4DR5C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 53
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr5C02
1IBKC 2UXDC 4DUZC 3T1YC 3T1HC 1ZB8A 2EGTA 1ML8A 4DV0C 2E8FA 1VLAA 1J5EC 2E8CA 1XMOC 4NXNC 1N2FA 2E8EA 4JI4C 4JYAC 1ZB9A 4DR5C 2KZFA 4JI8C 4DV2C 4NOZA 2UUCC 4DCVA 4DUYC 5IWAC 2HJGA 4DR7C 4DR2C 1PA4A 4DCUA 3AF6A 2PN2A 2ZM6C 4DV1C 2UUBC 4B3MC 1LQLA 2DYJA 1UKKA 4DV3C 4LF6C 2JMPA 4JV5C 4LF7C 3LUSA 4X66C 4BSZA 5A2QD 4DR1C 4JI1C 1USPB 4DV5C 2OPLB 1HR0C 2XR1A 4K0KC 1MKYA 3GKUA 2ATWA 3IEVA 4X64C 3R9WA 4GKKC 4X65C 1HH2P 2CXCA 4DCTA 4JI0C 4JI5C 1IBMC 2HHHC 4LFAC 4JI6C 2UU9C 1N32C 4B3SC 4DV7C 4DV4C 1FJGC 4X62C 2E7GA 5FLXD 1L2FA 4B3TC 2YCBA 4LF4C 1QWIA 5IT9D 4JI7C 1HNZC 1HNXC 4DCSA 2BJOA 4YY3C 2VQEC 5LMUC 4OX9C 4B3RC 4KHPC 1XNRC 4JI2C 2D7VA 3CJEA 4NXMC 1WH9A 3OTOC 3I07A 4LF8C 4DR6C 4DV6C 4DR4C 1WF3A 3AF5A 4XX2A 2E5LC 2PT7G 1N33C 1NYEA 2UUAC 3J81D 2CY1A 1IBLC 2UXBC 1KKGA 1K0RA 5BR8C 4LF9C 2QL8A 4YHHC 4MTNA 2F4VC 3JAMD 3J80D 4AQYC 3R9XA 1HNWC 2VQFC 1N34C 4GKJC 4LFCC 3IEUA 1EGAA 2UXCC 3J7AD 1USPA 2OPLA 1N36C 4LF5C 2ASBA 1JOSA 1XMQC 5LMNC 1XNQC 4DR3C 1I94C 4LFBC 3EERA 4JI3C 2ONFA 4MH4A
chains in the Genus database with same CATH superfamily
1ML8A 5A1IA 5BURA 3A9VA 4DV0C 1YGTA 3TUFA 4R1LA 1YJ7A 3KXWA 4RVOA 4FUQA 2DPLA 3NPDA 4FUTA 1MDFA 1VEHA 4K0BA 5IWAC 4DR2C 1PA4A 3RV2A 2PN2A 1XRBA 1PG4A 4D4GA 3CW9A 1UKKA 4DV3C 3LNVA 4WV3A 4NDNA 4LF6C 5BSTA 4JI1C 3E7WA 5AE3A 2OBVA 1XRCA 3K6RA 1HR0C 3CQ2A 2XR1A 3UOWA 2ATWA 2CXCA 2HHHC 4B3SC 4DV7C 2NCLA 2YCBA 4LF4C 1QWIA 2QW0X 3CQ3A 4JI7C 1P7LA 2BJOA 4YY3C 2MM9A 4JI2C 3CJEA 4WS9A 3TDEA 1M6XC 1M6XA 3OTOC 4BC9A 3I07A 3A26A 4DV6C 4DR4C 3N2QA 4PROC 1TH5A 1WF3A 3FCEA 1UWDA 4EATA 2CY1A 3PESA 4DG8A 3R9XA 4AQYC 2CU6A 1HNWC 2VQFC 4GKJC 3IEUA 4TPSB 5T8SA 5A1GA 2AYAA 3B7WA 3TR3A 4RVNA 2ASBA 5BUQA 1XMQC 2Z51A 1QM4A 4DR3C 4G1IA 3EERA 4JI3C 3L95X 1GPMA 2UXDC 4DUZC 3IPLA 3LAXA 1XS3A 2E8CA 3ETOA 3UEBA 1XMOC 4NXNC 5H9UA 5K8FA 2E8EA 2D1SA 2KZFA 1FLOA 3GPCA 4D56A 2D27A 4DUYC 2HJGA 1WCJA 3EQ6A 4DR7C 5CZXA 4IR7A 2QVXX 2UUBC 2P20A 3ETCA 3LUSA 4ZJZA 5BSRA 3R44A 5A2QD 1USPB 4LE5A 2OPLB 4K0KC 2Y4NA 3IEVA 4X64C 4R0MA 4X65C 2M5HA 4DCTA 1N32C 2D28C 2P2JA 2M5OA 1L2FA 1PU1A 2OO4A 5CZVA 5IT9D 4DCSA 4OX9C 1O93A 4KHPC 1XNRC 1FUGA 1RG9A 3S82A 4D57A 3DAYA 2YX1A 3UZ0A 3FM7A 4PZPA 3AF5A 4PUHA 4DG9A 2E5LC 3PBKA 2UUAC 4R1MA 4BC7A 2D1TA 1MXCA 1K0RA 5BR8C 4YHHC 1O90A 2ZZNA 3VNRA 4PHTA 1BA3A 5ADZA 4I9GA 4ZLPA 3J7AD 3H2TA 1N36C 5A19A 1T5DX 1MXAA 4LFBC 4RM3A 2ONFA 1FJGC 1IBKC 3T1YC 3T1HC 1ZB8A 2EGTA 2D1RA 3IMLA 4RLQA 2E8FA 1J5EC 1N2FA 4JI4C 4JYAC 1ZB9A 2Y4OA 3VNQA 4OYCA 3A4IA 3LNOA 5JRHA 4PUGA 4GS5A 3N54B 3AF6A 4DV1C 4PUIA 4B3MC 1LQLA 5DV9A 1O92A 4L7IA 4JV5C 2KZ0A 4BSZA 3A25A 5BSWA 4DR1C 2V7BA 2WD9A 4GXRA 3CW8X 3AY0A 3R9WA 4GKKC 3VNSA 2JNVA 4G37A 4JI0C 4JI5C 5AE2A 3NI2A 3E7XA 3NYRA 3FCCA 3O2EA 2Y27A 4X62C 5FLXD 4B3TC 5KYTA 1XRAA 2VQEC 4B3RC 5LMUC 4RMNA 5LCIA 4NXMC 2YWCA 1AMUA 3DLPX 4XX2A 5BUSA 2PT7G 3C5EA 1N33C 1NYEA 2PROA 2P2QA 2VZEA 1IBLC 3SO4A 2UXBC 1KKGA 4LF9C 4MTNA 3J80D 4G36A 1ULTA 2ZTBA 1LCIA 1USPA 3CQ1A 2OPLA 2BH1X 4LF5C 1JOSA 5LMNC 2ZZMA 5IFIA 4D4IA 4KTTA 4RM2A 2WP0C 2PG1E 3UX2A 1MXBA 3A9UA 3L8CA 1VLAA 5AE1A 1V60A 3GR0A 1MDBA 4DR5C 2DHMA 5GTDA 1PG3A 3PROC 1NY8A 4DV2C 4NOZA 2UUCC 3DHVA 4FTFA 4DCVA 4ISBA 1IB8A 4DCUA 1XHJA 2ZM6C 1RY2A 2DYJA 4BBYA 3UX3A 2JMPA 5BSVA 4LF7C 1XDXA 3GR1A 4X66C 3RG2A 4DV5C 1T5HX 1O9TA 3TQIA 3G7SA 4KTVA 1MKYA 3I08A 3GKUA 2P02A 3LGXA 2MCQA 4U5YD 2MMAB 3NYQA 4I9FA 1HH2P 2QVZX 2VSQA 1IBMC 4HPVA 4LFAC 4JI6C 2UU9C 4DV4C 4RLFA 2E7GA 4IZ6A 1HNZC 1HNXC 2E0GA 4L2ZA 2D1QA 2D7VA 1WH9A 1P4EC 1P4EA 4LF8C 4DR6C 4OXIA 4JM1A 5T8TA 5K85A 5E7QA 2P2MA 3J81D 4BCAA 4L4QA 5KYVA 2QL8A 1V26A 2F4VC 3JAMD 2P2BA 1N34C 4LFCC 1V25A 2P2FA 2KDNA 5BSUA 1EGAA 1MD9A 5BSMA 2UXCC 2QVYX 4ODJA 2YWBA 5KEIA 4GXQA 1XNQC 1I94C 4JI8C 4MH4A
chains in the Genus database with same CATH topology
1ML8A 5A1IA 5BURA 3A9VA 4DV0C 3TUFA 4R1LA 1YJ7A 3KXWA 4RVOA 4FUQA 2DPLA 3NPDA 4FUTA 1MDFA 4K0BA 5IWAC 4DR2C 1PA4A 3RV2A 2PN2A 1XRBA 1PG4A 4D4GA 3CW9A 1UKKA 4DV3C 3LNVA 4WV3A 4NDNA 4LF6C 5BSTA 4JI1C 3E7WA 5AE3A 2OBVA 1XRCA 1HR0C 2XR1A 3UOWA 2ATWA 2CXCA 2HHHC 4B3SC 4DV7C 2YCBA 4LF4C 1QWIA 2QW0X 4JI7C 1P7LA 2BJOA 4YY3C 4JI2C 3CJEA 4WS9A 3TDEA 3OTOC 4BC9A 3I07A 4DV6C 4DR4C 3N2QA 4PROC 1WF3A 3FCEA 4EATA 2CY1A 3PESA 4DG8A 3R9XA 4AQYC 1HNWC 2VQFC 4GKJC 3IEUA 4TPSB 5T8SA 5A1GA 2AYAA 3B7WA 4RVNA 2ASBA 5BUQA 1XMQC 1QM4A 4DR3C 4G1IA 3EERA 4JI3C 3L95X 1GPMA 2UXDC 4DUZC 3IPLA 3LAXA 2E8CA 3ETOA 1XMOC 4NXNC 5H9UA 5K8FA 2E8EA 2D1SA 2KZFA 3GPCA 4D56A 2D27A 4DUYC 2HJGA 3EQ6A 4DR7C 5CZXA 4IR7A 2QVXX 2UUBC 2P20A 3ETCA 3LUSA 4ZJZA 5BSRA 3R44A 5A2QD 1USPB 4LE5A 2OPLB 4K0KC 2Y4NA 3IEVA 4X64C 4R0MA 4X65C 4DCTA 1N32C 2D28C 2P2JA 1L2FA 2OO4A 5CZVA 5IT9D 4DCSA 4OX9C 1O93A 4KHPC 1XNRC 1FUGA 1RG9A 3S82A 4D57A 3DAYA 3UZ0A 4PZPA 3AF5A 4DG9A 2E5LC 3PBKA 2UUAC 4R1MA 4BC7A 2D1TA 1MXCA 1K0RA 5BR8C 4YHHC 1O90A 3VNRA 4PHTA 1BA3A 4ZLPA 4I9GA 5ADZA 3J7AD 3H2TA 1N36C 5A19A 1T5DX 1MXAA 4LFBC 4RM3A 2ONFA 1FJGC 1IBKC 3T1YC 3T1HC 1ZB8A 2EGTA 2D1RA 3IMLA 4RLQA 2E8FA 1J5EC 1N2FA 4JI4C 4JYAC 1ZB9A 2Y4OA 3VNQA 4OYCA 3A4IA 5JRHA 4GS5A 3N54B 3AF6A 4DV1C 4B3MC 1LQLA 5DV9A 1O92A 4L7IA 4JV5C 4BSZA 5BSWA 4DR1C 2V7BA 2WD9A 4GXRA 3CW8X 3R9WA 4GKKC 3VNSA 4G37A 4JI0C 4JI5C 5AE2A 3NI2A 3E7XA 3NYRA 3FCCA 4X62C 2Y27A 5FLXD 4B3TC 5KYTA 1XRAA 2VQEC 4B3RC 5LMUC 4RMNA 4NXMC 2YWCA 1AMUA 3DLPX 4XX2A 5BUSA 2PT7G 3C5EA 1N33C 1NYEA 2PROA 2P2QA 2VZEA 1IBLC 3SO4A 2UXBC 1KKGA 4LF9C 4MTNA 3J80D 4G36A 1ULTA 1LCIA 1USPA 2OPLA 2BH1X 4LF5C 1JOSA 5LMNC 5IFIA 4D4IA 4KTTA 4RM2A 2WP0C 1MXBA 3A9UA 3L8CA 1VLAA 5AE1A 3GR0A 1MDBA 4DR5C 5GTDA 1PG3A 3PROC 4DV2C 4NOZA 2UUCC 3DHVA 4FTFA 4DCVA 4ISBA 4DCUA 2ZM6C 1RY2A 2DYJA 4BBYA 2JMPA 5BSVA 4LF7C 3GR1A 4X66C 3RG2A 4DV5C 1T5HX 1O9TA 3TQIA 3G7SA 4KTVA 1MKYA 3I08A 3GKUA 2P02A 3LGXA 4U5YD 3NYQA 4I9FA 1HH2P 2QVZX 2VSQA 1IBMC 4HPVA 4LFAC 4JI6C 2UU9C 4DV4C 4RLFA 2E7GA 4IZ6A 1HNZC 1HNXC 2E0GA 4L2ZA 2D1QA 2D7VA 1WH9A 4LF8C 4DR6C 4OXIA 4JM1A 5T8TA 5K85A 5E7QA 2P2MA 3J81D 4BCAA 4L4QA 5KYVA 2QL8A 1V26A 2F4VC 3JAMD 2P2BA 1N34C 4LFCC 1V25A 2P2FA 5BSUA 1EGAA 1MD9A 5BSMA 2UXCC 2QVYX 4ODJA 2YWBA 5KEIA 4GXQA 1XNQC 1I94C 4JI8C 4MH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK C;  2UXD C;  4DUZ C;  3T1Y C;  3T1H C;  1ZB8 A;  2EGT A;  1ML8 A;  4DV0 C;  2E8F A;  1VLA A;  1J5E C;  2E8C A;  1XMO C;  4NXN C;  1N2F A;  2E8E A;  4JI4 C;  4JYA C;  1ZB9 A;  4DR5 C;  2KZF A;  4JI8 C;  4DV2 C;  4NOZ A;  2UUC C;  4DCV A;  4DUY C;  5IWA C;  2HJG A;  4DR7 C;  4DR2 C;  1PA4 A;  4DCU A;  3AF6 A;  2PN2 A;  2ZM6 C;  4DV1 C;  2UUB C;  4B3M C;  1LQL A;  2DYJ A;  1UKK A;  4DV3 C;  4LF6 C;  2JMP A;  4JV5 C;  4LF7 C;  3LUS A;  4X66 C;  4BSZ A;  5A2Q D;  4DR1 C;  4JI1 C;  1USP B;  4DV5 C;  2OPL B;  1HR0 C;  2XR1 A;  4K0K C;  1MKY A;  3GKU A;  2ATW A;  3IEV A;  4X64 C;  3R9W A;  4GKK C;  4X65 C;  1HH2 P;  2CXC A;  4DCT A;  4JI0 C;  4JI5 C;  1IBM C;  2HHH C;  4LFA C;  4JI6 C;  2UU9 C;  1N32 C;  4B3S C;  4DV7 C;  4DV4 C;  1FJG C;  4X62 C;  2E7G A;  5FLX D;  1L2F A;  4B3T C;  2YCB A;  4LF4 C;  1QWI A;  5IT9 D;  4JI7 C;  1HNZ C;  1HNX C;  4DCS A;  2BJO A;  4YY3 C;  2VQE C;  5LMU C;  4OX9 C;  4B3R C;  4KHP C;  1XNR C;  4JI2 C;  2D7V A;  3CJE A;  4NXM C;  1WH9 A;  3OTO C;  3I07 A;  4LF8 C;  4DR6 C;  4DV6 C;  4DR4 C;  1WF3 A;  3AF5 A;  4XX2 A;  2E5L C;  2PT7 G;  1N33 C;  1NYE A;  2UUA C;  3J81 D;  2CY1 A;  1IBL C;  2UXB C;  1KKG A;  1K0R A;  5BR8 C;  4LF9 C;  2QL8 A;  4YHH C;  4MTN A;  2F4V C;  3JAM D;  3J80 D;  4AQY C;  3R9X A;  1HNW C;  2VQF C;  1N34 C;  4GKJ C;  4LFC C;  3IEU A;  1EGA A;  2UXC C;  3J7A D;  1USP A;  2OPL A;  1N36 C;  4LF5 C;  2ASB A;  1JOS A;  1XMQ C;  5LMN C;  1XNQ C;  4DR3 C;  1I94 C;  4LFB C;  3EER A;  4JI3 C;  2ONF A;  4MH4 A; 
#chains in the Genus database with same CATH topology
 1ML8 A;  5A1I A;  5BUR A;  3A9V A;  4DV0 C;  1YGT A;  3TUF A;  4R1L A;  1YJ7 A;  3KXW A;  4RVO A;  4FUQ A;  2DPL A;  3NPD A;  4FUT A;  1MDF A;  1VEH A;  4K0B A;  5IWA C;  4DR2 C;  1PA4 A;  3RV2 A;  2PN2 A;  1XRB A;  1PG4 A;  4D4G A;  3CW9 A;  1UKK A;  4DV3 C;  3LNV A;  4WV3 A;  4NDN A;  4LF6 C;  5BST A;  4JI1 C;  3E7W A;  5AE3 A;  2OBV A;  1XRC A;  3K6R A;  1HR0 C;  3CQ2 A;  2XR1 A;  3UOW A;  2ATW A;  2CXC A;  2HHH C;  4B3S C;  4DV7 C;  2NCL A;  2YCB A;  4LF4 C;  1QWI A;  2QW0 X;  3CQ3 A;  4JI7 C;  1P7L A;  2BJO A;  4YY3 C;  2MM9 A;  4JI2 C;  3CJE A;  4WS9 A;  3TDE A;  1M6X C;  1M6X A;  3OTO C;  4BC9 A;  3I07 A;  3A26 A;  4DV6 C;  4DR4 C;  3N2Q A;  4PRO C;  1TH5 A;  1WF3 A;  3FCE A;  1UWD A;  4EAT A;  2CY1 A;  3PES A;  4DG8 A;  3R9X A;  4AQY C;  2CU6 A;  1HNW C;  2VQF C;  4GKJ C;  3IEU A;  4TPS B;  5T8S A;  5A1G A;  2AYA A;  3B7W A;  3TR3 A;  4RVN A;  2ASB A;  5BUQ A;  1XMQ C;  2Z51 A;  1QM4 A;  4DR3 C;  4G1I A;  3EER A;  4JI3 C;  3L95 X;  1GPM A;  2UXD C;  4DUZ C;  3IPL A;  3LAX A;  1XS3 A;  2E8C A;  3ETO A;  3UEB A;  1XMO C;  4NXN C;  5H9U A;  5K8F A;  2E8E A;  2D1S A;  2KZF A;  1FLO A;  3GPC A;  4D56 A;  2D27 A;  4DUY C;  2HJG A;  1WCJ A;  3EQ6 A;  4DR7 C;  5CZX A;  4IR7 A;  2QVX X;  2UUB C;  2P20 A;  3ETC A;  3LUS A;  4ZJZ A;  5BSR A;  3R44 A;  5A2Q D;  1USP B;  4LE5 A;  2OPL B;  4K0K C;  2Y4N A;  3IEV A;  4X64 C;  4R0M A;  4X65 C;  2M5H A;  4DCT A;  1N32 C;  2D28 C;  2P2J A;  2M5O A;  1L2F A;  1PU1 A;  2OO4 A;  5CZV A;  5IT9 D;  4DCS A;  4OX9 C;  1O93 A;  4KHP C;  1XNR C;  1FUG A;  1RG9 A;  3S82 A;  4D57 A;  3DAY A;  2YX1 A;  3UZ0 A;  3FM7 A;  4PZP A;  3AF5 A;  4PUH A;  4DG9 A;  2E5L C;  3PBK A;  2UUA C;  4R1M A;  4BC7 A;  2D1T A;  1MXC A;  1K0R A;  5BR8 C;  4YHH C;  1O90 A;  2ZZN A;  3VNR A;  4PHT A;  1BA3 A;  5ADZ A;  4I9G A;  4ZLP A;  3J7A D;  3H2T A;  1N36 C;  5A19 A;  1T5D X;  1MXA A;  4LFB C;  4RM3 A;  2ONF A;  1FJG C;  1IBK C;  3T1Y C;  3T1H C;  1ZB8 A;  2EGT A;  2D1R A;  3IML A;  4RLQ A;  2E8F A;  1J5E C;  1N2F A;  4JI4 C;  4JYA C;  1ZB9 A;  2Y4O A;  3VNQ A;  4OYC A;  3A4I A;  3LNO A;  5JRH A;  4PUG A;  4GS5 A;  3N54 B;  3AF6 A;  4DV1 C;  4PUI A;  4B3M C;  1LQL A;  5DV9 A;  1O92 A;  4L7I A;  4JV5 C;  2KZ0 A;  4BSZ A;  3A25 A;  5BSW A;  4DR1 C;  2V7B A;  2WD9 A;  4GXR A;  3CW8 X;  3AY0 A;  3R9W A;  4GKK C;  3VNS A;  2JNV A;  4G37 A;  4JI0 C;  4JI5 C;  5AE2 A;  3NI2 A;  3E7X A;  3NYR A;  3FCC A;  3O2E A;  2Y27 A;  4X62 C;  5FLX D;  4B3T C;  5KYT A;  1XRA A;  2VQE C;  4B3R C;  5LMU C;  4RMN A;  5LCI A;  4NXM C;  2YWC A;  1AMU A;  3DLP X;  4XX2 A;  5BUS A;  2PT7 G;  3C5E A;  1N33 C;  1NYE A;  2PRO A;  2P2Q A;  2VZE A;  1IBL C;  3SO4 A;  2UXB C;  1KKG A;  4LF9 C;  4MTN A;  3J80 D;  4G36 A;  1ULT A;  2ZTB A;  1LCI A;  1USP A;  3CQ1 A;  2OPL A;  2BH1 X;  4LF5 C;  1JOS A;  5LMN C;  2ZZM A;  5IFI A;  4D4I A;  4KTT A;  4RM2 A;  2WP0 C;  2PG1 E;  3UX2 A;  1MXB A;  3A9U A;  3L8C A;  1VLA A;  5AE1 A;  1V60 A;  3GR0 A;  1MDB A;  4DR5 C;  2DHM A;  5GTD A;  1PG3 A;  3PRO C;  1NY8 A;  4DV2 C;  4NOZ A;  2UUC C;  3DHV A;  4FTF A;  4DCV A;  4ISB A;  1IB8 A;  4DCU A;  1XHJ A;  2ZM6 C;  1RY2 A;  2DYJ A;  4BBY A;  3UX3 A;  2JMP A;  5BSV A;  4LF7 C;  1XDX A;  3GR1 A;  4X66 C;  3RG2 A;  4DV5 C;  1T5H X;  1O9T A;  3TQI A;  3G7S A;  4KTV A;  1MKY A;  3I08 A;  3GKU A;  2P02 A;  3LGX A;  2MCQ A;  4U5Y D;  2MMA B;  3NYQ A;  4I9F A;  1HH2 P;  2QVZ X;  2VSQ A;  1IBM C;  4HPV A;  4LFA C;  4JI6 C;  2UU9 C;  4DV4 C;  4RLF A;  2E7G A;  4IZ6 A;  1HNZ C;  1HNX C;  2E0G A;  4L2Z A;  2D1Q A;  2D7V A;  1WH9 A;  1P4E C;  1P4E A;  4LF8 C;  4DR6 C;  4OXI A;  4JM1 A;  5T8T A;  5K85 A;  5E7Q A;  2P2M A;  3J81 D;  4BCA A;  4L4Q A;  5KYV A;  2QL8 A;  1V26 A;  2F4V C;  3JAM D;  2P2B A;  1N34 C;  4LFC C;  1V25 A;  2P2F A;  2KDN A;  5BSU A;  1EGA A;  1MD9 A;  5BSM A;  2UXC C;  2QVY X;  4ODJ A;  2YWB A;  5KEI A;  4GXQ A;  1XNQ C;  1I94 C;  4JI8 C;  4MH4 A; 
#chains in the Genus database with same CATH homology
 1ML8 A;  5A1I A;  5BUR A;  3A9V A;  4DV0 C;  3TUF A;  4R1L A;  1YJ7 A;  3KXW A;  4RVO A;  4FUQ A;  2DPL A;  3NPD A;  4FUT A;  1MDF A;  4K0B A;  5IWA C;  4DR2 C;  1PA4 A;  3RV2 A;  2PN2 A;  1XRB A;  1PG4 A;  4D4G A;  3CW9 A;  1UKK A;  4DV3 C;  3LNV A;  4WV3 A;  4NDN A;  4LF6 C;  5BST A;  4JI1 C;  3E7W A;  5AE3 A;  2OBV A;  1XRC A;  1HR0 C;  2XR1 A;  3UOW A;  2ATW A;  2CXC A;  2HHH C;  4B3S C;  4DV7 C;  2YCB A;  4LF4 C;  1QWI A;  2QW0 X;  4JI7 C;  1P7L A;  2BJO A;  4YY3 C;  4JI2 C;  3CJE A;  4WS9 A;  3TDE A;  3OTO C;  4BC9 A;  3I07 A;  4DV6 C;  4DR4 C;  3N2Q A;  4PRO C;  1WF3 A;  3FCE A;  4EAT A;  2CY1 A;  3PES A;  4DG8 A;  3R9X A;  4AQY C;  1HNW C;  2VQF C;  4GKJ C;  3IEU A;  4TPS B;  5T8S A;  5A1G A;  2AYA A;  3B7W A;  4RVN A;  2ASB A;  5BUQ A;  1XMQ C;  1QM4 A;  4DR3 C;  4G1I A;  3EER A;  4JI3 C;  3L95 X;  1GPM A;  2UXD C;  4DUZ C;  3IPL A;  3LAX A;  2E8C A;  3ETO A;  1XMO C;  4NXN C;  5H9U A;  5K8F A;  2E8E A;  2D1S A;  2KZF A;  3GPC A;  4D56 A;  2D27 A;  4DUY C;  2HJG A;  3EQ6 A;  4DR7 C;  5CZX A;  4IR7 A;  2QVX X;  2UUB C;  2P20 A;  3ETC A;  3LUS A;  4ZJZ A;  5BSR A;  3R44 A;  5A2Q D;  1USP B;  4LE5 A;  2OPL B;  4K0K C;  2Y4N A;  3IEV A;  4X64 C;  4R0M A;  4X65 C;  4DCT A;  1N32 C;  2D28 C;  2P2J A;  1L2F A;  2OO4 A;  5CZV A;  5IT9 D;  4DCS A;  4OX9 C;  1O93 A;  4KHP C;  1XNR C;  1FUG A;  1RG9 A;  3S82 A;  4D57 A;  3DAY A;  3UZ0 A;  4PZP A;  3AF5 A;  4DG9 A;  2E5L C;  3PBK A;  2UUA C;  4R1M A;  4BC7 A;  2D1T A;  1MXC A;  1K0R A;  5BR8 C;  4YHH C;  1O90 A;  3VNR A;  4PHT A;  1BA3 A;  4ZLP A;  4I9G A;  5ADZ A;  3J7A D;  3H2T A;  1N36 C;  5A19 A;  1T5D X;  1MXA A;  4LFB C;  4RM3 A;  2ONF A;  1FJG C;  1IBK C;  3T1Y C;  3T1H C;  1ZB8 A;  2EGT A;  2D1R A;  3IML A;  4RLQ A;  2E8F A;  1J5E C;  1N2F A;  4JI4 C;  4JYA C;  1ZB9 A;  2Y4O A;  3VNQ A;  4OYC A;  3A4I A;  5JRH A;  4GS5 A;  3N54 B;  3AF6 A;  4DV1 C;  4B3M C;  1LQL A;  5DV9 A;  1O92 A;  4L7I A;  4JV5 C;  4BSZ A;  5BSW A;  4DR1 C;  2V7B A;  2WD9 A;  4GXR A;  3CW8 X;  3R9W A;  4GKK C;  3VNS A;  4G37 A;  4JI0 C;  4JI5 C;  5AE2 A;  3NI2 A;  3E7X A;  3NYR A;  3FCC A;  4X62 C;  2Y27 A;  5FLX D;  4B3T C;  5KYT A;  1XRA A;  2VQE C;  4B3R C;  5LMU C;  4RMN A;  4NXM C;  2YWC A;  1AMU A;  3DLP X;  4XX2 A;  5BUS A;  2PT7 G;  3C5E A;  1N33 C;  1NYE A;  2PRO A;  2P2Q A;  2VZE A;  1IBL C;  3SO4 A;  2UXB C;  1KKG A;  4LF9 C;  4MTN A;  3J80 D;  4G36 A;  1ULT A;  1LCI A;  1USP A;  2OPL A;  2BH1 X;  4LF5 C;  1JOS A;  5LMN C;  5IFI A;  4D4I A;  4KTT A;  4RM2 A;  2WP0 C;  1MXB A;  3A9U A;  3L8C A;  1VLA A;  5AE1 A;  3GR0 A;  1MDB A;  4DR5 C;  5GTD A;  1PG3 A;  3PRO C;  4DV2 C;  4NOZ A;  2UUC C;  3DHV A;  4FTF A;  4DCV A;  4ISB A;  4DCU A;  2ZM6 C;  1RY2 A;  2DYJ A;  4BBY A;  2JMP A;  5BSV A;  4LF7 C;  3GR1 A;  4X66 C;  3RG2 A;  4DV5 C;  1T5H X;  1O9T A;  3TQI A;  3G7S A;  4KTV A;  1MKY A;  3I08 A;  3GKU A;  2P02 A;  3LGX A;  4U5Y D;  3NYQ A;  4I9F A;  1HH2 P;  2QVZ X;  2VSQ A;  1IBM C;  4HPV A;  4LFA C;  4JI6 C;  2UU9 C;  4DV4 C;  4RLF A;  2E7G A;  4IZ6 A;  1HNZ C;  1HNX C;  2E0G A;  4L2Z A;  2D1Q A;  2D7V A;  1WH9 A;  4LF8 C;  4DR6 C;  4OXI A;  4JM1 A;  5T8T A;  5K85 A;  5E7Q A;  2P2M A;  3J81 D;  4BCA A;  4L4Q A;  5KYV A;  2QL8 A;  1V26 A;  2F4V C;  3JAM D;  2P2B A;  1N34 C;  4LFC C;  1V25 A;  2P2F A;  5BSU A;  1EGA A;  1MD9 A;  5BSM A;  2UXC C;  2QVY X;  4ODJ A;  2YWB A;  5KEI A;  4GXQ A;  1XNQ C;  1I94 C;  4JI8 C;  4MH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...