4LF4C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 47
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf4C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf4C02
4B3SC 1USPA 4LF7C 2ASBA 4DCUA 1JOSA 4K0KC 4JI1C 3AF5A 2E5LC 1IBKC 1XMOC 3J81D 5LMUC 4X64C 4GKJC 1XNRC 1IBMC 2UUCC 2QL8A 4JI5C 4DCVA 4DR1C 2PT7G 3I07A 4JI6C 1HH2P 4DCSA 2UU9C 5IT9D 4OX9C 1N36C 3R9XA 2YCBA 2VQEC 2HJGA 3OTOC 4LF5C 2HHHC 4LFAC 1MKYA 1QWIA 4BSZA 1FJGC 4B3TC 1PA4A 4B3MC 4JI0C 1HR0C 2DYJA 4LFBC 1ZB9A 2CY1A 1WH9A 4JI3C 1XMQC 4X66C 5LMNC 3J7AD 2VQFC 4DV2C 2UUBC 4DV7C 4JI7C 4DCTA 5A2QD 3LUSA 2PN2A 2JMPA 4JYAC 1HNZC 4MTNA 2EGTA 1J5EC 3J80D 1N34C 3CJEA 4DV4C 4JI2C 4GKKC 4JV5C 5BR8C 2E7GA 2D7VA 5IWAC 2F4VC 5FLXD 4DR4C 2CXCA 2UXCC 4NOZA 1KKGA 1WF3A 2ATWA 4AQYC 1HNXC 1L2FA 2OPLB 1USPB 1N32C 2E8FA 4YHHC 3IEUA 1IBLC 4LF8C 4NXNC 4X65C 1ZB8A 4DV1C 3IEVA 1N2FA 4DV3C 4B3RC 4XX2A 1NYEA 4DV5C 1ML8A 1UKKA 3JAMD 4X62C 3AF6A 2BJOA 4KHPC 3GKUA 4LF9C 1K0RA 4DUYC 2UXBC 3T1YC 4DV6C 2UUAC 4DV0C 4JI8C 1EGAA 4YY3C 3T1HC 4DR3C 1XNQC 4NXMC 4DR7C 4DR6C 4DUZC 4DR2C 2E8EA 4LFCC 1VLAA 3R9WA 2ONFA 4DR5C 3EERA 4LF4C 2E8CA 2UXDC 2KZFA 4LF6C 1N33C 1I94C 4MH4A 1HNWC 2XR1A 4JI4C 2ZM6C 2OPLA 1LQLA
chains in the Genus database with same CATH superfamily
4LF7C 2QVXX 4DCUA 4WS9A 1JOSA 4JI1C 3A25A 2D27A 1XMOC 5LMUC 2QL8A 3CW8X 3PROC 3DHVA 3I07A 5CZVA 1XRCA 3I08A 4R1LA 4FUTA 2Y27A 2YCBA 2VQEC 2KDNA 4LF5C 1IB8A 4RLFA 3CQ2A 1M6XC 2NCLA 4B3TC 1HR0C 1ZB9A 2CY1A 4BC9A 2VQFC 2V7BA 3N2QA 4DV7C 4R0MA 1RG9A 3KXWA 2WD9A 4PUGA 3FM7A 3LGXA 1HNZC 2EGTA 4D57A 1WCJA 4K0BA 3J80D 4JV5C 3SO4A 2KZ0A 3UOWA 5CZXA 1XRAA 3ETOA 4ZJZA 1WF3A 2ATWA 1YGTA 2Y4NA 3VNSA 2BH1X 3IEVA 3PBKA 3CW9A 4DV3C 3UX3A 4XX2A 3IMLA 1NYEA 1O9TA 5KYVA 2YWCA 3H2TA 5DV9A 3GKUA 4DUYC 4L4QA 5LCIA 2UUAC 4I9FA 3TQIA 4YY3C 2Y4OA 3CQ3A 4NXMC 5BSWA 4DR6C 2E8EA 5AE1A 4R1MA 2ONFA 1XRBA 3A9UA 2CU6A 1I94C 4BC7A 2AYAA 2Z51A 5AE3A 4JM1A 1LQLA 4DR5C 4B3SC 4D4GA 5IFIA 3RV2A 1IBKC 4X64C 4D56A 4DG8A 1XNRC 4DR1C 2PT7G 1O90A 1PG4A 3B7WA 4JI6C 2YX1A 4HPVA 1M6XA 4RVNA 3A26A 5IT9D 1N36C 2HJGA 3OTOC 4ZLPA 4BSZA 1P4EC 3GR1A 4PZPA 3FCEA 2OBVA 1PA4A 1WH9A 4PROC 4IR7A 5A2QD 3LUSA 3GR0A 3TDEA 2WP0C 3CJEA 3NPDA 4JI2C 4GKKC 2ZZNA 3R44A 2MM9A 3VNQA 2VSQA 1MD9A 3L8CA 4NOZA 2YWBA 4AQYC 3IPLA 2OPLB 3EQ6A 4GXQA 4YHHC 3E7XA 4L2ZA 4FUQA 1IBLC 4NXNC 4DV1C 2M5HA 1PU1A 1V25A 2M5OA 2JNVA 1ML8A 3JAMD 2OO4A 3AF6A 1T5DX 2BJOA 4RVOA 4TPSB 4KHPC 2UXBC 3T1YC 3E7WA 3NYQA 1EGAA 4LE5A 5A1GA 2PG1E 4DR3C 3FCCA 1XNQC 4RLQA 3VNRA 4DUZC 3RG2A 3R9WA 4I9GA 2D1QA 5JRHA 2E8CA 2KZFA 1HNWC 5H9UA 4ODJA 4JI4C 2VZEA 3UX2A 2OPLA 1PG3A 4G1IA 4RMNA 5A1IA 1MXAA 4GKJC 3J81D 2UUCC 4JI5C 1O93A 4DCVA 1HH2P 1MXCA 1P4EA 3LAXA 4DCSA 4ISBA 4KTTA 4OX9C 3LNVA 2D1SA 1MKYA 1QWIA 2MCQA 1FJGC 4JI0C 4LFBC 1XMQC 2QW0X 5LMNC 1P7LA 2P02A 4JI7C 4DCTA 1VEHA 4RM2A 2P2MA 1AMUA 4FTFA 1J5EC 1V60A 5BUQA 1N34C 2MMAB 1XHJA 2E7GA 5BR8C 2D7VA 4DG9A 5AE2A 5IWAC 2F4VC 1LCIA 2CXCA 4G36A 1KKGA 5KEIA 1HNXC 1USPB 3G7SA 5K8FA 3IEUA 4X65C 1ZB8A 4NDNA 3K6RA 3A9VA 3S82A 4DV5C 1UKKA 2DPLA 1K0RA 4EATA 1FUGA 2ZTBA 4PUHA 3O2EA 1MDFA 1MXBA 3ETCA 2P2JA 4DR7C 4L7IA 3UEBA 4DR2C 4KTVA 1VLAA 2P2FA 1XS3A 3EERA 3L95X 2UXDC 2D1RA 3CQ1A 1UWDA 5BSVA 3LNOA 1QM4A 4MH4A 2PROA 2XR1A 2DHMA 3A4IA 1T5HX 5E7QA 2ZM6C 1USPA 2ASBA 4WV3A 4GXRA 4PUIA 5GTDA 4K0KC 3AF5A 3NYRA 5T8TA 2E5LC 1IBMC 3AY0A 1FLOA 4GS5A 3DAYA 5BSUA 5BSRA 2UU9C 3N54B 1NY8A 3R9XA 5A19A 1BA3A 1ULTA 1V26A 3NI2A 2HHHC 4LFAC 3C5EA 3GPCA 3UZ0A 3TUFA 4B3MC 2DYJA 5KYTA 4JI3C 4X66C 3J7AD 1YJ7A 4DV2C 2UUBC 2P2BA 2PN2A 5T8SA 2JMPA 5K85A 4JYAC 1GPMA 4MTNA 2P20A 4BBYA 4DV4C 4G37A 5FLXD 1MDBA 4DR4C 2UXCC 4D4IA 1L2FA 3TR3A 1N32C 2E8FA 3PESA 1RY2A 4RM3A 2P2QA 4LF8C 4OXIA 4IZ6A 1N2FA 4B3RC 1XDXA 2ZZMA 2QVZX 2D1TA 2D28C 2QVYX 4X62C 4U5YD 5BUSA 4BCAA 4LF9C 4DV6C 5BURA 4DV0C 4JI8C 3T1HC 4PHTA 5BSMA 2E0GA 3DLPX 1TH5A 4LFCC 4LF4C 5ADZA 1O92A 5BSTA 4LF6C 1N33C 4OYCA
chains in the Genus database with same CATH topology
4LF7C 2QVXX 4DCUA 4WS9A 1JOSA 4JI1C 2D27A 1XMOC 5LMUC 2QL8A 3CW8X 3PROC 3DHVA 3I07A 5CZVA 1XRCA 3I08A 4R1LA 4FUTA 2Y27A 2YCBA 2VQEC 4LF5C 4RLFA 4B3TC 1HR0C 1ZB9A 2CY1A 4BC9A 2VQFC 2V7BA 3N2QA 4DV7C 4R0MA 1RG9A 3KXWA 2WD9A 3LGXA 1HNZC 2EGTA 4D57A 4K0BA 3J80D 4JV5C 3SO4A 3UOWA 5CZXA 1XRAA 3ETOA 4ZJZA 1WF3A 2ATWA 2Y4NA 3VNSA 2BH1X 3IEVA 3PBKA 3CW9A 4DV3C 4XX2A 3IMLA 1NYEA 1O9TA 5KYVA 2YWCA 3H2TA 5DV9A 3GKUA 4DUYC 4L4QA 2UUAC 4I9FA 3TQIA 4YY3C 2Y4OA 4NXMC 5BSWA 4DR6C 2E8EA 5AE1A 2ONFA 4R1MA 1XRBA 3A9UA 1I94C 4BC7A 2AYAA 5AE3A 4JM1A 4DR5C 1LQLA 4B3SC 4D4GA 5IFIA 3RV2A 1IBKC 4X64C 4D56A 4DG8A 1XNRC 4DR1C 2PT7G 1O90A 1PG4A 3B7WA 4JI6C 4HPVA 4RVNA 5IT9D 1N36C 2HJGA 3OTOC 4ZLPA 4BSZA 3GR1A 4PZPA 3FCEA 2OBVA 1PA4A 1WH9A 4PROC 4IR7A 5A2QD 3LUSA 3GR0A 3TDEA 2WP0C 3CJEA 3NPDA 4JI2C 4GKKC 3R44A 3VNQA 2VSQA 1MD9A 3L8CA 4NOZA 2YWBA 4AQYC 3IPLA 2OPLB 3EQ6A 4GXQA 4YHHC 3E7XA 4L2ZA 4FUQA 1IBLC 4NXNC 4DV1C 1V25A 1ML8A 3JAMD 2OO4A 3AF6A 1T5DX 2BJOA 4RVOA 4TPSB 4KHPC 2UXBC 3T1YC 3E7WA 3NYQA 1EGAA 4LE5A 5A1GA 4DR3C 3FCCA 1XNQC 4RLQA 3VNRA 4DUZC 3RG2A 3R9WA 4I9GA 2D1QA 5JRHA 2E8CA 2KZFA 1HNWC 5H9UA 4ODJA 4JI4C 2VZEA 2OPLA 1PG3A 4G1IA 4RMNA 5A1IA 1MXAA 4GKJC 3J81D 2UUCC 4JI5C 1O93A 4DCVA 1HH2P 1MXCA 3LAXA 4DCSA 4ISBA 4KTTA 4OX9C 3LNVA 2D1SA 1MKYA 1QWIA 1FJGC 4JI0C 4LFBC 1XMQC 2QW0X 5LMNC 1P7LA 2P02A 4JI7C 4DCTA 4RM2A 2P2MA 1AMUA 4FTFA 1J5EC 5BUQA 1N34C 5BR8C 2E7GA 2D7VA 4DG9A 5AE2A 5IWAC 2F4VC 1LCIA 2CXCA 4G36A 1KKGA 5KEIA 1HNXC 1USPB 3G7SA 5K8FA 3IEUA 4X65C 1ZB8A 4NDNA 3A9VA 3S82A 4DV5C 1UKKA 2DPLA 1K0RA 4EATA 1FUGA 1MDFA 1MXBA 3ETCA 2P2JA 4DR7C 4L7IA 4DR2C 4KTVA 1VLAA 2P2FA 3EERA 3L95X 2UXDC 2D1RA 5BSVA 1QM4A 4MH4A 2PROA 2XR1A 3A4IA 1T5HX 5E7QA 2ZM6C 1USPA 2ASBA 4WV3A 4GXRA 5GTDA 4K0KC 3AF5A 3NYRA 5T8TA 2E5LC 1IBMC 4GS5A 3DAYA 5BSUA 5BSRA 2UU9C 3N54B 3R9XA 5A19A 1BA3A 1ULTA 1V26A 3NI2A 2HHHC 4LFAC 3C5EA 3GPCA 3UZ0A 3TUFA 4B3MC 2DYJA 5KYTA 4JI3C 4X66C 3J7AD 1YJ7A 4DV2C 2UUBC 2P2BA 2PN2A 5T8SA 2JMPA 5K85A 4JYAC 1GPMA 4MTNA 2P20A 4BBYA 4DV4C 4G37A 5FLXD 1MDBA 4DR4C 2UXCC 4D4IA 1L2FA 1N32C 2E8FA 3PESA 1RY2A 4RM3A 2P2QA 4LF8C 4OXIA 4IZ6A 1N2FA 4B3RC 2QVZX 2D1TA 2D28C 2QVYX 4X62C 4U5YD 5BUSA 4BCAA 4LF9C 4DV6C 5BURA 4DV0C 4JI8C 3T1HC 4PHTA 5BSMA 2E0GA 3DLPX 4LFCC 4LF4C 5ADZA 1O92A 5BSTA 4LF6C 1N33C 4OYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S C;  1USP A;  4LF7 C;  2ASB A;  4DCU A;  1JOS A;  4K0K C;  4JI1 C;  3AF5 A;  2E5L C;  1IBK C;  1XMO C;  3J81 D;  5LMU C;  4X64 C;  4GKJ C;  1XNR C;  1IBM C;  2UUC C;  2QL8 A;  4JI5 C;  4DCV A;  4DR1 C;  2PT7 G;  3I07 A;  4JI6 C;  1HH2 P;  4DCS A;  2UU9 C;  5IT9 D;  4OX9 C;  1N36 C;  3R9X A;  2YCB A;  2VQE C;  2HJG A;  3OTO C;  4LF5 C;  2HHH C;  4LFA C;  1MKY A;  1QWI A;  4BSZ A;  1FJG C;  4B3T C;  1PA4 A;  4B3M C;  4JI0 C;  1HR0 C;  2DYJ A;  4LFB C;  1ZB9 A;  2CY1 A;  1WH9 A;  4JI3 C;  1XMQ C;  4X66 C;  5LMN C;  3J7A D;  2VQF C;  4DV2 C;  2UUB C;  4DV7 C;  4JI7 C;  4DCT A;  5A2Q D;  3LUS A;  2PN2 A;  2JMP A;  4JYA C;  1HNZ C;  4MTN A;  2EGT A;  1J5E C;  3J80 D;  1N34 C;  3CJE A;  4DV4 C;  4JI2 C;  4GKK C;  4JV5 C;  5BR8 C;  2E7G A;  2D7V A;  5IWA C;  2F4V C;  5FLX D;  4DR4 C;  2CXC A;  2UXC C;  4NOZ A;  1KKG A;  1WF3 A;  2ATW A;  4AQY C;  1HNX C;  1L2F A;  2OPL B;  1USP B;  1N32 C;  2E8F A;  4YHH C;  3IEU A;  1IBL C;  4LF8 C;  4NXN C;  4X65 C;  1ZB8 A;  4DV1 C;  3IEV A;  1N2F A;  4DV3 C;  4B3R C;  4XX2 A;  1NYE A;  4DV5 C;  1ML8 A;  1UKK A;  3JAM D;  4X62 C;  3AF6 A;  2BJO A;  4KHP C;  3GKU A;  4LF9 C;  1K0R A;  4DUY C;  2UXB C;  3T1Y C;  4DV6 C;  2UUA C;  4DV0 C;  4JI8 C;  1EGA A;  4YY3 C;  3T1H C;  4DR3 C;  1XNQ C;  4NXM C;  4DR7 C;  4DR6 C;  4DUZ C;  4DR2 C;  2E8E A;  4LFC C;  1VLA A;  3R9W A;  2ONF A;  4DR5 C;  3EER A;  4LF4 C;  2E8C A;  2UXD C;  2KZF A;  4LF6 C;  1N33 C;  1I94 C;  4MH4 A;  1HNW C;  2XR1 A;  4JI4 C;  2ZM6 C;  2OPL A;  1LQL A; 
#chains in the Genus database with same CATH topology
 4LF7 C;  2QVX X;  4DCU A;  4WS9 A;  1JOS A;  4JI1 C;  3A25 A;  2D27 A;  1XMO C;  5LMU C;  2QL8 A;  3CW8 X;  3PRO C;  3DHV A;  3I07 A;  5CZV A;  1XRC A;  3I08 A;  4R1L A;  4FUT A;  2Y27 A;  2YCB A;  2VQE C;  2KDN A;  4LF5 C;  1IB8 A;  4RLF A;  3CQ2 A;  1M6X C;  2NCL A;  4B3T C;  1HR0 C;  1ZB9 A;  2CY1 A;  4BC9 A;  2VQF C;  2V7B A;  3N2Q A;  4DV7 C;  4R0M A;  1RG9 A;  3KXW A;  2WD9 A;  4PUG A;  3FM7 A;  3LGX A;  1HNZ C;  2EGT A;  4D57 A;  1WCJ A;  4K0B A;  3J80 D;  4JV5 C;  3SO4 A;  2KZ0 A;  3UOW A;  5CZX A;  1XRA A;  3ETO A;  4ZJZ A;  1WF3 A;  2ATW A;  1YGT A;  2Y4N A;  3VNS A;  2BH1 X;  3IEV A;  3PBK A;  3CW9 A;  4DV3 C;  3UX3 A;  4XX2 A;  3IML A;  1NYE A;  1O9T A;  5KYV A;  2YWC A;  3H2T A;  5DV9 A;  3GKU A;  4DUY C;  4L4Q A;  5LCI A;  2UUA C;  4I9F A;  3TQI A;  4YY3 C;  2Y4O A;  3CQ3 A;  4NXM C;  5BSW A;  4DR6 C;  2E8E A;  5AE1 A;  4R1M A;  2ONF A;  1XRB A;  3A9U A;  2CU6 A;  1I94 C;  4BC7 A;  2AYA A;  2Z51 A;  5AE3 A;  4JM1 A;  1LQL A;  4DR5 C;  4B3S C;  4D4G A;  5IFI A;  3RV2 A;  1IBK C;  4X64 C;  4D56 A;  4DG8 A;  1XNR C;  4DR1 C;  2PT7 G;  1O90 A;  1PG4 A;  3B7W A;  4JI6 C;  2YX1 A;  4HPV A;  1M6X A;  4RVN A;  3A26 A;  5IT9 D;  1N36 C;  2HJG A;  3OTO C;  4ZLP A;  4BSZ A;  1P4E C;  3GR1 A;  4PZP A;  3FCE A;  2OBV A;  1PA4 A;  1WH9 A;  4PRO C;  4IR7 A;  5A2Q D;  3LUS A;  3GR0 A;  3TDE A;  2WP0 C;  3CJE A;  3NPD A;  4JI2 C;  4GKK C;  2ZZN A;  3R44 A;  2MM9 A;  3VNQ A;  2VSQ A;  1MD9 A;  3L8C A;  4NOZ A;  2YWB A;  4AQY C;  3IPL A;  2OPL B;  3EQ6 A;  4GXQ A;  4YHH C;  3E7X A;  4L2Z A;  4FUQ A;  1IBL C;  4NXN C;  4DV1 C;  2M5H A;  1PU1 A;  1V25 A;  2M5O A;  2JNV A;  1ML8 A;  3JAM D;  2OO4 A;  3AF6 A;  1T5D X;  2BJO A;  4RVO A;  4TPS B;  4KHP C;  2UXB C;  3T1Y C;  3E7W A;  3NYQ A;  1EGA A;  4LE5 A;  5A1G A;  2PG1 E;  4DR3 C;  3FCC A;  1XNQ C;  4RLQ A;  3VNR A;  4DUZ C;  3RG2 A;  3R9W A;  4I9G A;  2D1Q A;  5JRH A;  2E8C A;  2KZF A;  1HNW C;  5H9U A;  4ODJ A;  4JI4 C;  2VZE A;  3UX2 A;  2OPL A;  1PG3 A;  4G1I A;  4RMN A;  5A1I A;  1MXA A;  4GKJ C;  3J81 D;  2UUC C;  4JI5 C;  1O93 A;  4DCV A;  1HH2 P;  1MXC A;  1P4E A;  3LAX A;  4DCS A;  4ISB A;  4KTT A;  4OX9 C;  3LNV A;  2D1S A;  1MKY A;  1QWI A;  2MCQ A;  1FJG C;  4JI0 C;  4LFB C;  1XMQ C;  2QW0 X;  5LMN C;  1P7L A;  2P02 A;  4JI7 C;  4DCT A;  1VEH A;  4RM2 A;  2P2M A;  1AMU A;  4FTF A;  1J5E C;  1V60 A;  5BUQ A;  1N34 C;  2MMA B;  1XHJ A;  2E7G A;  5BR8 C;  2D7V A;  4DG9 A;  5AE2 A;  5IWA C;  2F4V C;  1LCI A;  2CXC A;  4G36 A;  1KKG A;  5KEI A;  1HNX C;  1USP B;  3G7S A;  5K8F A;  3IEU A;  4X65 C;  1ZB8 A;  4NDN A;  3K6R A;  3A9V A;  3S82 A;  4DV5 C;  1UKK A;  2DPL A;  1K0R A;  4EAT A;  1FUG A;  2ZTB A;  4PUH A;  3O2E A;  1MDF A;  1MXB A;  3ETC A;  2P2J A;  4DR7 C;  4L7I A;  3UEB A;  4DR2 C;  4KTV A;  1VLA A;  2P2F A;  1XS3 A;  3EER A;  3L95 X;  2UXD C;  2D1R A;  3CQ1 A;  1UWD A;  5BSV A;  3LNO A;  1QM4 A;  4MH4 A;  2PRO A;  2XR1 A;  2DHM A;  3A4I A;  1T5H X;  5E7Q A;  2ZM6 C;  1USP A;  2ASB A;  4WV3 A;  4GXR A;  4PUI A;  5GTD A;  4K0K C;  3AF5 A;  3NYR A;  5T8T A;  2E5L C;  1IBM C;  3AY0 A;  1FLO A;  4GS5 A;  3DAY A;  5BSU A;  5BSR A;  2UU9 C;  3N54 B;  1NY8 A;  3R9X A;  5A19 A;  1BA3 A;  1ULT A;  1V26 A;  3NI2 A;  2HHH C;  4LFA C;  3C5E A;  3GPC A;  3UZ0 A;  3TUF A;  4B3M C;  2DYJ A;  5KYT A;  4JI3 C;  4X66 C;  3J7A D;  1YJ7 A;  4DV2 C;  2UUB C;  2P2B A;  2PN2 A;  5T8S A;  2JMP A;  5K85 A;  4JYA C;  1GPM A;  4MTN A;  2P20 A;  4BBY A;  4DV4 C;  4G37 A;  5FLX D;  1MDB A;  4DR4 C;  2UXC C;  4D4I A;  1L2F A;  3TR3 A;  1N32 C;  2E8F A;  3PES A;  1RY2 A;  4RM3 A;  2P2Q A;  4LF8 C;  4OXI A;  4IZ6 A;  1N2F A;  4B3R C;  1XDX A;  2ZZM A;  2QVZ X;  2D1T A;  2D28 C;  2QVY X;  4X62 C;  4U5Y D;  5BUS A;  4BCA A;  4LF9 C;  4DV6 C;  5BUR A;  4DV0 C;  4JI8 C;  3T1H C;  4PHT A;  5BSM A;  2E0G A;  3DLP X;  1TH5 A;  4LFC C;  4LF4 C;  5ADZ A;  1O92 A;  5BST A;  4LF6 C;  1N33 C;  4OYC A; 
#chains in the Genus database with same CATH homology
 4LF7 C;  2QVX X;  4DCU A;  4WS9 A;  1JOS A;  4JI1 C;  2D27 A;  1XMO C;  5LMU C;  2QL8 A;  3CW8 X;  3PRO C;  3DHV A;  3I07 A;  5CZV A;  1XRC A;  3I08 A;  4R1L A;  4FUT A;  2Y27 A;  2YCB A;  2VQE C;  4LF5 C;  4RLF A;  4B3T C;  1HR0 C;  1ZB9 A;  2CY1 A;  4BC9 A;  2VQF C;  2V7B A;  3N2Q A;  4DV7 C;  4R0M A;  1RG9 A;  3KXW A;  2WD9 A;  3LGX A;  1HNZ C;  2EGT A;  4D57 A;  4K0B A;  3J80 D;  4JV5 C;  3SO4 A;  3UOW A;  5CZX A;  1XRA A;  3ETO A;  4ZJZ A;  1WF3 A;  2ATW A;  2Y4N A;  3VNS A;  2BH1 X;  3IEV A;  3PBK A;  3CW9 A;  4DV3 C;  4XX2 A;  3IML A;  1NYE A;  1O9T A;  5KYV A;  2YWC A;  3H2T A;  5DV9 A;  3GKU A;  4DUY C;  4L4Q A;  2UUA C;  4I9F A;  3TQI A;  4YY3 C;  2Y4O A;  4NXM C;  5BSW A;  4DR6 C;  2E8E A;  5AE1 A;  2ONF A;  4R1M A;  1XRB A;  3A9U A;  1I94 C;  4BC7 A;  2AYA A;  5AE3 A;  4JM1 A;  4DR5 C;  1LQL A;  4B3S C;  4D4G A;  5IFI A;  3RV2 A;  1IBK C;  4X64 C;  4D56 A;  4DG8 A;  1XNR C;  4DR1 C;  2PT7 G;  1O90 A;  1PG4 A;  3B7W A;  4JI6 C;  4HPV A;  4RVN A;  5IT9 D;  1N36 C;  2HJG A;  3OTO C;  4ZLP A;  4BSZ A;  3GR1 A;  4PZP A;  3FCE A;  2OBV A;  1PA4 A;  1WH9 A;  4PRO C;  4IR7 A;  5A2Q D;  3LUS A;  3GR0 A;  3TDE A;  2WP0 C;  3CJE A;  3NPD A;  4JI2 C;  4GKK C;  3R44 A;  3VNQ A;  2VSQ A;  1MD9 A;  3L8C A;  4NOZ A;  2YWB A;  4AQY C;  3IPL A;  2OPL B;  3EQ6 A;  4GXQ A;  4YHH C;  3E7X A;  4L2Z A;  4FUQ A;  1IBL C;  4NXN C;  4DV1 C;  1V25 A;  1ML8 A;  3JAM D;  2OO4 A;  3AF6 A;  1T5D X;  2BJO A;  4RVO A;  4TPS B;  4KHP C;  2UXB C;  3T1Y C;  3E7W A;  3NYQ A;  1EGA A;  4LE5 A;  5A1G A;  4DR3 C;  3FCC A;  1XNQ C;  4RLQ A;  3VNR A;  4DUZ C;  3RG2 A;  3R9W A;  4I9G A;  2D1Q A;  5JRH A;  2E8C A;  2KZF A;  1HNW C;  5H9U A;  4ODJ A;  4JI4 C;  2VZE A;  2OPL A;  1PG3 A;  4G1I A;  4RMN A;  5A1I A;  1MXA A;  4GKJ C;  3J81 D;  2UUC C;  4JI5 C;  1O93 A;  4DCV A;  1HH2 P;  1MXC A;  3LAX A;  4DCS A;  4ISB A;  4KTT A;  4OX9 C;  3LNV A;  2D1S A;  1MKY A;  1QWI A;  1FJG C;  4JI0 C;  4LFB C;  1XMQ C;  2QW0 X;  5LMN C;  1P7L A;  2P02 A;  4JI7 C;  4DCT A;  4RM2 A;  2P2M A;  1AMU A;  4FTF A;  1J5E C;  5BUQ A;  1N34 C;  5BR8 C;  2E7G A;  2D7V A;  4DG9 A;  5AE2 A;  5IWA C;  2F4V C;  1LCI A;  2CXC A;  4G36 A;  1KKG A;  5KEI A;  1HNX C;  1USP B;  3G7S A;  5K8F A;  3IEU A;  4X65 C;  1ZB8 A;  4NDN A;  3A9V A;  3S82 A;  4DV5 C;  1UKK A;  2DPL A;  1K0R A;  4EAT A;  1FUG A;  1MDF A;  1MXB A;  3ETC A;  2P2J A;  4DR7 C;  4L7I A;  4DR2 C;  4KTV A;  1VLA A;  2P2F A;  3EER A;  3L95 X;  2UXD C;  2D1R A;  5BSV A;  1QM4 A;  4MH4 A;  2PRO A;  2XR1 A;  3A4I A;  1T5H X;  5E7Q A;  2ZM6 C;  1USP A;  2ASB A;  4WV3 A;  4GXR A;  5GTD A;  4K0K C;  3AF5 A;  3NYR A;  5T8T A;  2E5L C;  1IBM C;  4GS5 A;  3DAY A;  5BSU A;  5BSR A;  2UU9 C;  3N54 B;  3R9X A;  5A19 A;  1BA3 A;  1ULT A;  1V26 A;  3NI2 A;  2HHH C;  4LFA C;  3C5E A;  3GPC A;  3UZ0 A;  3TUF A;  4B3M C;  2DYJ A;  5KYT A;  4JI3 C;  4X66 C;  3J7A D;  1YJ7 A;  4DV2 C;  2UUB C;  2P2B A;  2PN2 A;  5T8S A;  2JMP A;  5K85 A;  4JYA C;  1GPM A;  4MTN A;  2P20 A;  4BBY A;  4DV4 C;  4G37 A;  5FLX D;  1MDB A;  4DR4 C;  2UXC C;  4D4I A;  1L2F A;  1N32 C;  2E8F A;  3PES A;  1RY2 A;  4RM3 A;  2P2Q A;  4LF8 C;  4OXI A;  4IZ6 A;  1N2F A;  4B3R C;  2QVZ X;  2D1T A;  2D28 C;  2QVY X;  4X62 C;  4U5Y D;  5BUS A;  4BCA A;  4LF9 C;  4DV6 C;  5BUR A;  4DV0 C;  4JI8 C;  3T1H C;  4PHT A;  5BSM A;  2E0G A;  3DLP X;  4LFC C;  4LF4 C;  5ADZ A;  1O92 A;  5BST A;  4LF6 C;  1N33 C;  4OYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...