4DR5C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 53
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr5C02
2XR1A 2VQEC 2QL8A 4JI0C 3IEVA 4B3SC 1N34C 2ASBA 1WH9A 2ATWA 4JI6C 2E5LC 4DV6C 4DUYC 1MKYA 4GKKC 4DR1C 1IBLC 4DV7C 1HNZC 1HNWC 4X65C 2E8EA 4LF4C 4NOZA 1N32C 4X66C 3T1HC 4DR4C 2OPLB 4DCTA 1L2FA 1N33C 1UKKA 2PN2A 4B3MC 4DR5C 4DV2C 4KHPC 2UXDC 2UUBC 3JAMD 2HHHC 4DCVA 2CXCA 4XX2A 1N2FA 4DV5C 2UU9C 3CJEA 4JV5C 1USPB 4DUZC 1K0RA 4MTNA 4JI7C 5A2QD 3R9WA 4GKJC 2DYJA 2UUAC 4DV0C 1KKGA 5LMUC 3LUSA 1EGAA 4DR3C 4DV3C 3EERA 4JI2C 1QWIA 2E8CA 4JI8C 4OX9C 4K0KC 2UUCC 3OTOC 4YY3C 3J81D 1N36C 4LF8C 4LFAC 1JOSA 3J7AD 4YHHC 1USPA 5FLXD 4JI4C 1IBMC 4LFBC 5LMNC 4LF7C 4B3TC 4DR2C 1ZB8A 2UXCC 3R9XA 2EGTA 4JI5C 2ONFA 4NXNC 4LF9C 4X64C 2JMPA 2OPLA 2E8FA 4DR7C 1NYEA 1ML8A 2E7GA 1XMQC 2UXBC 3IEUA 4X62C 4JYAC 4B3RC 1VLAA 3AF6A 1I94C 3I07A 1LQLA 1HR0C 4JI1C 2D7VA 2F4VC 5IT9D 4LF6C 3AF5A 4MH4A 2CY1A 1XMOC 5BR8C 5IWAC 4NXMC 2KZFA 1XNQC 2YCBA 4LF5C 4JI3C 2VQFC 1PA4A 1HNXC 1J5EC 1HH2P 4BSZA 1IBKC 2ZM6C 1FJGC 2BJOA 2HJGA 1XNRC 4AQYC 4DR6C 3J80D 1WF3A 2PT7G 4DV1C 3T1YC 1ZB9A 4DCUA 4LFCC 4DV4C 4DCSA 3GKUA
chains in the Genus database with same CATH superfamily
3LAXA 4OYCA 4B3SC 2QVZX 1N34C 2ASBA 2E5LC 2E0GA 2YX1A 4DUYC 4DR1C 4X65C 4LF4C 1P4EA 1L2FA 4ISBA 5AE3A 1UKKA 4IR7A 4B3MC 4PROC 4DV2C 3VNRA 5BSTA 2HHHC 2QVXX 2CXCA 3N54B 2UU9C 3A9VA 1USPB 1O93A 4BC7A 5A2QD 1O90A 5KYVA 1TH5A 3RV2A 1V26A 2MM9A 3CQ2A 3DAYA 2VZEA 4K0KC 4JM1A 5T8TA 3J81D 3PESA 3GPCA 4GXRA 4LFBC 5LMNC 4DR2C 3E7WA 1GPMA 3R9XA 2EGTA 4JI5C 2ONFA 4L4QA 4G37A 2MCQA 4X64C 2OPLA 1M6XA 3O2EA 2Z51A 1ML8A 2E7GA 1XMQC 2YWBA 4JYAC 1O9TA 2P02A 2NCLA 3FM7A 3I07A 3TR3A 2CY1A 1XMOC 5AE2A 5IWAC 2YCBA 2M5OA 4G1IA 2ZM6C 2VSQA 2HJGA 3J80D 1WF3A 3T1YC 3GR1A 4D56A 3GKUA 4PUGA 3NYRA 3IEVA 1RG9A 4RVOA 4DV6C 3N2QA 1IBLC 4RM2A 1HNZC 2P2JA 2E8EA 4GXQA 2QW0X 1RY2A 2JNVA 4DG9A 5BSRA 4X66C 3PROC 2P2QA 2ZTBA 2QVYX 4U5YD 4WV3A 5K8FA 2OPLB 3DHVA 2PN2A 4DR5C 2YWCA 2KDNA 4I9FA 3TUFA 2UUBC 4LE5A 1XS3A 4DCVA 1YGTA 4XX2A 1IB8A 3CJEA 5LCIA 1P7LA 2D1QA 3A26A 4MTNA 3UZ0A 4GKJC 3A9UA 1XRBA 3B7WA 2ZZMA 3LUSA 1XRAA 1V25A 1MXCA 4DV3C 5K85A 5GTDA 3OTOC 1UWDA 1N36C 3J7AD 3CQ1A 4PZPA 1ZB8A 2UXCC 3CQ3A 4RMNA 4ZLPA 4LF9C 1V60A 4G36A 2JMPA 2Y4NA 4BCAA 3IMLA 1FLOA 4B3RC 2WD9A 1LQLA 4JI1C 1P4EC 3L95X 5BSMA 5E7QA 2BH1X 1XNQC 4RM3A 5AE1A 4D57A 3NI2A 4IZ6A 2D1SA 3UX2A 1PG4A 3A4IA 4RVNA 1T5HX 3PBKA 4FUTA 2VQFC 1HNXC 3ETCA 3L8CA 3G7SA 4BSZA 3TQIA 1IBKC 1FJGC 2BJOA 4L7IA 3R44A 4DR6C 3KXWA 4DCUA 4DV4C 4DCSA 4LFCC 4TPSB 2VQEC 2M5HA 4JI0C 4KTVA 1WH9A 5A1GA 1AMUA 4GKKC 5IFIA 1HNWC 1MD9A 5BSVA 2D28C 4NOZA 1N32C 3CW8X 5ADZA 4DR4C 1YJ7A 4DCTA 1N33C 5BSUA 1WCJA 5H9UA 5DV9A 4KHPC 3CW9A 1PG3A 2UXDC 5KYTA 1M6XC 4WS9A 4R1MA 4DV5C 5CZXA 2MMAB 1K0RA 4JI7C 3LGXA 2D1RA 4PUIA 3R9WA 3UEBA 2UUAC 4DV0C 1EGAA 4DR3C 4JI2C 3EERA 2CU6A 2E8CA 4BC9A 4JI8C 1JOSA 1MDBA 1USPA 5KEIA 5FLXD 4LF7C 4ZJZA 4R0MA 3TDEA 1MXBA 4NXNC 1ULTA 1PU1A 5CZVA 5JRHA 4DG8A 2Y4OA 1XDXA 4FTFA 4KTTA 5BUSA 5A1IA 1BA3A 1HR0C 3E7XA 2D7VA 2F4VC 2P2BA 4RLFA 5BR8C 2KZFA 4LF5C 1O92A 3LNVA 1PA4A 3FCEA 3IPLA 1J5EC 1HH2P 3UOWA 4EATA 1XNRC 4AQYC 2P2FA 1ZB9A 4GS5A 3LNOA 2XR1A 2QL8A 3SO4A 4PUHA 3RG2A 2ATWA 4JI6C 4HPVA 1MKYA 2AYAA 2DPLA 3ETOA 4DV7C 4OXIA 4RLQA 2D1TA 3T1HC 2OBVA 3EQ6A 2ZZNA 3JAMD 3VNSA 2D27A 4BBYA 1N2FA 1XHJA 4PHTA 4JV5C 3AY0A 4DUZC 5BUQA 1LCIA 4D4IA 5BURA 2DYJA 3H2TA 1KKGA 5LMUC 4I9GA 2P20A 2V7BA 4D4GA 1MDFA 3C5EA 1QWIA 4OX9C 2UUCC 1FUGA 4YY3C 4LF8C 1NY8A 4LFAC 1VEHA 3FCCA 4YHHC 2KZ0A 4JI4C 1IBMC 4B3TC 3NPDA 3K6RA 2OO4A 2P2MA 5BSWA 3I08A 2WP0C 3NYQA 3VNQA 2E8FA 4L2ZA 4DR7C 2PG1E 4FUQA 1NYEA 3S82A 2UXBC 2PROA 1XRCA 3IEUA 4NDNA 2DHMA 4X62C 3GR0A 1VLAA 5A19A 3AF6A 1MXAA 1I94C 1T5DX 3A25A 5IT9D 4LF6C 1QM4A 3AF5A 4MH4A 3DLPX 4NXMC 4R1LA 4JI3C 2Y27A 4ODJA 5T8SA 2PT7G 4DV1C 4K0BA 3UX3A
chains in the Genus database with same CATH topology
3LAXA 4OYCA 4B3SC 2QVZX 1N34C 2ASBA 2E5LC 2E0GA 4DUYC 4DR1C 4X65C 4LF4C 1L2FA 4ISBA 5AE3A 1UKKA 4IR7A 4B3MC 4PROC 4DV2C 3VNRA 5BSTA 2HHHC 2QVXX 2CXCA 3N54B 2UU9C 3A9VA 1USPB 1O93A 4BC7A 5A2QD 1O90A 5KYVA 3RV2A 1V26A 3DAYA 2VZEA 4K0KC 4JM1A 5T8TA 3J81D 3PESA 3GPCA 4GXRA 4LFBC 5LMNC 4DR2C 3E7WA 1GPMA 3R9XA 2EGTA 4JI5C 2ONFA 4L4QA 4G37A 4X64C 2OPLA 1ML8A 2E7GA 1XMQC 2YWBA 4JYAC 1O9TA 2P02A 3I07A 2CY1A 1XMOC 5AE2A 5IWAC 2YCBA 4G1IA 2ZM6C 2VSQA 2HJGA 3J80D 1WF3A 3T1YC 3GR1A 4D56A 3GKUA 3NYRA 3IEVA 1RG9A 4RVOA 4DV6C 3N2QA 1IBLC 4RM2A 1HNZC 2P2JA 2E8EA 4GXQA 2QW0X 1RY2A 4DG9A 5BSRA 4X66C 3PROC 2P2QA 2QVYX 4U5YD 4WV3A 5K8FA 2OPLB 3DHVA 2PN2A 4DR5C 2YWCA 4I9FA 3TUFA 2UUBC 4LE5A 4DCVA 4XX2A 3CJEA 1P7LA 2D1QA 4MTNA 3UZ0A 4GKJC 3A9UA 1XRBA 3B7WA 1XRAA 3LUSA 1V25A 1MXCA 4DV3C 5K85A 5GTDA 3OTOC 1N36C 3J7AD 4PZPA 1ZB8A 2UXCC 4RMNA 4ZLPA 4LF9C 4G36A 2JMPA 2Y4NA 4BCAA 3IMLA 4B3RC 2WD9A 1LQLA 4JI1C 3L95X 5BSMA 5E7QA 2BH1X 1XNQC 4RM3A 5AE1A 4D57A 3NI2A 4IZ6A 2D1SA 2VQFC 1PG4A 3A4IA 4RVNA 1T5HX 3PBKA 4FUTA 1HNXC 3ETCA 3L8CA 3G7SA 4BSZA 3TQIA 1IBKC 1FJGC 2BJOA 4L7IA 3R44A 4DR6C 3KXWA 4DCUA 4DV4C 4DCSA 4LFCC 4TPSB 2VQEC 4JI0C 4KTVA 1WH9A 5A1GA 1AMUA 4GKKC 5IFIA 1HNWC 1MD9A 5BSVA 2D28C 4NOZA 1N32C 3CW8X 5ADZA 4DR4C 1YJ7A 4DCTA 1N33C 5BSUA 5H9UA 5DV9A 4KHPC 3CW9A 1PG3A 2UXDC 5KYTA 4WS9A 4R1MA 4DV5C 5CZXA 1K0RA 4JI7C 3LGXA 2D1RA 3R9WA 2UUAC 4DV0C 1EGAA 4DR3C 4JI2C 3EERA 2E8CA 4BC9A 4JI8C 1JOSA 1MDBA 1USPA 5KEIA 5FLXD 4LF7C 4ZJZA 4R0MA 3TDEA 1MXBA 4NXNC 1ULTA 5CZVA 5JRHA 4DG8A 2Y4OA 4FTFA 4KTTA 5BUSA 5A1IA 1BA3A 1HR0C 3E7XA 2D7VA 2F4VC 2P2BA 4RLFA 5BR8C 2KZFA 4LF5C 1O92A 3LNVA 1PA4A 3FCEA 3IPLA 1J5EC 1HH2P 3UOWA 4EATA 1XNRC 4AQYC 2P2FA 1ZB9A 4GS5A 2XR1A 2QL8A 3SO4A 3RG2A 2ATWA 4JI6C 4HPVA 1MKYA 2AYAA 2DPLA 3ETOA 4DV7C 4OXIA 4RLQA 2D1TA 3T1HC 2OBVA 3EQ6A 3JAMD 3VNSA 2D27A 4BBYA 1N2FA 4PHTA 4JV5C 4DUZC 5BUQA 1LCIA 4D4IA 5BURA 2DYJA 3H2TA 1KKGA 5LMUC 4I9GA 2P20A 2V7BA 4D4GA 1MDFA 3C5EA 1QWIA 4OX9C 2UUCC 1FUGA 4YY3C 4LF8C 4LFAC 3FCCA 4YHHC 4JI4C 1IBMC 4B3TC 3NPDA 2OO4A 2P2MA 5BSWA 3I08A 2WP0C 3NYQA 3VNQA 2E8FA 4L2ZA 4DR7C 4FUQA 1NYEA 3S82A 2UXBC 2PROA 1XRCA 3IEUA 4NDNA 4X62C 3GR0A 1VLAA 5A19A 3AF6A 1MXAA 1I94C 1T5DX 5IT9D 4LF6C 1QM4A 3AF5A 4MH4A 3DLPX 4NXMC 4R1LA 4JI3C 2Y27A 4ODJA 5T8SA 2PT7G 4DV1C 4K0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XR1 A;  2VQE C;  2QL8 A;  4JI0 C;  3IEV A;  4B3S C;  1N34 C;  2ASB A;  1WH9 A;  2ATW A;  4JI6 C;  2E5L C;  4DV6 C;  4DUY C;  1MKY A;  4GKK C;  4DR1 C;  1IBL C;  4DV7 C;  1HNZ C;  1HNW C;  4X65 C;  2E8E A;  4LF4 C;  4NOZ A;  1N32 C;  4X66 C;  3T1H C;  4DR4 C;  2OPL B;  4DCT A;  1L2F A;  1N33 C;  1UKK A;  2PN2 A;  4B3M C;  4DR5 C;  4DV2 C;  4KHP C;  2UXD C;  2UUB C;  3JAM D;  2HHH C;  4DCV A;  2CXC A;  4XX2 A;  1N2F A;  4DV5 C;  2UU9 C;  3CJE A;  4JV5 C;  1USP B;  4DUZ C;  1K0R A;  4MTN A;  4JI7 C;  5A2Q D;  3R9W A;  4GKJ C;  2DYJ A;  2UUA C;  4DV0 C;  1KKG A;  5LMU C;  3LUS A;  1EGA A;  4DR3 C;  4DV3 C;  3EER A;  4JI2 C;  1QWI A;  2E8C A;  4JI8 C;  4OX9 C;  4K0K C;  2UUC C;  3OTO C;  4YY3 C;  3J81 D;  1N36 C;  4LF8 C;  4LFA C;  1JOS A;  3J7A D;  4YHH C;  1USP A;  5FLX D;  4JI4 C;  1IBM C;  4LFB C;  5LMN C;  4LF7 C;  4B3T C;  4DR2 C;  1ZB8 A;  2UXC C;  3R9X A;  2EGT A;  4JI5 C;  2ONF A;  4NXN C;  4LF9 C;  4X64 C;  2JMP A;  2OPL A;  2E8F A;  4DR7 C;  1NYE A;  1ML8 A;  2E7G A;  1XMQ C;  2UXB C;  3IEU A;  4X62 C;  4JYA C;  4B3R C;  1VLA A;  3AF6 A;  1I94 C;  3I07 A;  1LQL A;  1HR0 C;  4JI1 C;  2D7V A;  2F4V C;  5IT9 D;  4LF6 C;  3AF5 A;  4MH4 A;  2CY1 A;  1XMO C;  5BR8 C;  5IWA C;  4NXM C;  2KZF A;  1XNQ C;  2YCB A;  4LF5 C;  4JI3 C;  2VQF C;  1PA4 A;  1HNX C;  1J5E C;  1HH2 P;  4BSZ A;  1IBK C;  2ZM6 C;  1FJG C;  2BJO A;  2HJG A;  1XNR C;  4AQY C;  4DR6 C;  3J80 D;  1WF3 A;  2PT7 G;  4DV1 C;  3T1Y C;  1ZB9 A;  4DCU A;  4LFC C;  4DV4 C;  4DCS A;  3GKU A; 
#chains in the Genus database with same CATH topology
 3LAX A;  4OYC A;  4B3S C;  2QVZ X;  1N34 C;  2ASB A;  2E5L C;  2E0G A;  2YX1 A;  4DUY C;  4DR1 C;  4X65 C;  4LF4 C;  1P4E A;  1L2F A;  4ISB A;  5AE3 A;  1UKK A;  4IR7 A;  4B3M C;  4PRO C;  4DV2 C;  3VNR A;  5BST A;  2HHH C;  2QVX X;  2CXC A;  3N54 B;  2UU9 C;  3A9V A;  1USP B;  1O93 A;  4BC7 A;  5A2Q D;  1O90 A;  5KYV A;  1TH5 A;  3RV2 A;  1V26 A;  2MM9 A;  3CQ2 A;  3DAY A;  2VZE A;  4K0K C;  4JM1 A;  5T8T A;  3J81 D;  3PES A;  3GPC A;  4GXR A;  4LFB C;  5LMN C;  4DR2 C;  3E7W A;  1GPM A;  3R9X A;  2EGT A;  4JI5 C;  2ONF A;  4L4Q A;  4G37 A;  2MCQ A;  4X64 C;  2OPL A;  1M6X A;  3O2E A;  2Z51 A;  1ML8 A;  2E7G A;  1XMQ C;  2YWB A;  4JYA C;  1O9T A;  2P02 A;  2NCL A;  3FM7 A;  3I07 A;  3TR3 A;  2CY1 A;  1XMO C;  5AE2 A;  5IWA C;  2YCB A;  2M5O A;  4G1I A;  2ZM6 C;  2VSQ A;  2HJG A;  3J80 D;  1WF3 A;  3T1Y C;  3GR1 A;  4D56 A;  3GKU A;  4PUG A;  3NYR A;  3IEV A;  1RG9 A;  4RVO A;  4DV6 C;  3N2Q A;  1IBL C;  4RM2 A;  1HNZ C;  2P2J A;  2E8E A;  4GXQ A;  2QW0 X;  1RY2 A;  2JNV A;  4DG9 A;  5BSR A;  4X66 C;  3PRO C;  2P2Q A;  2ZTB A;  2QVY X;  4U5Y D;  4WV3 A;  5K8F A;  2OPL B;  3DHV A;  2PN2 A;  4DR5 C;  2YWC A;  2KDN A;  4I9F A;  3TUF A;  2UUB C;  4LE5 A;  1XS3 A;  4DCV A;  1YGT A;  4XX2 A;  1IB8 A;  3CJE A;  5LCI A;  1P7L A;  2D1Q A;  3A26 A;  4MTN A;  3UZ0 A;  4GKJ C;  3A9U A;  1XRB A;  3B7W A;  2ZZM A;  3LUS A;  1XRA A;  1V25 A;  1MXC A;  4DV3 C;  5K85 A;  5GTD A;  3OTO C;  1UWD A;  1N36 C;  3J7A D;  3CQ1 A;  4PZP A;  1ZB8 A;  2UXC C;  3CQ3 A;  4RMN A;  4ZLP A;  4LF9 C;  1V60 A;  4G36 A;  2JMP A;  2Y4N A;  4BCA A;  3IML A;  1FLO A;  4B3R C;  2WD9 A;  1LQL A;  4JI1 C;  1P4E C;  3L95 X;  5BSM A;  5E7Q A;  2BH1 X;  1XNQ C;  4RM3 A;  5AE1 A;  4D57 A;  3NI2 A;  4IZ6 A;  2D1S A;  3UX2 A;  1PG4 A;  3A4I A;  4RVN A;  1T5H X;  3PBK A;  4FUT A;  2VQF C;  1HNX C;  3ETC A;  3L8C A;  3G7S A;  4BSZ A;  3TQI A;  1IBK C;  1FJG C;  2BJO A;  4L7I A;  3R44 A;  4DR6 C;  3KXW A;  4DCU A;  4DV4 C;  4DCS A;  4LFC C;  4TPS B;  2VQE C;  2M5H A;  4JI0 C;  4KTV A;  1WH9 A;  5A1G A;  1AMU A;  4GKK C;  5IFI A;  1HNW C;  1MD9 A;  5BSV A;  2D28 C;  4NOZ A;  1N32 C;  3CW8 X;  5ADZ A;  4DR4 C;  1YJ7 A;  4DCT A;  1N33 C;  5BSU A;  1WCJ A;  5H9U A;  5DV9 A;  4KHP C;  3CW9 A;  1PG3 A;  2UXD C;  5KYT A;  1M6X C;  4WS9 A;  4R1M A;  4DV5 C;  5CZX A;  2MMA B;  1K0R A;  4JI7 C;  3LGX A;  2D1R A;  4PUI A;  3R9W A;  3UEB A;  2UUA C;  4DV0 C;  1EGA A;  4DR3 C;  4JI2 C;  3EER A;  2CU6 A;  2E8C A;  4BC9 A;  4JI8 C;  1JOS A;  1MDB A;  1USP A;  5KEI A;  5FLX D;  4LF7 C;  4ZJZ A;  4R0M A;  3TDE A;  1MXB A;  4NXN C;  1ULT A;  1PU1 A;  5CZV A;  5JRH A;  4DG8 A;  2Y4O A;  1XDX A;  4FTF A;  4KTT A;  5BUS A;  5A1I A;  1BA3 A;  1HR0 C;  3E7X A;  2D7V A;  2F4V C;  2P2B A;  4RLF A;  5BR8 C;  2KZF A;  4LF5 C;  1O92 A;  3LNV A;  1PA4 A;  3FCE A;  3IPL A;  1J5E C;  1HH2 P;  3UOW A;  4EAT A;  1XNR C;  4AQY C;  2P2F A;  1ZB9 A;  4GS5 A;  3LNO A;  2XR1 A;  2QL8 A;  3SO4 A;  4PUH A;  3RG2 A;  2ATW A;  4JI6 C;  4HPV A;  1MKY A;  2AYA A;  2DPL A;  3ETO A;  4DV7 C;  4OXI A;  4RLQ A;  2D1T A;  3T1H C;  2OBV A;  3EQ6 A;  2ZZN A;  3JAM D;  3VNS A;  2D27 A;  4BBY A;  1N2F A;  1XHJ A;  4PHT A;  4JV5 C;  3AY0 A;  4DUZ C;  5BUQ A;  1LCI A;  4D4I A;  5BUR A;  2DYJ A;  3H2T A;  1KKG A;  5LMU C;  4I9G A;  2P20 A;  2V7B A;  4D4G A;  1MDF A;  3C5E A;  1QWI A;  4OX9 C;  2UUC C;  1FUG A;  4YY3 C;  4LF8 C;  1NY8 A;  4LFA C;  1VEH A;  3FCC A;  4YHH C;  2KZ0 A;  4JI4 C;  1IBM C;  4B3T C;  3NPD A;  3K6R A;  2OO4 A;  2P2M A;  5BSW A;  3I08 A;  2WP0 C;  3NYQ A;  3VNQ A;  2E8F A;  4L2Z A;  4DR7 C;  2PG1 E;  4FUQ A;  1NYE A;  3S82 A;  2UXB C;  2PRO A;  1XRC A;  3IEU A;  4NDN A;  2DHM A;  4X62 C;  3GR0 A;  1VLA A;  5A19 A;  3AF6 A;  1MXA A;  1I94 C;  1T5D X;  3A25 A;  5IT9 D;  4LF6 C;  1QM4 A;  3AF5 A;  4MH4 A;  3DLP X;  4NXM C;  4R1L A;  4JI3 C;  2Y27 A;  4ODJ A;  5T8S A;  2PT7 G;  4DV1 C;  4K0B A;  3UX3 A; 
#chains in the Genus database with same CATH homology
 3LAX A;  4OYC A;  4B3S C;  2QVZ X;  1N34 C;  2ASB A;  2E5L C;  2E0G A;  4DUY C;  4DR1 C;  4X65 C;  4LF4 C;  1L2F A;  4ISB A;  5AE3 A;  1UKK A;  4IR7 A;  4B3M C;  4PRO C;  4DV2 C;  3VNR A;  5BST A;  2HHH C;  2QVX X;  2CXC A;  3N54 B;  2UU9 C;  3A9V A;  1USP B;  1O93 A;  4BC7 A;  5A2Q D;  1O90 A;  5KYV A;  3RV2 A;  1V26 A;  3DAY A;  2VZE A;  4K0K C;  4JM1 A;  5T8T A;  3J81 D;  3PES A;  3GPC A;  4GXR A;  4LFB C;  5LMN C;  4DR2 C;  3E7W A;  1GPM A;  3R9X A;  2EGT A;  4JI5 C;  2ONF A;  4L4Q A;  4G37 A;  4X64 C;  2OPL A;  1ML8 A;  2E7G A;  1XMQ C;  2YWB A;  4JYA C;  1O9T A;  2P02 A;  3I07 A;  2CY1 A;  1XMO C;  5AE2 A;  5IWA C;  2YCB A;  4G1I A;  2ZM6 C;  2VSQ A;  2HJG A;  3J80 D;  1WF3 A;  3T1Y C;  3GR1 A;  4D56 A;  3GKU A;  3NYR A;  3IEV A;  1RG9 A;  4RVO A;  4DV6 C;  3N2Q A;  1IBL C;  4RM2 A;  1HNZ C;  2P2J A;  2E8E A;  4GXQ A;  2QW0 X;  1RY2 A;  4DG9 A;  5BSR A;  4X66 C;  3PRO C;  2P2Q A;  2QVY X;  4U5Y D;  4WV3 A;  5K8F A;  2OPL B;  3DHV A;  2PN2 A;  4DR5 C;  2YWC A;  4I9F A;  3TUF A;  2UUB C;  4LE5 A;  4DCV A;  4XX2 A;  3CJE A;  1P7L A;  2D1Q A;  4MTN A;  3UZ0 A;  4GKJ C;  3A9U A;  1XRB A;  3B7W A;  1XRA A;  3LUS A;  1V25 A;  1MXC A;  4DV3 C;  5K85 A;  5GTD A;  3OTO C;  1N36 C;  3J7A D;  4PZP A;  1ZB8 A;  2UXC C;  4RMN A;  4ZLP A;  4LF9 C;  4G36 A;  2JMP A;  2Y4N A;  4BCA A;  3IML A;  4B3R C;  2WD9 A;  1LQL A;  4JI1 C;  3L95 X;  5BSM A;  5E7Q A;  2BH1 X;  1XNQ C;  4RM3 A;  5AE1 A;  4D57 A;  3NI2 A;  4IZ6 A;  2D1S A;  2VQF C;  1PG4 A;  3A4I A;  4RVN A;  1T5H X;  3PBK A;  4FUT A;  1HNX C;  3ETC A;  3L8C A;  3G7S A;  4BSZ A;  3TQI A;  1IBK C;  1FJG C;  2BJO A;  4L7I A;  3R44 A;  4DR6 C;  3KXW A;  4DCU A;  4DV4 C;  4DCS A;  4LFC C;  4TPS B;  2VQE C;  4JI0 C;  4KTV A;  1WH9 A;  5A1G A;  1AMU A;  4GKK C;  5IFI A;  1HNW C;  1MD9 A;  5BSV A;  2D28 C;  4NOZ A;  1N32 C;  3CW8 X;  5ADZ A;  4DR4 C;  1YJ7 A;  4DCT A;  1N33 C;  5BSU A;  5H9U A;  5DV9 A;  4KHP C;  3CW9 A;  1PG3 A;  2UXD C;  5KYT A;  4WS9 A;  4R1M A;  4DV5 C;  5CZX A;  1K0R A;  4JI7 C;  3LGX A;  2D1R A;  3R9W A;  2UUA C;  4DV0 C;  1EGA A;  4DR3 C;  4JI2 C;  3EER A;  2E8C A;  4BC9 A;  4JI8 C;  1JOS A;  1MDB A;  1USP A;  5KEI A;  5FLX D;  4LF7 C;  4ZJZ A;  4R0M A;  3TDE A;  1MXB A;  4NXN C;  1ULT A;  5CZV A;  5JRH A;  4DG8 A;  2Y4O A;  4FTF A;  4KTT A;  5BUS A;  5A1I A;  1BA3 A;  1HR0 C;  3E7X A;  2D7V A;  2F4V C;  2P2B A;  4RLF A;  5BR8 C;  2KZF A;  4LF5 C;  1O92 A;  3LNV A;  1PA4 A;  3FCE A;  3IPL A;  1J5E C;  1HH2 P;  3UOW A;  4EAT A;  1XNR C;  4AQY C;  2P2F A;  1ZB9 A;  4GS5 A;  2XR1 A;  2QL8 A;  3SO4 A;  3RG2 A;  2ATW A;  4JI6 C;  4HPV A;  1MKY A;  2AYA A;  2DPL A;  3ETO A;  4DV7 C;  4OXI A;  4RLQ A;  2D1T A;  3T1H C;  2OBV A;  3EQ6 A;  3JAM D;  3VNS A;  2D27 A;  4BBY A;  1N2F A;  4PHT A;  4JV5 C;  4DUZ C;  5BUQ A;  1LCI A;  4D4I A;  5BUR A;  2DYJ A;  3H2T A;  1KKG A;  5LMU C;  4I9G A;  2P20 A;  2V7B A;  4D4G A;  1MDF A;  3C5E A;  1QWI A;  4OX9 C;  2UUC C;  1FUG A;  4YY3 C;  4LF8 C;  4LFA C;  3FCC A;  4YHH C;  4JI4 C;  1IBM C;  4B3T C;  3NPD A;  2OO4 A;  2P2M A;  5BSW A;  3I08 A;  2WP0 C;  3NYQ A;  3VNQ A;  2E8F A;  4L2Z A;  4DR7 C;  4FUQ A;  1NYE A;  3S82 A;  2UXB C;  2PRO A;  1XRC A;  3IEU A;  4NDN A;  4X62 C;  3GR0 A;  1VLA A;  5A19 A;  3AF6 A;  1MXA A;  1I94 C;  1T5D X;  5IT9 D;  4LF6 C;  1QM4 A;  3AF5 A;  4MH4 A;  3DLP X;  4NXM C;  4R1L A;  4JI3 C;  2Y27 A;  4ODJ A;  5T8S A;  2PT7 G;  4DV1 C;  4K0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...