4D56 A;  4DV3 C;  4FUT A;  2E0G A;  4GKK C;  1N2F A;  5LMU C;  5AE2 A;  4IZ6 A;  3ETC A;  2E5L C;  2UU9 C;  4B3S C;  2YCB A;  3AY0 A;  3FM7 A;  4FUQ A;  2NCL A;  2P2B A;  4X64 C;  4PUI A;  1VLA A;  4DG8 A;  3LAX A;  4L4Q A;  4U5Y D;  1ML8 A;  1USP B;  2E8E A;  3J7A D;  4JI7 C;  4K0K C;  4DV0 C;  3JAM D;  1YJ7 A;  2KZF A;  2DPL A;  2P2Q A;  3NPD A;  1KKG A;  4DR5 C;  2YWB A;  1P7L A;  3J81 D;  4LF6 C;  4DCU A;  2D7V A;  1O9T A;  5IFI A;  4NXN C;  2HHH C;  4MH4 A;  1MXC A;  1MDF A;  4RM3 A;  1V26 A;  5GTD A;  1XRB A;  2OO4 A;  1UKK A;  2P20 A;  3GR1 A;  4L2Z A;  1XMQ C;  2JNV A;  2MMA B;  4RM2 A;  1IB8 A;  4DR6 C;  5A2Q D;  5JRH A;  1N33 C;  4WS9 A;  3A9U A;  4DUZ C;  5BUS A;  2EGT A;  3C5E A;  4PUH A;  3TQI A;  4LFC C;  4BSZ A;  1PG4 A;  1HNX C;  4JI2 C;  4DV6 C;  4I9G A;  5LCI A;  2E8C A;  3N2Q A;  5BSV A;  3O2E A;  3DAY A;  3OTO C;  5BSR A;  2ZM6 C;  1O92 A;  2QVZ X;  2V7B A;  4XX2 A;  1ULT A;  4BBY A;  3RG2 A;  5T8T A;  1XRC A;  3CJE A;  3N54 B;  5KEI A;  4LFA C;  2JMP A;  5FLX D;  4TPS B;  2YX1 A;  4LF9 C;  3DHV A;  4RLQ A;  3T1H C;  4NDN A;  3LNV A;  3CQ2 A;  2PN2 A;  3CW9 A;  2WP0 C;  4X62 C;  1PA4 A;  2OPL A;  4DCS A;  4X65 C;  2D1Q A;  3TUF A;  3ETO A;  2KDN A;  2DHM A;  1EGA A;  4X66 C;  5BSW A;  4OX9 C;  5ADZ A;  2D1S A;  2QW0 X;  3AF5 A;  3DLP X;  4YY3 C;  1IBM C;  2PG1 E;  2UXC C;  2ZZM A;  4D4I A;  4I9F A;  2Y4N A;  3A25 A;  3E7W A;  3L95 X;  1RY2 A;  4EAT A;  1N32 C;  4GS5 A;  4KTT A;  1USP A;  2XR1 A;  4R1L A;  1WF3 A;  2BH1 X;  1AMU A;  4G36 A;  1BA3 A;  4L7I A;  4MTN A;  4LF4 C;  1ZB9 A;  2P2F A;  2OBV A;  2P2M A;  4G1I A;  2QVX X;  3LNO A;  2DYJ A;  1N34 C;  2VZE A;  3UZ0 A;  4JV5 C;  4DR1 C;  4K0B A;  1QWI A;  1NY8 A;  1PU1 A;  4YHH C;  3RV2 A;  1GPM A;  1RG9 A;  1UWD A;  1WH9 A;  1N36 C;  2CXC A;  2MCQ A;  1LQL A;  2D1T A;  2UXB C;  1VEH A;  2D1R A;  2YWC A;  3LGX A;  2M5O A; 
#chains in the Genus database with same CATH homology
 3I08 A;  2QVY X;  3AF6 A;  1L2F A;  3IEU A;  5DV9 A;  1IBL C;  4LF5 C;  5KYT A;  4NOZ A;  2D28 C;  1T5H X;  1XMO C;  2Y27 A;  4BC9 A;  4DV2 C;  3VNQ A;  3T1Y C;  4G37 A;  2VQF C;  3S82 A;  4DCT A;  5H9U A;  5AE3 A;  1IBK C;  5BR8 C;  4B3R C;  3A4I A;  4OXI A;  5K8F A;  4DV1 C;  1T5D X;  3FCE A;  4DR4 C;  2VSQ A;  1QM4 A;  4DV5 C;  4R1M A;  3TDE A;  5BSM A;  3E7X A;  4PRO C;  4GXR A;  2ATW A;  4HPV A;  1JOS A;  3VNS A;  1I94 C;  1V25 A;  2E8F A;  4IR7 A;  4GXQ A;  3R9X A;  4PHT A;  3I07 A;  3IPL A;  4JYA C;  2WD9 A;  4D4G A;  4ISB A;  2UUB C;  2F4V C;  4JI5 C;  3GKU A;  1XNR C;  2PT7 G;  1K0R A;  4ZJZ A;  2D27 A;  3L8C A;  2ONF A;  3PBK A;  4DV4 C;  3G7S A;  1XRA A;  5CZX A;  1O90 A;  1J5E C;  1MXB A;  1FUG A;  5AE1 A;  4DG9 A;  1MKY A;  3PES A;  1MD9 A;  5BST A;  3EQ6 A;  3LUS A;  5T8S A;  3A9V A;  2BJO A;  5KYV A;  3NI2 A;  4B3T C;  4JI1 C;  4DR3 C;  3R9W A;  4R0M A;  4RLF A;  2PRO A;  4OYC A;  1MXA A;  5A1G A;  2VQE C;  3NYR A;  2HJG A;  1PG3 A;  4JI0 C;  2UUC C;  3KXW A;  2ASB A;  3GPC A;  5A19 A;  4LFB C;  4ZLP A;  1ZB8 A;  1XNQ C;  5CZV A;  5BUR A;  2P02 A;  1HH2 P;  3NYQ A;  4RMN A;  4BCA A;  4BC7 A;  4DV7 C;  3FCC A;  2E7G A;  3B7W A;  5IT9 D;  2UXD C;  4JI8 C;  4KHP C;  4JI3 C;  4DCV A;  3IML A;  1LCI A;  3J80 D;  1FJG C;  3GR0 A;  4WV3 A;  4ODJ A;  4DR7 C;  4LF8 C;  5IWA C;  3CW8 X;  5K85 A;  3EER A;  3SO4 A;  3H2T A;  4NXM C;  2CY1 A;  3VNR A;  4B3M C;  3PRO C;  4D57 A;  5LMN C;  1HR0 C;  4JM1 A;  5BUQ A;  4JI6 C;  3R44 A;  2AYA A;  4RVN A;  3IEV A;  4DUY C;  1O93 A;  5BSU A;  4JI4 C;  2UUA C;  2Y4O A;  4PZP A;  1NYE A;  1HNW C;  2P2J A;  4RVO A;  4AQY C;  4KTV A;  2QL8 A;  5A1I A;  4DR2 C;  2OPL B;  4LE5 A;  1MDB A;  3UOW A;  5E7Q A;  1HNZ C;  4FTF A;  4LF7 C;  4GKJ C;  4D56 A;  4DV3 C;  4FUT A;  2E0G A;  4GKK C;  1N2F A;  5LMU C;  5AE2 A;  4IZ6 A;  3ETC A;  4B3S C;  2E5L C;  2UU9 C;  2YCB A;  4FUQ A;  2P2B A;  4X64 C;  1VLA A;  4DG8 A;  3LAX A;  4L4Q A;  4U5Y D;  1ML8 A;  1USP B;  2E8E A;  3J7A D;  4JI7 C;  4K0K C;  4DV0 C;  3JAM D;  1YJ7 A;  2KZF A;  2DPL A;  2P2Q A;  3NPD A;  1KKG A;  4DR5 C;  2YWB A;  1P7L A;  3J81 D;  4LF6 C;  4DCU A;  2D7V A;  1O9T A;  5IFI A;  4NXN C;  2HHH C;  4MH4 A;  1MXC A;  1MDF A;  4RM3 A;  1V26 A;  5GTD A;  1XRB A;  2OO4 A;  1UKK A;  2P20 A;  3GR1 A;  4L2Z A;  1XMQ C;  4RM2 A;  4DR6 C;  5A2Q D;  5JRH A;  1N33 C;  4WS9 A;  3A9U A;  4DUZ C;  5BUS A;  2EGT A;  3C5E A;  3TQI A;  4LFC C;  4BSZ A;  1PG4 A;  1HNX C;  4JI2 C;  4DV6 C;  4I9G A;  2E8C A;  3N2Q A;  5BSV A;  3DAY A;  3OTO C;  5BSR A;  2ZM6 C;  1O92 A;  2QVZ X;  2V7B A;  4XX2 A;  1ULT A;  4BBY A;  3RG2 A;  5T8T A;  1XRC A;  3CJE A;  3N54 B;  5KEI A;  4LFA C;  2JMP A;  5FLX D;  4TPS B;  4LF9 C;  3DHV A;  4RLQ A;  3T1H C;  4NDN A;  3LNV A;  2PN2 A;  3CW9 A;  2WP0 C;  4X62 C;  1PA4 A;  2OPL A;  4DCS A;  4X65 C;  2D1Q A;  3TUF A;  3ETO A;  1EGA A;  4X66 C;  5BSW A;  4OX9 C;  5ADZ A;  2D1S A;  2QW0 X;  3AF5 A;  3DLP X;  4YY3 C;  1IBM C;  2UXC C;  4D4I A;  4I9F A;  2Y4N A;  3E7W A;  3L95 X;  1RY2 A;  4EAT A;  1N32 C;  4GS5 A;  4KTT A;  1USP A;  2XR1 A;  4R1L A;  1WF3 A;  2BH1 X;  1AMU A;  4G36 A;  1BA3 A;  4L7I A;  4MTN A;  4LF4 C;  1ZB9 A;  2P2F A;  2OBV A;  2P2M A;  4G1I A;  2QVX X;  2DYJ A;  1N34 C;  2VZE A;  3UZ0 A;  4JV5 C;  4DR1 C;  4K0B A;  1QWI A;  4YHH C;  3RV2 A;  1GPM A;  1RG9 A;  1WH9 A;  1N36 C;  2CXC A;  1LQL A;  2D1T A;  2UXB C;  2D1R A;  2YWC A;  3LGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...