4DR5C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 53
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr5C02
1USPA 4DCSA 4DUZC 3IEUA 2UUCC 4LF7C 2OPLB 2UXBC 4BSZA 4DV1C 1USPB 2E8EA 2BJOA 4DR7C 2PN2A 5A2QD 4GKJC 3CJEA 4OX9C 3OTOC 4DV4C 2UXCC 1N36C 1N2FA 4JI4C 4GKKC 1ZB8A 5LMUC 4X66C 4KHPC 4DV2C 4LF8C 1QWIA 2UU9C 3T1HC 2ATWA 4AQYC 1HR0C 3EERA 4DUYC 4LFCC 1IBKC 1J5EC 2KZFA 4DCUA 1NYEA 1IBMC 2CXCA 4X64C 5IT9D 1KKGA 2E7GA 2VQFC 1N32C 3J81D 4LF4C 4DR2C 4YY3C 1VLAA 4DV3C 4JV5C 4LF9C 1MKYA 3J7AD 4JI3C 4DCVA 1HNWC 4DV5C 4JI5C 4JYAC 1HH2P 4DCTA 4JI2C 3IEVA 2YCBA 5FLXD 4X62C 1LQLA 4DR6C 4MH4A 1WF3A 1ZB9A 1I94C 1XMQC 2F4VC 4MTNA 2ZM6C 2D7VA 2ONFA 3GKUA 1N34C 4B3SC 4K0KC 1ML8A 1L2FA 2HHHC 1XNQC 3T1YC 2UUAC 2DYJA 4JI1C 4DR4C 1EGAA 4B3MC 4JI8C 4LFBC 2E8CA 3J80D 5BR8C 1IBLC 1UKKA 4DR3C 5IWAC 4B3TC 1K0RA 1HNXC 4LF5C 4NXNC 3LUSA 2UXDC 2QL8A 3R9XA 3AF6A 4JI0C 4NXMC 4X65C 1WH9A 5LMNC 2JMPA 1JOSA 4DR5C 1FJGC 4JI6C 1XMOC 4NOZA 2E8FA 1N33C 4DV0C 4XX2A 4LF6C 3R9WA 4JI7C 2E5LC 3AF5A 2EGTA 3JAMD 1PA4A 2VQEC 4YHHC 1XNRC 4B3RC 2CY1A 4DV7C 1HNZC 3I07A 4DV6C 2XR1A 2UUBC 2PT7G 2ASBA 2OPLA 2HJGA 4DR1C 4LFAC
chains in the Genus database with same CATH superfamily
1USPA 4DUZC 4LF7C 4WS9A 2E8EA 2P20A 2CU6A 2BJOA 4ZLPA 3DAYA 2OO4A 4GS5A 2YWBA 4I9GA 1N36C 4JM1A 5KYTA 4KTVA 2ATWA 4DUYC 1IBKC 4DCUA 4U5YD 4NDNA 3S82A 4FUQA 2QVZX 4LE5A 2CXCA 4X64C 3TUFA 1MDBA 4R1MA 4EATA 1N32C 3I08A 3E7XA 5GTDA 1MKYA 5CZXA 5A1IA 4RM3A 3CQ2A 4JI5C 1MD9A 4JYAC 1HH2P 3DLPX 5DV9A 1GPMA 1LQLA 1M6XA 3L8CA 3NYQA 1T5DX 4GXRA 1N34C 3E7WA 3AY0A 1L2FA 3ETOA 2QW0X 3A9UA 4LFBC 5BUSA 1IBLC 1K0RA 1XRCA 1RY2A 4LF5C 2QL8A 3L95X 5CZVA 1V60A 4NXMC 4JI0C 2Y27A 4HPVA 5KEIA 2QVYX 1O93A 1MXCA 1FJGC 4NOZA 3A4IA 2P2MA 4LF6C 3AF5A 3GR1A 2VQEC 1MXBA 4YHHC 2P2FA 1RG9A 4RVNA 1ULTA 3I07A 3EQ6A 4DV6C 2XR1A 5BURA 3RV2A 2HJGA 1XDXA 1V26A 4K0BA 5JRHA 3A9VA 1XS3A 2PN2A 3A26A 1M6XC 4D56A 3OTOC 4DV4C 1PU1A 2UXCC 3PESA 2VSQA 3IMLA 4DG8A 4DV2C 3N54B 2KDNA 4LF8C 1T5HX 3EERA 4LFCC 3FCCA 1J5EC 1UWDA 3VNRA 1NYEA 2OBVA 3H2TA 5K8FA 1YJ7A 3CW8X 1KKGA 2VQFC 3J81D 3TDEA 3LNVA 4JV5C 5AE1A 3J7AD 1IB8A 4L4QA 1VEHA 4OYCA 1MDFA 2YCBA 4IZ6A 5FLXD 2WD9A 1XHJA 4MH4A 1PG4A 1I94C 4RM2A 1XMQC 3LNOA 2D7VA 2ONFA 3GKUA 1AMUA 4R0MA 2ZZMA 2HHHC 2PG1E 3TQIA 2UUAC 2ZZNA 4B3MC 1V25A 3J80D 5BR8C 1FLOA 4R1LA 1HNXC 1BA3A 5KYVA 3UX3A 3R9XA 2Z51A 2P2JA 3CW9A 2JMPA 4DR5C 2E8FA 3PBKA 3R9WA 4JI7C 2EGTA 2BH1X 4D57A 1PA4A 4RLQA 3SO4A 5T8SA 2UUBC 2PT7G 2M5OA 3FCEA 4LFAC 5BSMA 4DCSA 2DHMA 2YWCA 3IEUA 2UUCC 2OPLB 4BSZA 4DV1C 1USPB 3KXWA 4ODJA 5BSUA 5T8TA 2M5HA 4DR7C 2VZEA 5A2QD 3FM7A 4G36A 4GXQA 2KZ0A 3NI2A 2WP0C 1N2FA 3R44A 4JI4C 5AE3A 4GKKC 1ZB8A 3CQ3A 5LMUC 3UEBA 1QWIA 2UU9C 5BSVA 3T1HC 4L7IA 1HR0C 4PUIA 2P2QA 2MCQA 4PZPA 3C5EA 1QM4A 1IBMC 3LAXA 2D28C 2E7GA 4ZJZA 4DR2C 4YY3C 4D4IA 4LF9C 4JI3C 4RMNA 1HNWC 4DV5C 1XRAA 4DG9A 4DCTA 4JI2C 4X62C 1LCIA 1ZB9A 4MTNA 4WV3A 1P4EA 1YGTA 2P02A 5H9UA 3O2EA 4K0KC 1ML8A 5BSTA 5IFIA 1XNQC 1P7LA 2DYJA 4JI1C 4DR4C 1EGAA 3A25A 4JI8C 4RVOA 2E8CA 5A19A 4ISBA 2QVXX 4DR3C 4B3TC 1O90A 3NYRA 4BCAA 4G1IA 3AF6A 2MM9A 2E0GA 1WH9A 3VNQA 3B7WA 1XMOC 1N33C 5K85A 4DV0C 4XX2A 2E5LC 2D1TA 4B3RC 4DV7C 1HNZC 1PG3A 2ASBA 2OPLA 3UZ0A 4DR1C 1NY8A 2D27A 2AYAA 1TH5A 2UXBC 4IR7A 3GR0A 5A1GA 4GKJC 3CJEA 4OX9C 3TR3A 1O92A 4PUHA 1MXAA 4BC9A 4X66C 4KHPC 5BUQA 4AQYC 4TPSB 3G7SA 2KZFA 5E7QA 3CQ1A 4I9FA 5IT9D 2D1SA 4PROC 4LF4C 1VLAA 4DV3C 5BSWA 3LGXA 4BC7A 1FUGA 4DCVA 3IEVA 1O9TA 2YX1A 4DR6C 1WF3A 3PROC 3GPCA 2JNVA 2DPLA 4FTFA 4D4GA 2F4VC 2ZM6C 4B3SC 1XRBA 4PHTA 4L2ZA 2ZTBA 3T1YC 2V7BA 3ETCA 2PROA 5BSRA 2NCLA 3NPDA 1UKKA 5IWAC 2Y4OA 4NXNC 3LUSA 4RLFA 2UXDC 4G37A 5AE2A 2P2BA 5LCIA 2D1RA 3N2QA 4X65C 1WCJA 2D1QA 3VNSA 4OXIA 5LMNC 1JOSA 1P4EC 4PUGA 4FUTA 4JI6C 3IPLA 2Y4NA 4BBYA 3JAMD 4KTTA 1XNRC 2CY1A 5ADZA 3K6RA 3UX2A 2MMAB 3UOWA 3RG2A 3DHVA
chains in the Genus database with same CATH topology
1USPA 4DUZC 4LF7C 4WS9A 2E8EA 2P20A 2BJOA 4ZLPA 3DAYA 2OO4A 4GS5A 2YWBA 4I9GA 1N36C 4JM1A 5KYTA 4KTVA 2ATWA 4DUYC 1IBKC 4DCUA 4U5YD 4NDNA 3S82A 4FUQA 2QVZX 4LE5A 2CXCA 4X64C 3TUFA 1MDBA 4R1MA 4EATA 1N32C 3I08A 3E7XA 5GTDA 1MKYA 5CZXA 5A1IA 4RM3A 4JI5C 1MD9A 4JYAC 1HH2P 3DLPX 5DV9A 1GPMA 1LQLA 3L8CA 3NYQA 1T5DX 4GXRA 1N34C 3E7WA 1L2FA 3ETOA 2QW0X 3A9UA 4LFBC 5BUSA 1IBLC 1K0RA 1XRCA 1RY2A 4LF5C 2QL8A 3L95X 5CZVA 4JI0C 4NXMC 2Y27A 4HPVA 5KEIA 2QVYX 1O93A 1MXCA 1FJGC 4NOZA 3A4IA 2P2MA 4LF6C 3AF5A 3GR1A 2VQEC 1MXBA 4YHHC 2P2FA 1RG9A 4RVNA 1ULTA 3I07A 3EQ6A 4DV6C 2XR1A 5BURA 3RV2A 2HJGA 1V26A 4K0BA 5JRHA 3A9VA 2PN2A 4D56A 3OTOC 4DV4C 2UXCC 3PESA 2VSQA 3IMLA 4DG8A 4DV2C 3N54B 4LF8C 1T5HX 3EERA 4LFCC 3FCCA 1J5EC 3VNRA 1NYEA 2OBVA 3H2TA 5K8FA 1YJ7A 3CW8X 1KKGA 2VQFC 3J81D 3TDEA 3LNVA 4JV5C 5AE1A 3J7AD 4L4QA 4OYCA 1MDFA 2YCBA 4IZ6A 5FLXD 2WD9A 4MH4A 1PG4A 1I94C 4RM2A 1XMQC 2D7VA 2ONFA 3GKUA 1AMUA 4R0MA 2HHHC 3TQIA 2UUAC 4B3MC 1V25A 3J80D 5BR8C 4R1LA 1HNXC 1BA3A 5KYVA 3R9XA 2P2JA 3CW9A 2JMPA 4DR5C 2E8FA 3PBKA 3R9WA 4JI7C 2EGTA 2BH1X 4D57A 1PA4A 4RLQA 3SO4A 5T8SA 2UUBC 2PT7G 3FCEA 4LFAC 5BSMA 4DCSA 2YWCA 3IEUA 2UUCC 2OPLB 4BSZA 4DV1C 1USPB 3KXWA 4ODJA 5BSUA 5T8TA 4DR7C 2VZEA 5A2QD 4G36A 4GXQA 3NI2A 2WP0C 1N2FA 3R44A 4JI4C 5AE3A 4GKKC 1ZB8A 5LMUC 1QWIA 2UU9C 5BSVA 3T1HC 4L7IA 1HR0C 2P2QA 4PZPA 3C5EA 1QM4A 1IBMC 3LAXA 2D28C 2E7GA 4ZJZA 4DR2C 4YY3C 4D4IA 4LF9C 4JI3C 4RMNA 1HNWC 4DV5C 1XRAA 4DG9A 4DCTA 4JI2C 4X62C 1LCIA 1ZB9A 4MTNA 4WV3A 2P02A 5H9UA 4K0KC 1ML8A 5BSTA 5IFIA 1XNQC 1P7LA 2DYJA 4JI1C 4DR4C 1EGAA 4JI8C 4RVOA 2E8CA 5A19A 4ISBA 2QVXX 4DR3C 4B3TC 1O90A 3NYRA 4BCAA 4G1IA 3AF6A 2E0GA 1WH9A 3VNQA 3B7WA 1XMOC 1N33C 5K85A 4DV0C 4XX2A 2E5LC 2D1TA 4B3RC 4DV7C 1HNZC 1PG3A 2ASBA 2OPLA 3UZ0A 4DR1C 2D27A 2AYAA 2UXBC 4IR7A 3GR0A 5A1GA 4GKJC 3CJEA 4OX9C 1O92A 1MXAA 4BC9A 4X66C 4KHPC 5BUQA 4AQYC 4TPSB 3G7SA 2KZFA 5E7QA 4I9FA 5IT9D 2D1SA 4PROC 4LF4C 1VLAA 4DV3C 5BSWA 3LGXA 4BC7A 1FUGA 4DCVA 3IEVA 1O9TA 4DR6C 1WF3A 3PROC 3GPCA 2DPLA 4FTFA 4D4GA 2F4VC 2ZM6C 4B3SC 1XRBA 4PHTA 4L2ZA 3T1YC 2V7BA 3ETCA 2PROA 5BSRA 3NPDA 1UKKA 5IWAC 2Y4OA 4NXNC 3LUSA 4RLFA 2UXDC 4G37A 5AE2A 2P2BA 2D1RA 3N2QA 4X65C 3VNSA 2D1QA 4OXIA 5LMNC 1JOSA 4FUTA 4JI6C 3IPLA 2Y4NA 4BBYA 3JAMD 4KTTA 1XNRC 2CY1A 5ADZA 3UOWA 3RG2A 3DHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP A;  4DCS A;  4DUZ C;  3IEU A;  2UUC C;  4LF7 C;  2OPL B;  2UXB C;  4BSZ A;  4DV1 C;  1USP B;  2E8E A;  2BJO A;  4DR7 C;  2PN2 A;  5A2Q D;  4GKJ C;  3CJE A;  4OX9 C;  3OTO C;  4DV4 C;  2UXC C;  1N36 C;  1N2F A;  4JI4 C;  4GKK C;  1ZB8 A;  5LMU C;  4X66 C;  4KHP C;  4DV2 C;  4LF8 C;  1QWI A;  2UU9 C;  3T1H C;  2ATW A;  4AQY C;  1HR0 C;  3EER A;  4DUY C;  4LFC C;  1IBK C;  1J5E C;  2KZF A;  4DCU A;  1NYE A;  1IBM C;  2CXC A;  4X64 C;  5IT9 D;  1KKG A;  2E7G A;  2VQF C;  1N32 C;  3J81 D;  4LF4 C;  4DR2 C;  4YY3 C;  1VLA A;  4DV3 C;  4JV5 C;  4LF9 C;  1MKY A;  3J7A D;  4JI3 C;  4DCV A;  1HNW C;  4DV5 C;  4JI5 C;  4JYA C;  1HH2 P;  4DCT A;  4JI2 C;  3IEV A;  2YCB A;  5FLX D;  4X62 C;  1LQL A;  4DR6 C;  4MH4 A;  1WF3 A;  1ZB9 A;  1I94 C;  1XMQ C;  2F4V C;  4MTN A;  2ZM6 C;  2D7V A;  2ONF A;  3GKU A;  1N34 C;  4B3S C;  4K0K C;  1ML8 A;  1L2F A;  2HHH C;  1XNQ C;  3T1Y C;  2UUA C;  2DYJ A;  4JI1 C;  4DR4 C;  1EGA A;  4B3M C;  4JI8 C;  4LFB C;  2E8C A;  3J80 D;  5BR8 C;  1IBL C;  1UKK A;  4DR3 C;  5IWA C;  4B3T C;  1K0R A;  1HNX C;  4LF5 C;  4NXN C;  3LUS A;  2UXD C;  2QL8 A;  3R9X A;  3AF6 A;  4JI0 C;  4NXM C;  4X65 C;  1WH9 A;  5LMN C;  2JMP A;  1JOS A;  4DR5 C;  1FJG C;  4JI6 C;  1XMO C;  4NOZ A;  2E8F A;  1N33 C;  4DV0 C;  4XX2 A;  4LF6 C;  3R9W A;  4JI7 C;  2E5L C;  3AF5 A;  2EGT A;  3JAM D;  1PA4 A;  2VQE C;  4YHH C;  1XNR C;  4B3R C;  2CY1 A;  4DV7 C;  1HNZ C;  3I07 A;  4DV6 C;  2XR1 A;  2UUB C;  2PT7 G;  2ASB A;  2OPL A;  2HJG A;  4DR1 C;  4LFA C; 
#chains in the Genus database with same CATH topology
 1USP A;  4DUZ C;  4LF7 C;  4WS9 A;  2E8E A;  2P20 A;  2CU6 A;  2BJO A;  4ZLP A;  3DAY A;  2OO4 A;  4GS5 A;  2YWB A;  4I9G A;  1N36 C;  4JM1 A;  5KYT A;  4KTV A;  2ATW A;  4DUY C;  1IBK C;  4DCU A;  4U5Y D;  4NDN A;  3S82 A;  4FUQ A;  2QVZ X;  4LE5 A;  2CXC A;  4X64 C;  3TUF A;  1MDB A;  4R1M A;  4EAT A;  1N32 C;  3I08 A;  3E7X A;  5GTD A;  1MKY A;  5CZX A;  5A1I A;  4RM3 A;  3CQ2 A;  4JI5 C;  1MD9 A;  4JYA C;  1HH2 P;  3DLP X;  5DV9 A;  1GPM A;  1LQL A;  1M6X A;  3L8C A;  3NYQ A;  1T5D X;  4GXR A;  1N34 C;  3E7W A;  3AY0 A;  1L2F A;  3ETO A;  2QW0 X;  3A9U A;  4LFB C;  5BUS A;  1IBL C;  1K0R A;  1XRC A;  1RY2 A;  4LF5 C;  2QL8 A;  3L95 X;  5CZV A;  1V60 A;  4NXM C;  4JI0 C;  2Y27 A;  4HPV A;  5KEI A;  2QVY X;  1O93 A;  1MXC A;  1FJG C;  4NOZ A;  3A4I A;  2P2M A;  4LF6 C;  3AF5 A;  3GR1 A;  2VQE C;  1MXB A;  4YHH C;  2P2F A;  1RG9 A;  4RVN A;  1ULT A;  3I07 A;  3EQ6 A;  4DV6 C;  2XR1 A;  5BUR A;  3RV2 A;  2HJG A;  1XDX A;  1V26 A;  4K0B A;  5JRH A;  3A9V A;  1XS3 A;  2PN2 A;  3A26 A;  1M6X C;  4D56 A;  3OTO C;  4DV4 C;  1PU1 A;  2UXC C;  3PES A;  2VSQ A;  3IML A;  4DG8 A;  4DV2 C;  3N54 B;  2KDN A;  4LF8 C;  1T5H X;  3EER A;  4LFC C;  3FCC A;  1J5E C;  1UWD A;  3VNR A;  1NYE A;  2OBV A;  3H2T A;  5K8F A;  1YJ7 A;  3CW8 X;  1KKG A;  2VQF C;  3J81 D;  3TDE A;  3LNV A;  4JV5 C;  5AE1 A;  3J7A D;  1IB8 A;  4L4Q A;  1VEH A;  4OYC A;  1MDF A;  2YCB A;  4IZ6 A;  5FLX D;  2WD9 A;  1XHJ A;  4MH4 A;  1PG4 A;  1I94 C;  4RM2 A;  1XMQ C;  3LNO A;  2D7V A;  2ONF A;  3GKU A;  1AMU A;  4R0M A;  2ZZM A;  2HHH C;  2PG1 E;  3TQI A;  2UUA C;  2ZZN A;  4B3M C;  1V25 A;  3J80 D;  5BR8 C;  1FLO A;  4R1L A;  1HNX C;  1BA3 A;  5KYV A;  3UX3 A;  3R9X A;  2Z51 A;  2P2J A;  3CW9 A;  2JMP A;  4DR5 C;  2E8F A;  3PBK A;  3R9W A;  4JI7 C;  2EGT A;  2BH1 X;  4D57 A;  1PA4 A;  4RLQ A;  3SO4 A;  5T8S A;  2UUB C;  2PT7 G;  2M5O A;  3FCE A;  4LFA C;  5BSM A;  4DCS A;  2DHM A;  2YWC A;  3IEU A;  2UUC C;  2OPL B;  4BSZ A;  4DV1 C;  1USP B;  3KXW A;  4ODJ A;  5BSU A;  5T8T A;  2M5H A;  4DR7 C;  2VZE A;  5A2Q D;  3FM7 A;  4G36 A;  4GXQ A;  2KZ0 A;  3NI2 A;  2WP0 C;  1N2F A;  3R44 A;  4JI4 C;  5AE3 A;  4GKK C;  1ZB8 A;  3CQ3 A;  5LMU C;  3UEB A;  1QWI A;  2UU9 C;  5BSV A;  3T1H C;  4L7I A;  1HR0 C;  4PUI A;  2P2Q A;  2MCQ A;  4PZP A;  3C5E A;  1QM4 A;  1IBM C;  3LAX A;  2D28 C;  2E7G A;  4ZJZ A;  4DR2 C;  4YY3 C;  4D4I A;  4LF9 C;  4JI3 C;  4RMN A;  1HNW C;  4DV5 C;  1XRA A;  4DG9 A;  4DCT A;  4JI2 C;  4X62 C;  1LCI A;  1ZB9 A;  4MTN A;  4WV3 A;  1P4E A;  1YGT A;  2P02 A;  5H9U A;  3O2E A;  4K0K C;  1ML8 A;  5BST A;  5IFI A;  1XNQ C;  1P7L A;  2DYJ A;  4JI1 C;  4DR4 C;  1EGA A;  3A25 A;  4JI8 C;  4RVO A;  2E8C A;  5A19 A;  4ISB A;  2QVX X;  4DR3 C;  4B3T C;  1O90 A;  3NYR A;  4BCA A;  4G1I A;  3AF6 A;  2MM9 A;  2E0G A;  1WH9 A;  3VNQ A;  3B7W A;  1XMO C;  1N33 C;  5K85 A;  4DV0 C;  4XX2 A;  2E5L C;  2D1T A;  4B3R C;  4DV7 C;  1HNZ C;  1PG3 A;  2ASB A;  2OPL A;  3UZ0 A;  4DR1 C;  1NY8 A;  2D27 A;  2AYA A;  1TH5 A;  2UXB C;  4IR7 A;  3GR0 A;  5A1G A;  4GKJ C;  3CJE A;  4OX9 C;  3TR3 A;  1O92 A;  4PUH A;  1MXA A;  4BC9 A;  4X66 C;  4KHP C;  5BUQ A;  4AQY C;  4TPS B;  3G7S A;  2KZF A;  5E7Q A;  3CQ1 A;  4I9F A;  5IT9 D;  2D1S A;  4PRO C;  4LF4 C;  1VLA A;  4DV3 C;  5BSW A;  3LGX A;  4BC7 A;  1FUG A;  4DCV A;  3IEV A;  1O9T A;  2YX1 A;  4DR6 C;  1WF3 A;  3PRO C;  3GPC A;  2JNV A;  2DPL A;  4FTF A;  4D4G A;  2F4V C;  2ZM6 C;  4B3S C;  1XRB A;  4PHT A;  4L2Z A;  2ZTB A;  3T1Y C;  2V7B A;  3ETC A;  2PRO A;  5BSR A;  2NCL A;  3NPD A;  1UKK A;  5IWA C;  2Y4O A;  4NXN C;  3LUS A;  4RLF A;  2UXD C;  4G37 A;  5AE2 A;  2P2B A;  5LCI A;  2D1R A;  3N2Q A;  4X65 C;  1WCJ A;  2D1Q A;  3VNS A;  4OXI A;  5LMN C;  1JOS A;  1P4E C;  4PUG A;  4FUT A;  4JI6 C;  3IPL A;  2Y4N A;  4BBY A;  3JAM D;  4KTT A;  1XNR C;  2CY1 A;  5ADZ A;  3K6R A;  3UX2 A;  2MMA B;  3UOW A;  3RG2 A;  3DHV A; 
#chains in the Genus database with same CATH homology
 1USP A;  4DUZ C;  4LF7 C;  4WS9 A;  2E8E A;  2P20 A;  2BJO A;  4ZLP A;  3DAY A;  2OO4 A;  4GS5 A;  2YWB A;  4I9G A;  1N36 C;  4JM1 A;  5KYT A;  4KTV A;  2ATW A;  4DUY C;  1IBK C;  4DCU A;  4U5Y D;  4NDN A;  3S82 A;  4FUQ A;  2QVZ X;  4LE5 A;  2CXC A;  4X64 C;  3TUF A;  1MDB A;  4R1M A;  4EAT A;  1N32 C;  3I08 A;  3E7X A;  5GTD A;  1MKY A;  5CZX A;  5A1I A;  4RM3 A;  4JI5 C;  1MD9 A;  4JYA C;  1HH2 P;  3DLP X;  5DV9 A;  1GPM A;  1LQL A;  3L8C A;  3NYQ A;  1T5D X;  4GXR A;  1N34 C;  3E7W A;  1L2F A;  3ETO A;  2QW0 X;  3A9U A;  4LFB C;  5BUS A;  1IBL C;  1K0R A;  1XRC A;  1RY2 A;  4LF5 C;  2QL8 A;  3L95 X;  5CZV A;  4JI0 C;  4NXM C;  2Y27 A;  4HPV A;  5KEI A;  2QVY X;  1O93 A;  1MXC A;  1FJG C;  4NOZ A;  3A4I A;  2P2M A;  4LF6 C;  3AF5 A;  3GR1 A;  2VQE C;  1MXB A;  4YHH C;  2P2F A;  1RG9 A;  4RVN A;  1ULT A;  3I07 A;  3EQ6 A;  4DV6 C;  2XR1 A;  5BUR A;  3RV2 A;  2HJG A;  1V26 A;  4K0B A;  5JRH A;  3A9V A;  2PN2 A;  4D56 A;  3OTO C;  4DV4 C;  2UXC C;  3PES A;  2VSQ A;  3IML A;  4DG8 A;  4DV2 C;  3N54 B;  4LF8 C;  1T5H X;  3EER A;  4LFC C;  3FCC A;  1J5E C;  3VNR A;  1NYE A;  2OBV A;  3H2T A;  5K8F A;  1YJ7 A;  3CW8 X;  1KKG A;  2VQF C;  3J81 D;  3TDE A;  3LNV A;  4JV5 C;  5AE1 A;  3J7A D;  4L4Q A;  4OYC A;  1MDF A;  2YCB A;  4IZ6 A;  5FLX D;  2WD9 A;  4MH4 A;  1PG4 A;  1I94 C;  4RM2 A;  1XMQ C;  2D7V A;  2ONF A;  3GKU A;  1AMU A;  4R0M A;  2HHH C;  3TQI A;  2UUA C;  4B3M C;  1V25 A;  3J80 D;  5BR8 C;  4R1L A;  1HNX C;  1BA3 A;  5KYV A;  3R9X A;  2P2J A;  3CW9 A;  2JMP A;  4DR5 C;  2E8F A;  3PBK A;  3R9W A;  4JI7 C;  2EGT A;  2BH1 X;  4D57 A;  1PA4 A;  4RLQ A;  3SO4 A;  5T8S A;  2UUB C;  2PT7 G;  3FCE A;  4LFA C;  5BSM A;  4DCS A;  2YWC A;  3IEU A;  2UUC C;  2OPL B;  4BSZ A;  4DV1 C;  1USP B;  3KXW A;  4ODJ A;  5BSU A;  5T8T A;  4DR7 C;  2VZE A;  5A2Q D;  4G36 A;  4GXQ A;  3NI2 A;  2WP0 C;  1N2F A;  3R44 A;  4JI4 C;  5AE3 A;  4GKK C;  1ZB8 A;  5LMU C;  1QWI A;  2UU9 C;  5BSV A;  3T1H C;  4L7I A;  1HR0 C;  2P2Q A;  4PZP A;  3C5E A;  1QM4 A;  1IBM C;  3LAX A;  2D28 C;  2E7G A;  4ZJZ A;  4DR2 C;  4YY3 C;  4D4I A;  4LF9 C;  4JI3 C;  4RMN A;  1HNW C;  4DV5 C;  1XRA A;  4DG9 A;  4DCT A;  4JI2 C;  4X62 C;  1LCI A;  1ZB9 A;  4MTN A;  4WV3 A;  2P02 A;  5H9U A;  4K0K C;  1ML8 A;  5BST A;  5IFI A;  1XNQ C;  1P7L A;  2DYJ A;  4JI1 C;  4DR4 C;  1EGA A;  4JI8 C;  4RVO A;  2E8C A;  5A19 A;  4ISB A;  2QVX X;  4DR3 C;  4B3T C;  1O90 A;  3NYR A;  4BCA A;  4G1I A;  3AF6 A;  2E0G A;  1WH9 A;  3VNQ A;  3B7W A;  1XMO C;  1N33 C;  5K85 A;  4DV0 C;  4XX2 A;  2E5L C;  2D1T A;  4B3R C;  4DV7 C;  1HNZ C;  1PG3 A;  2ASB A;  2OPL A;  3UZ0 A;  4DR1 C;  2D27 A;  2AYA A;  2UXB C;  4IR7 A;  3GR0 A;  5A1G A;  4GKJ C;  3CJE A;  4OX9 C;  1O92 A;  1MXA A;  4BC9 A;  4X66 C;  4KHP C;  5BUQ A;  4AQY C;  4TPS B;  3G7S A;  2KZF A;  5E7Q A;  4I9F A;  5IT9 D;  2D1S A;  4PRO C;  4LF4 C;  1VLA A;  4DV3 C;  5BSW A;  3LGX A;  4BC7 A;  1FUG A;  4DCV A;  3IEV A;  1O9T A;  4DR6 C;  1WF3 A;  3PRO C;  3GPC A;  2DPL A;  4FTF A;  4D4G A;  2F4V C;  2ZM6 C;  4B3S C;  1XRB A;  4PHT A;  4L2Z A;  3T1Y C;  2V7B A;  3ETC A;  2PRO A;  5BSR A;  3NPD A;  1UKK A;  5IWA C;  2Y4O A;  4NXN C;  3LUS A;  4RLF A;  2UXD C;  4G37 A;  5AE2 A;  2P2B A;  2D1R A;  3N2Q A;  4X65 C;  3VNS A;  2D1Q A;  4OXI A;  5LMN C;  1JOS A;  4FUT A;  4JI6 C;  3IPL A;  2Y4N A;  4BBY A;  3JAM D;  4KTT A;  1XNR C;  2CY1 A;  5ADZ A;  3UOW A;  3RG2 A;  3DHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...