4DR5C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 53
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr5C02
1JOSA 1MKYA 3J81D 1N34C 2E8FA 3JAMD 4LF7C 1UKKA 1USPA 1WH9A 3IEUA 5IWAC 4JI1C 5IT9D 1I94C 4JYAC 2EGTA 1ZB8A 3I07A 3R9XA 4DR6C 5A2QD 2YCBA 4JI0C 2UU9C 2OPLA 4LFCC 1WF3A 4DR1C 4DCTA 4X64C 5LMNC 4LF6C 4DUYC 1ML8A 4DUZC 4NOZA 2ZM6C 1VLAA 4GKKC 2UUBC 1PA4A 2UXBC 1J5EC 1XNQC 5BR8C 2CY1A 2KZFA 4DCSA 2PT7G 2ATWA 4JI3C 3J7AD 4JI4C 4YHHC 2UXCC 2UXDC 5LMUC 4BSZA 4DCVA 4DR3C 2E8CA 2UUCC 3AF5A 4JI2C 3GKUA 4X65C 3T1HC 4KHPC 4NXMC 3J80D 4MH4A 1IBKC 3CJEA 3T1YC 4B3SC 4JI6C 2ASBA 4MTNA 4LFBC 2D7VA 4YY3C 2CXCA 4LF5C 2ONFA 4DV4C 4DV2C 4LF9C 4LFAC 4B3RC 3OTOC 1IBMC 4DR2C 3LUSA 1NYEA 5FLXD 3AF6A 1N32C 4DCUA 2XR1A 4JI8C 2OPLB 4X66C 4AQYC 2HHHC 4B3MC 1ZB9A 3EERA 1L2FA 3R9WA 2QL8A 4B3TC 4DV0C 4DR5C 4JV5C 2E8EA 4LF8C 4OX9C 1QWIA 1N36C 1XMQC 4JI5C 2E5LC 1XNRC 1KKGA 1USPB 1HNXC 1HH2P 2PN2A 4DV1C 4DV7C 4NXNC 1N2FA 4DV5C 1IBLC 4DV6C 3IEVA 1LQLA 4DR7C 1K0RA 2JMPA 1HR0C 4LF4C 1HNWC 2F4VC 1FJGC 4GKJC 2HJGA 2VQFC 4DR4C 2DYJA 2VQEC 4K0KC 2UUAC 1XMOC 2BJOA 2E7GA 4DV3C 4X62C 1EGAA 4XX2A 1HNZC 4JI7C 1N33C
chains in the Genus database with same CATH superfamily
1JOSA 5LCIA 3J81D 3DAYA 4LF7C 1UKKA 3FCCA 3IEUA 5DV9A 4JI1C 1ZB8A 5A2QD 1WF3A 4X64C 4LF6C 4TPSB 4ODJA 3EQ6A 2MMAB 4NOZA 2UUBC 1PA4A 3NPDA 1J5EC 3UX3A 2Y27A 2KZFA 5BUSA 2PT7G 3O2EA 3J7AD 1LCIA 1P7LA 4DG9A 4D56A 4DCVA 3UZ0A 4FUQA 3FM7A 2QW0X 4KHPC 4NXMC 1XRAA 1T5HX 1IBKC 2DHMA 4JI6C 2BH1X 5BSMA 1XHJA 2D7VA 5T8TA 4LF5C 1M6XA 4LFAC 3OTOC 5AE1A 5T8SA 1QM4A 1YGTA 3L8CA 5H9UA 2D28C 2XR1A 1XRBA 3NI2A 5A1IA 2Z51A 5BSVA 2DPLA 2QVYX 1O93A 2QL8A 4RLFA 4RVNA 3TDEA 4LF8C 1KKGA 3A25A 3RV2A 4K0BA 3A4IA 4DV1C 1NY8A 3NYQA 4U5YD 3VNQA 2WP0C 4BC9A 3IEVA 1K0RA 2KDNA 5GTDA 3G7SA 3LGXA 4DR4C 1MD9A 4G36A 4DV3C 4L7IA 2QVXX 4X62C 1EGAA 3NYRA 1HNZC 2CU6A 4D57A 5KYTA 3A9UA 5IWAC 2P2FA 4JYAC 3GR1A 4GXQA 3CQ1A 4JI0C 2OPLA 4DR1C 3E7WA 2Y4OA 5IFIA 4HPVA 2AYAA 1VLAA 1FLOA 3GPCA 2D1RA 4RVOA 4DCSA 2YWBA 3R44A 2UXDC 4BSZA 1XS3A 3CQ3A 2E8CA 3DHVA 3AF5A 4JI2C 2P2JA 2D1QA 1GPMA 1T5DX 4X65C 3TUFA 4R1MA 3A9VA 3CJEA 5BURA 2ASBA 4LFBC 2NCLA 5AE3A 1BA3A 2CXCA 2ONFA 1NYEA 2P2MA 1PG3A 4RLQA 2OPLB 4X66C 4AQYC 2OO4A 3C5EA 1O9TA 1ZB9A 2PROA 3EERA 3R9WA 4I9GA 3LNVA 1PG4A 4DR5C 2E8EA 1YJ7A 4OX9C 1QWIA 1XNRC 1XMQC 2E0GA 4NXNC 4IZ6A 1IBLC 2M5OA 4IR7A 4D4IA 4PROC 1TH5A 1HNWC 3FCEA 5BUQA 5CZVA 3IMLA 4GKJC 2VQFC 2DYJA 3GR0A 3RG2A 3TQIA 4I9FA 4EATA 4R0MA 3UOWA 4PZPA 3UX2A 3JAMD 2P02A 3E7XA 2VSQA 3I07A 4DG8A 4FUTA 2YCBA 2M5HA 2UU9C 4LFCC 5K8FA 5KEIA 5LMNC 3CW9A 3DLPX 3ETOA 1PU1A 2UXBC 5BR8C 2KZ0A 2P20A 4JI4C 5AE2A 2UXCC 5LMUC 1UWDA 3CW8X 3I08A 5K85A 5CZXA 2UUCC 3K6RA 3ETCA 2OBVA 1RG9A 5A19A 3IPLA 4WV3A 3T1YC 4MTNA 4YY3C 2QVZX 4JM1A 5BSWA 2YWCA 5E7QA 2YX1A 1IBMC 4DR2C 2MM9A 3LUSA 5FLXD 3AF6A 1N32C 4DCUA 1XDXA 2HHHC 5ADZA 4NDNA 3AY0A 1MXAA 2Y4NA 1V25A 2P2QA 1L2FA 4B3TC 1P4EA 4DV0C 4JV5C 2D27A 4GXRA 4L4QA 5BSRA 1HNXC 5KYVA 1HH2P 2PN2A 4DV7C 1N2FA 1RY2A 1WCJA 4RM3A 2P2BA 1HR0C 4LF4C 2PG1E 2HJGA 3VNRA 2VZEA 1XMOC 2UUAC 3PROC 4LE5A 2BJOA 2E7GA 4G37A 1V26A 4PHTA 4L2ZA 4XX2A 3LNOA 1MKYA 3B7WA 3PBKA 1N34C 2E8FA 3N54B 4ZJZA 1USPA 1WH9A 2ZZNA 5IT9D 1I94C 2ZTBA 2EGTA 3R9XA 4DR6C 1M6XC 1AMUA 2JNVA 3L95X 4DCTA 3LAXA 3S82A 3TR3A 4DUYC 1ML8A 4DUZC 1IB8A 2ZM6C 4GKKC 1FUGA 5BSTA 4R1LA 2D1SA 4PUIA 4BCAA 1XNQC 2CY1A 2D1TA 4D4GA 1ULTA 2ATWA 4JI3C 4YHHC 4DR3C 4FTFA 2WD9A 4RMNA 1VEHA 3N2QA 1V60A 1P4EC 4PUHA 3GKUA 1MDFA 3T1HC 1MXBA 3J80D 4MH4A 3A26A 4RM2A 1XRCA 2V7BA 4B3SC 1MDBA 4DV4C 4DV2C 4LF9C 1O92A 4B3RC 4G1IA 4BBYA 4OXIA 4JI8C 4KTVA 3UEBA 3PESA 4B3MC 3VNSA 1N36C 4JI5C 2E5LC 1USPB 2MCQA 4BC7A 4ISBA 5BSUA 4DV5C 4DV6C 1LQLA 4DR7C 2JMPA 4KTTA 4ZLPA 5JRHA 2F4VC 1FJGC 5A1GA 1MXCA 4WS9A 2VQEC 4K0KC 2ZZMA 4PUGA 4GS5A 4OYCA 3H2TA 3SO4A 3KXWA 1O90A 3CQ2A 4JI7C 1N33C
chains in the Genus database with same CATH topology
1JOSA 3J81D 3DAYA 4LF7C 1UKKA 3FCCA 3IEUA 5DV9A 4JI1C 1ZB8A 5A2QD 1WF3A 4X64C 4LF6C 4TPSB 4ODJA 3EQ6A 4NOZA 2UUBC 1PA4A 3NPDA 1J5EC 2Y27A 2KZFA 5BUSA 2PT7G 3J7AD 1LCIA 1P7LA 4DG9A 4D56A 4DCVA 3UZ0A 4FUQA 2QW0X 4KHPC 4NXMC 1XRAA 1T5HX 1IBKC 4JI6C 2BH1X 5BSMA 2D7VA 5T8TA 4LF5C 4LFAC 3OTOC 5AE1A 5T8SA 1QM4A 3L8CA 5H9UA 2D28C 2XR1A 1XRBA 3NI2A 5A1IA 5BSVA 2DPLA 2QVYX 1O93A 2QL8A 4RLFA 4RVNA 3TDEA 4LF8C 1KKGA 3RV2A 4K0BA 3A4IA 4DV1C 3NYQA 4U5YD 3VNQA 2WP0C 4BC9A 3IEVA 1K0RA 5GTDA 3G7SA 3LGXA 4DR4C 1MD9A 4G36A 4DV3C 4L7IA 2QVXX 4X62C 1EGAA 3NYRA 1HNZC 4D57A 5KYTA 3A9UA 5IWAC 2P2FA 4JYAC 3GR1A 4GXQA 4JI0C 2OPLA 4DR1C 3E7WA 2Y4OA 5IFIA 4HPVA 2AYAA 1VLAA 3GPCA 2D1RA 4RVOA 4DCSA 2YWBA 3R44A 2UXDC 4BSZA 2E8CA 3DHVA 3AF5A 4JI2C 2P2JA 2D1QA 1GPMA 1T5DX 4X65C 3TUFA 4R1MA 3A9VA 3CJEA 5BURA 2ASBA 4LFBC 5AE3A 1BA3A 2CXCA 2ONFA 1NYEA 2P2MA 1PG3A 4RLQA 2OPLB 4X66C 4AQYC 2OO4A 3C5EA 1O9TA 1ZB9A 2PROA 3EERA 3R9WA 4I9GA 3LNVA 1PG4A 4DR5C 2E8EA 1YJ7A 4OX9C 1QWIA 1XNRC 1XMQC 2E0GA 4NXNC 4IZ6A 1IBLC 4IR7A 4D4IA 4PROC 1HNWC 3FCEA 5BUQA 5CZVA 3IMLA 4GKJC 2VQFC 2DYJA 3GR0A 3RG2A 3TQIA 4I9FA 4EATA 4R0MA 3UOWA 4PZPA 3JAMD 2P02A 3E7XA 2VSQA 3I07A 4DG8A 4FUTA 2YCBA 2UU9C 4LFCC 5K8FA 5KEIA 5LMNC 3CW9A 3DLPX 3ETOA 2UXBC 5BR8C 2P20A 4JI4C 5AE2A 2UXCC 5LMUC 3CW8X 3I08A 5K85A 5CZXA 2UUCC 3ETCA 2OBVA 1RG9A 5A19A 3IPLA 4WV3A 3T1YC 4MTNA 4YY3C 2QVZX 4JM1A 5BSWA 2YWCA 5E7QA 1IBMC 4DR2C 3LUSA 5FLXD 3AF6A 1N32C 4DCUA 2HHHC 5ADZA 4NDNA 1MXAA 2Y4NA 1V25A 2P2QA 1L2FA 4B3TC 4DV0C 4JV5C 2D27A 4GXRA 4L4QA 5BSRA 1HNXC 5KYVA 1HH2P 2PN2A 4DV7C 1N2FA 1RY2A 4RM3A 2P2BA 1HR0C 4LF4C 2HJGA 3VNRA 2VZEA 1XMOC 2UUAC 3PROC 4LE5A 2BJOA 2E7GA 4G37A 1V26A 4PHTA 4L2ZA 4XX2A 1MKYA 3B7WA 3PBKA 1N34C 2E8FA 3N54B 4ZJZA 1USPA 1WH9A 5IT9D 1I94C 2EGTA 3R9XA 4DR6C 1AMUA 3L95X 4DCTA 3LAXA 3S82A 4DUYC 1ML8A 4DUZC 2ZM6C 4GKKC 1FUGA 5BSTA 4R1LA 2D1SA 4BCAA 1XNQC 2CY1A 2D1TA 4D4GA 1ULTA 2ATWA 4JI3C 4YHHC 4DR3C 4FTFA 2WD9A 4RMNA 3N2QA 3GKUA 1MDFA 3T1HC 1MXBA 3J80D 4MH4A 4RM2A 1XRCA 2V7BA 4B3SC 1MDBA 4DV4C 4DV2C 4LF9C 1O92A 4B3RC 4G1IA 4BBYA 4OXIA 4JI8C 4KTVA 3PESA 4B3MC 3VNSA 1N36C 4JI5C 2E5LC 1USPB 4BC7A 4ISBA 5BSUA 4DV5C 4DV6C 1LQLA 4DR7C 2JMPA 4KTTA 4ZLPA 5JRHA 2F4VC 1FJGC 5A1GA 1MXCA 4WS9A 2VQEC 4K0KC 4GS5A 4OYCA 3H2TA 3SO4A 3KXWA 1O90A 4JI7C 1N33C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOS A;  1MKY A;  3J81 D;  1N34 C;  2E8F A;  3JAM D;  4LF7 C;  1UKK A;  1USP A;  1WH9 A;  3IEU A;  5IWA C;  4JI1 C;  5IT9 D;  1I94 C;  4JYA C;  2EGT A;  1ZB8 A;  3I07 A;  3R9X A;  4DR6 C;  5A2Q D;  2YCB A;  4JI0 C;  2UU9 C;  2OPL A;  4LFC C;  1WF3 A;  4DR1 C;  4DCT A;  4X64 C;  5LMN C;  4LF6 C;  4DUY C;  1ML8 A;  4DUZ C;  4NOZ A;  2ZM6 C;  1VLA A;  4GKK C;  2UUB C;  1PA4 A;  2UXB C;  1J5E C;  1XNQ C;  5BR8 C;  2CY1 A;  2KZF A;  4DCS A;  2PT7 G;  2ATW A;  4JI3 C;  3J7A D;  4JI4 C;  4YHH C;  2UXC C;  2UXD C;  5LMU C;  4BSZ A;  4DCV A;  4DR3 C;  2E8C A;  2UUC C;  3AF5 A;  4JI2 C;  3GKU A;  4X65 C;  3T1H C;  4KHP C;  4NXM C;  3J80 D;  4MH4 A;  1IBK C;  3CJE A;  3T1Y C;  4B3S C;  4JI6 C;  2ASB A;  4MTN A;  4LFB C;  2D7V A;  4YY3 C;  2CXC A;  4LF5 C;  2ONF A;  4DV4 C;  4DV2 C;  4LF9 C;  4LFA C;  4B3R C;  3OTO C;  1IBM C;  4DR2 C;  3LUS A;  1NYE A;  5FLX D;  3AF6 A;  1N32 C;  4DCU A;  2XR1 A;  4JI8 C;  2OPL B;  4X66 C;  4AQY C;  2HHH C;  4B3M C;  1ZB9 A;  3EER A;  1L2F A;  3R9W A;  2QL8 A;  4B3T C;  4DV0 C;  4DR5 C;  4JV5 C;  2E8E A;  4LF8 C;  4OX9 C;  1QWI A;  1N36 C;  1XMQ C;  4JI5 C;  2E5L C;  1XNR C;  1KKG A;  1USP B;  1HNX C;  1HH2 P;  2PN2 A;  4DV1 C;  4DV7 C;  4NXN C;  1N2F A;  4DV5 C;  1IBL C;  4DV6 C;  3IEV A;  1LQL A;  4DR7 C;  1K0R A;  2JMP A;  1HR0 C;  4LF4 C;  1HNW C;  2F4V C;  1FJG C;  4GKJ C;  2HJG A;  2VQF C;  4DR4 C;  2DYJ A;  2VQE C;  4K0K C;  2UUA C;  1XMO C;  2BJO A;  2E7G A;  4DV3 C;  4X62 C;  1EGA A;  4XX2 A;  1HNZ C;  4JI7 C;  1N33 C; 
#chains in the Genus database with same CATH topology
 1JOS A;  5LCI A;  3J81 D;  3DAY A;  4LF7 C;  1UKK A;  3FCC A;  3IEU A;  5DV9 A;  4JI1 C;  1ZB8 A;  5A2Q D;  1WF3 A;  4X64 C;  4LF6 C;  4TPS B;  4ODJ A;  3EQ6 A;  2MMA B;  4NOZ A;  2UUB C;  1PA4 A;  3NPD A;  1J5E C;  3UX3 A;  2Y27 A;  2KZF A;  5BUS A;  2PT7 G;  3O2E A;  3J7A D;  1LCI A;  1P7L A;  4DG9 A;  4D56 A;  4DCV A;  3UZ0 A;  4FUQ A;  3FM7 A;  2QW0 X;  4KHP C;  4NXM C;  1XRA A;  1T5H X;  1IBK C;  2DHM A;  4JI6 C;  2BH1 X;  5BSM A;  1XHJ A;  2D7V A;  5T8T A;  4LF5 C;  1M6X A;  4LFA C;  3OTO C;  5AE1 A;  5T8S A;  1QM4 A;  1YGT A;  3L8C A;  5H9U A;  2D28 C;  2XR1 A;  1XRB A;  3NI2 A;  5A1I A;  2Z51 A;  5BSV A;  2DPL A;  2QVY X;  1O93 A;  2QL8 A;  4RLF A;  4RVN A;  3TDE A;  4LF8 C;  1KKG A;  3A25 A;  3RV2 A;  4K0B A;  3A4I A;  4DV1 C;  1NY8 A;  3NYQ A;  4U5Y D;  3VNQ A;  2WP0 C;  4BC9 A;  3IEV A;  1K0R A;  2KDN A;  5GTD A;  3G7S A;  3LGX A;  4DR4 C;  1MD9 A;  4G36 A;  4DV3 C;  4L7I A;  2QVX X;  4X62 C;  1EGA A;  3NYR A;  1HNZ C;  2CU6 A;  4D57 A;  5KYT A;  3A9U A;  5IWA C;  2P2F A;  4JYA C;  3GR1 A;  4GXQ A;  3CQ1 A;  4JI0 C;  2OPL A;  4DR1 C;  3E7W A;  2Y4O A;  5IFI A;  4HPV A;  2AYA A;  1VLA A;  1FLO A;  3GPC A;  2D1R A;  4RVO A;  4DCS A;  2YWB A;  3R44 A;  2UXD C;  4BSZ A;  1XS3 A;  3CQ3 A;  2E8C A;  3DHV A;  3AF5 A;  4JI2 C;  2P2J A;  2D1Q A;  1GPM A;  1T5D X;  4X65 C;  3TUF A;  4R1M A;  3A9V A;  3CJE A;  5BUR A;  2ASB A;  4LFB C;  2NCL A;  5AE3 A;  1BA3 A;  2CXC A;  2ONF A;  1NYE A;  2P2M A;  1PG3 A;  4RLQ A;  2OPL B;  4X66 C;  4AQY C;  2OO4 A;  3C5E A;  1O9T A;  1ZB9 A;  2PRO A;  3EER A;  3R9W A;  4I9G A;  3LNV A;  1PG4 A;  4DR5 C;  2E8E A;  1YJ7 A;  4OX9 C;  1QWI A;  1XNR C;  1XMQ C;  2E0G A;  4NXN C;  4IZ6 A;  1IBL C;  2M5O A;  4IR7 A;  4D4I A;  4PRO C;  1TH5 A;  1HNW C;  3FCE A;  5BUQ A;  5CZV A;  3IML A;  4GKJ C;  2VQF C;  2DYJ A;  3GR0 A;  3RG2 A;  3TQI A;  4I9F A;  4EAT A;  4R0M A;  3UOW A;  4PZP A;  3UX2 A;  3JAM D;  2P02 A;  3E7X A;  2VSQ A;  3I07 A;  4DG8 A;  4FUT A;  2YCB A;  2M5H A;  2UU9 C;  4LFC C;  5K8F A;  5KEI A;  5LMN C;  3CW9 A;  3DLP X;  3ETO A;  1PU1 A;  2UXB C;  5BR8 C;  2KZ0 A;  2P20 A;  4JI4 C;  5AE2 A;  2UXC C;  5LMU C;  1UWD A;  3CW8 X;  3I08 A;  5K85 A;  5CZX A;  2UUC C;  3K6R A;  3ETC A;  2OBV A;  1RG9 A;  5A19 A;  3IPL A;  4WV3 A;  3T1Y C;  4MTN A;  4YY3 C;  2QVZ X;  4JM1 A;  5BSW A;  2YWC A;  5E7Q A;  2YX1 A;  1IBM C;  4DR2 C;  2MM9 A;  3LUS A;  5FLX D;  3AF6 A;  1N32 C;  4DCU A;  1XDX A;  2HHH C;  5ADZ A;  4NDN A;  3AY0 A;  1MXA A;  2Y4N A;  1V25 A;  2P2Q A;  1L2F A;  4B3T C;  1P4E A;  4DV0 C;  4JV5 C;  2D27 A;  4GXR A;  4L4Q A;  5BSR A;  1HNX C;  5KYV A;  1HH2 P;  2PN2 A;  4DV7 C;  1N2F A;  1RY2 A;  1WCJ A;  4RM3 A;  2P2B A;  1HR0 C;  4LF4 C;  2PG1 E;  2HJG A;  3VNR A;  2VZE A;  1XMO C;  2UUA C;  3PRO C;  4LE5 A;  2BJO A;  2E7G A;  4G37 A;  1V26 A;  4PHT A;  4L2Z A;  4XX2 A;  3LNO A;  1MKY A;  3B7W A;  3PBK A;  1N34 C;  2E8F A;  3N54 B;  4ZJZ A;  1USP A;  1WH9 A;  2ZZN A;  5IT9 D;  1I94 C;  2ZTB A;  2EGT A;  3R9X A;  4DR6 C;  1M6X C;  1AMU A;  2JNV A;  3L95 X;  4DCT A;  3LAX A;  3S82 A;  3TR3 A;  4DUY C;  1ML8 A;  4DUZ C;  1IB8 A;  2ZM6 C;  4GKK C;  1FUG A;  5BST A;  4R1L A;  2D1S A;  4PUI A;  4BCA A;  1XNQ C;  2CY1 A;  2D1T A;  4D4G A;  1ULT A;  2ATW A;  4JI3 C;  4YHH C;  4DR3 C;  4FTF A;  2WD9 A;  4RMN A;  1VEH A;  3N2Q A;  1V60 A;  1P4E C;  4PUH A;  3GKU A;  1MDF A;  3T1H C;  1MXB A;  3J80 D;  4MH4 A;  3A26 A;  4RM2 A;  1XRC A;  2V7B A;  4B3S C;  1MDB A;  4DV4 C;  4DV2 C;  4LF9 C;  1O92 A;  4B3R C;  4G1I A;  4BBY A;  4OXI A;  4JI8 C;  4KTV A;  3UEB A;  3PES A;  4B3M C;  3VNS A;  1N36 C;  4JI5 C;  2E5L C;  1USP B;  2MCQ A;  4BC7 A;  4ISB A;  5BSU A;  4DV5 C;  4DV6 C;  1LQL A;  4DR7 C;  2JMP A;  4KTT A;  4ZLP A;  5JRH A;  2F4V C;  1FJG C;  5A1G A;  1MXC A;  4WS9 A;  2VQE C;  4K0K C;  2ZZM A;  4PUG A;  4GS5 A;  4OYC A;  3H2T A;  3SO4 A;  3KXW A;  1O90 A;  3CQ2 A;  4JI7 C;  1N33 C; 
#chains in the Genus database with same CATH homology
 1JOS A;  3J81 D;  3DAY A;  4LF7 C;  1UKK A;  3FCC A;  3IEU A;  5DV9 A;  4JI1 C;  1ZB8 A;  5A2Q D;  1WF3 A;  4X64 C;  4LF6 C;  4TPS B;  4ODJ A;  3EQ6 A;  4NOZ A;  2UUB C;  1PA4 A;  3NPD A;  1J5E C;  2Y27 A;  2KZF A;  5BUS A;  2PT7 G;  3J7A D;  1LCI A;  1P7L A;  4DG9 A;  4D56 A;  4DCV A;  3UZ0 A;  4FUQ A;  2QW0 X;  4KHP C;  4NXM C;  1XRA A;  1T5H X;  1IBK C;  4JI6 C;  2BH1 X;  5BSM A;  2D7V A;  5T8T A;  4LF5 C;  4LFA C;  3OTO C;  5AE1 A;  5T8S A;  1QM4 A;  3L8C A;  5H9U A;  2D28 C;  2XR1 A;  1XRB A;  3NI2 A;  5A1I A;  5BSV A;  2DPL A;  2QVY X;  1O93 A;  2QL8 A;  4RLF A;  4RVN A;  3TDE A;  4LF8 C;  1KKG A;  3RV2 A;  4K0B A;  3A4I A;  4DV1 C;  3NYQ A;  4U5Y D;  3VNQ A;  2WP0 C;  4BC9 A;  3IEV A;  1K0R A;  5GTD A;  3G7S A;  3LGX A;  4DR4 C;  1MD9 A;  4G36 A;  4DV3 C;  4L7I A;  2QVX X;  4X62 C;  1EGA A;  3NYR A;  1HNZ C;  4D57 A;  5KYT A;  3A9U A;  5IWA C;  2P2F A;  4JYA C;  3GR1 A;  4GXQ A;  4JI0 C;  2OPL A;  4DR1 C;  3E7W A;  2Y4O A;  5IFI A;  4HPV A;  2AYA A;  1VLA A;  3GPC A;  2D1R A;  4RVO A;  4DCS A;  2YWB A;  3R44 A;  2UXD C;  4BSZ A;  2E8C A;  3DHV A;  3AF5 A;  4JI2 C;  2P2J A;  2D1Q A;  1GPM A;  1T5D X;  4X65 C;  3TUF A;  4R1M A;  3A9V A;  3CJE A;  5BUR A;  2ASB A;  4LFB C;  5AE3 A;  1BA3 A;  2CXC A;  2ONF A;  1NYE A;  2P2M A;  1PG3 A;  4RLQ A;  2OPL B;  4X66 C;  4AQY C;  2OO4 A;  3C5E A;  1O9T A;  1ZB9 A;  2PRO A;  3EER A;  3R9W A;  4I9G A;  3LNV A;  1PG4 A;  4DR5 C;  2E8E A;  1YJ7 A;  4OX9 C;  1QWI A;  1XNR C;  1XMQ C;  2E0G A;  4NXN C;  4IZ6 A;  1IBL C;  4IR7 A;  4D4I A;  4PRO C;  1HNW C;  3FCE A;  5BUQ A;  5CZV A;  3IML A;  4GKJ C;  2VQF C;  2DYJ A;  3GR0 A;  3RG2 A;  3TQI A;  4I9F A;  4EAT A;  4R0M A;  3UOW A;  4PZP A;  3JAM D;  2P02 A;  3E7X A;  2VSQ A;  3I07 A;  4DG8 A;  4FUT A;  2YCB A;  2UU9 C;  4LFC C;  5K8F A;  5KEI A;  5LMN C;  3CW9 A;  3DLP X;  3ETO A;  2UXB C;  5BR8 C;  2P20 A;  4JI4 C;  5AE2 A;  2UXC C;  5LMU C;  3CW8 X;  3I08 A;  5K85 A;  5CZX A;  2UUC C;  3ETC A;  2OBV A;  1RG9 A;  5A19 A;  3IPL A;  4WV3 A;  3T1Y C;  4MTN A;  4YY3 C;  2QVZ X;  4JM1 A;  5BSW A;  2YWC A;  5E7Q A;  1IBM C;  4DR2 C;  3LUS A;  5FLX D;  3AF6 A;  1N32 C;  4DCU A;  2HHH C;  5ADZ A;  4NDN A;  1MXA A;  2Y4N A;  1V25 A;  2P2Q A;  1L2F A;  4B3T C;  4DV0 C;  4JV5 C;  2D27 A;  4GXR A;  4L4Q A;  5BSR A;  1HNX C;  5KYV A;  1HH2 P;  2PN2 A;  4DV7 C;  1N2F A;  1RY2 A;  4RM3 A;  2P2B A;  1HR0 C;  4LF4 C;  2HJG A;  3VNR A;  2VZE A;  1XMO C;  2UUA C;  3PRO C;  4LE5 A;  2BJO A;  2E7G A;  4G37 A;  1V26 A;  4PHT A;  4L2Z A;  4XX2 A;  1MKY A;  3B7W A;  3PBK A;  1N34 C;  2E8F A;  3N54 B;  4ZJZ A;  1USP A;  1WH9 A;  5IT9 D;  1I94 C;  2EGT A;  3R9X A;  4DR6 C;  1AMU A;  3L95 X;  4DCT A;  3LAX A;  3S82 A;  4DUY C;  1ML8 A;  4DUZ C;  2ZM6 C;  4GKK C;  1FUG A;  5BST A;  4R1L A;  2D1S A;  4BCA A;  1XNQ C;  2CY1 A;  2D1T A;  4D4G A;  1ULT A;  2ATW A;  4JI3 C;  4YHH C;  4DR3 C;  4FTF A;  2WD9 A;  4RMN A;  3N2Q A;  3GKU A;  1MDF A;  3T1H C;  1MXB A;  3J80 D;  4MH4 A;  4RM2 A;  1XRC A;  2V7B A;  4B3S C;  1MDB A;  4DV4 C;  4DV2 C;  4LF9 C;  1O92 A;  4B3R C;  4G1I A;  4BBY A;  4OXI A;  4JI8 C;  4KTV A;  3PES A;  4B3M C;  3VNS A;  1N36 C;  4JI5 C;  2E5L C;  1USP B;  4BC7 A;  4ISB A;  5BSU A;  4DV5 C;  4DV6 C;  1LQL A;  4DR7 C;  2JMP A;  4KTT A;  4ZLP A;  5JRH A;  2F4V C;  1FJG C;  5A1G A;  1MXC A;  4WS9 A;  2VQE C;  4K0K C;  4GS5 A;  4OYC A;  3H2T A;  3SO4 A;  3KXW A;  1O90 A;  4JI7 C;  1N33 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...