4DR5C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 53
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr5C02
2E8FA 4DCSA 4KHPC 1ML8A 2PN2A 4JI5C 1XNRC 4JV5C 4DR4C 2EGTA 2E8EA 2PT7G 3IEUA 4DR6C 4DR7C 1HR0C 2HJGA 2E8CA 1XMQC 2OPLA 4JI2C 3T1HC 2UUCC 2UXCC 1UKKA 2VQEC 4LFBC 3T1YC 4JI8C 4K0KC 1USPA 4DV2C 1WF3A 1NYEA 5FLXD 4DV3C 4JI7C 4NXNC 1WH9A 4OX9C 2ATWA 4DCTA 3LUSA 4DV7C 4B3MC 5LMNC 4X65C 1HNZC 1N34C 2D7VA 4JI3C 4LFAC 1ZB9A 2CXCA 4DUYC 2JMPA 3EERA 1N36C 2DYJA 4LF4C 1IBMC 5IWAC 4LF9C 3I07A 1N2FA 4DR5C 1N32C 3JAMD 2OPLB 4NXMC 2XR1A 5IT9D 4DR1C 1IBLC 2UUBC 1USPB 2YCBA 1QWIA 4BSZA 4DV4C 4DR2C 2QL8A 3GKUA 4LF6C 3AF5A 4JYAC 1HNXC 4NOZA 4AQYC 4LF7C 4GKKC 2BJOA 1J5EC 3J81D 2F4VC 4JI4C 2ONFA 4DCVA 2VQFC 1MKYA 1L2FA 5LMUC 1VLAA 2CY1A 1EGAA 4B3RC 1IBKC 3OTOC 2E7GA 1XNQC 5BR8C 3J80D 4DR3C 4JI6C 3R9XA 5A2QD 2UU9C 4DV0C 3AF6A 4LFCC 4B3SC 2UUAC 4X62C 4XX2A 4MH4A 2UXBC 1I94C 4DCUA 4LF8C 1JOSA 1FJGC 4DV6C 4B3TC 1K0RA 4DV5C 2UXDC 4X64C 2KZFA 1N33C 4MTNA 1HH2P 4DUZC 2HHHC 3J7AD 1KKGA 2ASBA 4LF5C 4YY3C 1XMOC 4GKJC 1ZB8A 4JI1C 3IEVA 4JI0C 1PA4A 3R9WA 2ZM6C 4DV1C 3CJEA 4YHHC 2E5LC 1HNWC 4X66C 1LQLA
chains in the Genus database with same CATH superfamily
5DV9A 4JV5C 3GR1A 2EGTA 2E8EA 3IEUA 3PBKA 2YWCA 1MD9A 2D28C 1TH5A 4FTFA 2UUCC 4I9FA 4K0KC 5K8FA 1O92A 4DV2C 4PROC 2JNVA 4JI7C 1PG4A 4RVNA 4DCTA 3LUSA 1FUGA 4BBYA 3I08A 1N34C 4OYCA 3K6RA 3CQ1A 4LE5A 5BURA 2CXCA 4PUGA 4L4QA 3IPLA 1MXBA 1IBMC 1N2FA 4DR5C 1XDXA 2Z51A 4NXMC 5AE3A 4DR1C 2UUBC 4BSZA 2YWBA 2QL8A 4JYAC 1QM4A 4NOZA 2VQFC 1EGAA 3OTOC 2D27A 1XNQC 1YGTA 4ZLPA 4DR3C 4JI6C 3CQ3A 2UU9C 3AF6A 4LFCC 3NYRA 3RG2A 5AE1A 2UUAC 3DLPX 3UX2A 1RY2A 3EQ6A 4DCUA 5BUQA 2P20A 4X64C 1N33C 4DUZC 5H9UA 5LCIA 2DPLA 2M5OA 1KKGA 4LF5C 4NDNA 4WV3A 4YY3C 3FM7A 4X66C 2KZ0A 1LQLA 2PROA 3L95X 2P2JA 3A9VA 4DCSA 2DHMA 3A9UA 3CQ2A 4KHPC 3NYQA 2PT7G 3LNOA 4L2ZA 2Y4OA 3TDEA 2CU6A 3KXWA 2V7BA 4PZPA 5T8TA 3TUFA 2OO4A 1UKKA 4DG9A 1PU1A 4JI8C 1USPA 1WF3A 4D57A 2ZTBA 2Y4NA 5K85A 4TPSB 2D1TA 1FLOA 4X65C 5AE2A 2WD9A 4D4GA 3A26A 2D7VA 4JI3C 3DHVA 4LFAC 1ZB9A 3UX3A 4DUYC 3PROC 3EERA 4PHTA 5BSTA 4FUTA 3I07A 3L8CA 1AMUA 4BC7A 1YJ7A 2XR1A 4GXRA 1USPB 1QWIA 3FCCA 4IR7A 3AF5A 4RLFA 1HNXC 1XRCA 4LF7C 3DAYA 3J81D 4RLQA 4RM2A 4JI4C 3LGXA 5ADZA 2ONFA 2WP0C 4DCVA 5BUSA 3CW8X 5LMUC 4WS9A 1M6XA 4D4IA 4R1MA 1P4EA 2D1RA 3AY0A 3SO4A 3VNSA 3ETCA 3PESA 1V60A 1XRBA 2YX1A 2MCQA 4U5YD 1RG9A 3TR3A 1WCJA 1UWDA 4DV6C 4B3TC 4KTTA 1VEHA 2P02A 4KTVA 5KYVA 3H2TA 2HHHC 3J7AD 5BSMA 3E7XA 2ASBA 2QW0X 1NY8A 3N2QA 2ZZNA 3VNQA 3UEBA 3LAXA 1M6XC 3S82A 3R9WA 1PG3A 2ZZMA 2VZEA 3CJEA 1HNWC 1GPMA 1ML8A 2PN2A 5A1GA 4DR4C 4L7IA 4BC9A 5GTDA 4K0BA 4DR7C 2HJGA 2OPLA 4JI2C 3T1HC 4R0MA 2UXCC 3GPCA 2VQEC 4PUIA 3T1YC 3UOWA 4EATA 1NYEA 4G1IA 5FLXD 4DV3C 4NXNC 2ATWA 1T5HX 4B3MC 5LMNC 1HNZC 1LCIA 5T8SA 4R1LA 1BA3A 2JMPA 1N36C 5IWAC 1MXCA 3TQIA 5BSUA 4ISBA 4DG8A 2OPLB 3VNRA 4GS5A 5IT9D 1IBLC 1O9TA 2YCBA 3IMLA 3GKUA 4LF6C 4AQYC 4GKKC 2BJOA 3NI2A 1J5EC 1MKYA 2P2MA 2CY1A 2E7GA 4ODJA 3J80D 3GR0A 4DV0C 1IB8A 3FCEA 5CZXA 5BSVA 2M5HA 2P2FA 4OXIA 2UXBC 1JOSA 1FJGC 2P2QA 2QVZX 1K0RA 4D56A 2KZFA 4BCAA 4MTNA 1HH2P 5BSWA 3UZ0A 1XHJA 4GXQA 3NPDA 4ZJZA 4IZ6A 3N54B 1ULTA 1XRAA 4GKJC 1ZB8A 3A4IA 4G36A 1PA4A 1O90A 4DV1C 4YHHC 2E5LC 2D1QA 2MMAB 2E8FA 4JM1A 1XNRC 4JI5C 2AYAA 2KDNA 4DR6C 3C5EA 5A1IA 1HR0C 2E8CA 4PUHA 1XMQC 4HPVA 4LFBC 3ETOA 1T5DX 1WH9A 4OX9C 1P4EC 4I9GA 5E7QA 4DV7C 2QVXX 1V25A 2P2BA 5BSRA 3A25A 4LF4C 2DYJA 4RMNA 4LF9C 1N32C 3JAMD 4G37A 3RV2A 2Y27A 4DV4C 2OBVA 4DR2C 4FUQA 2BH1X 2NCLA 2F4VC 2PG1E 1L2FA 2E0GA 1VLAA 2D1SA 4B3RC 5CZVA 1V26A 1IBKC 5BR8C 3R9XA 5A2QD 1MDFA 2VSQA 1MDBA 1P7LA 4B3SC 3CW9A 4RM3A 4X62C 4XX2A 4MH4A 5JRHA 3R44A 1I94C 4LF8C 4RVOA 1MXAA 5KEIA 1O93A 4DV5C 2UXDC 3E7WA 5A19A 5IFIA 2MM9A 2QVYX 1XS3A 1XMOC 3G7SA 4JI1C 3B7WA 4JI0C 3IEVA 3LNVA 2ZM6C 5KYTA 3O2EA
chains in the Genus database with same CATH topology
5DV9A 4JV5C 3GR1A 2EGTA 2E8EA 3IEUA 3PBKA 2YWCA 1MD9A 2D28C 4FTFA 2UUCC 4I9FA 4K0KC 5K8FA 1O92A 4DV2C 4PROC 4JI7C 1PG4A 4RVNA 4DCTA 3LUSA 1FUGA 4BBYA 3I08A 1N34C 4OYCA 4LE5A 5BURA 2CXCA 4L4QA 3IPLA 1MXBA 1IBMC 1N2FA 4DR5C 4NXMC 5AE3A 4DR1C 2UUBC 4BSZA 2YWBA 2QL8A 4JYAC 1QM4A 4NOZA 2VQFC 1EGAA 3OTOC 2D27A 1XNQC 4ZLPA 4DR3C 4JI6C 2UU9C 3AF6A 4LFCC 3NYRA 3RG2A 5AE1A 2UUAC 3DLPX 1RY2A 3EQ6A 4DCUA 5BUQA 2P20A 4X64C 1N33C 4DUZC 5H9UA 2DPLA 1KKGA 4LF5C 4NDNA 4WV3A 4YY3C 4X66C 1LQLA 2PROA 3L95X 2P2JA 3A9VA 4DCSA 3A9UA 4KHPC 3NYQA 2PT7G 4L2ZA 2Y4OA 3TDEA 3KXWA 4PZPA 2V7BA 5T8TA 3TUFA 2OO4A 1UKKA 4DG9A 4JI8C 1USPA 1WF3A 4D57A 2Y4NA 5K85A 4TPSB 2D1TA 4X65C 5AE2A 2WD9A 4D4GA 2D7VA 4JI3C 3DHVA 4LFAC 1ZB9A 4DUYC 3PROC 3EERA 4PHTA 5BSTA 4FUTA 3I07A 3L8CA 1AMUA 4BC7A 1YJ7A 2XR1A 4GXRA 1USPB 1QWIA 3FCCA 4IR7A 3AF5A 4RLFA 1HNXC 1XRCA 4LF7C 3DAYA 3J81D 4RLQA 4RM2A 4JI4C 3LGXA 5ADZA 2ONFA 2WP0C 4DCVA 5BUSA 3CW8X 5LMUC 4WS9A 4D4IA 4R1MA 2D1RA 3SO4A 3VNSA 3ETCA 3PESA 1XRBA 4U5YD 1RG9A 4DV6C 4B3TC 4KTTA 2P02A 4KTVA 5KYVA 3H2TA 2HHHC 3J7AD 5BSMA 3E7XA 2ASBA 2QW0X 3N2QA 3VNQA 3LAXA 3S82A 3R9WA 1PG3A 2VZEA 3CJEA 1HNWC 1GPMA 1ML8A 2PN2A 5A1GA 4DR4C 4L7IA 4BC9A 5GTDA 4K0BA 4DR7C 2HJGA 2OPLA 4JI2C 3T1HC 4R0MA 2UXCC 3GPCA 2VQEC 3T1YC 3UOWA 4EATA 1NYEA 4G1IA 5FLXD 4DV3C 4NXNC 2ATWA 1T5HX 4B3MC 5LMNC 1HNZC 1LCIA 5T8SA 4R1LA 1BA3A 2JMPA 1N36C 5IWAC 1MXCA 3TQIA 5BSUA 4ISBA 4DG8A 2OPLB 3VNRA 4GS5A 5IT9D 1IBLC 1O9TA 2YCBA 3IMLA 3GKUA 4LF6C 4AQYC 4GKKC 2BJOA 3NI2A 1J5EC 1MKYA 2P2MA 2CY1A 2E7GA 4ODJA 3J80D 3GR0A 4DV0C 3FCEA 5CZXA 5BSVA 2P2FA 4OXIA 2UXBC 1JOSA 1FJGC 2P2QA 2QVZX 1K0RA 4D56A 2KZFA 4BCAA 4MTNA 1HH2P 5BSWA 3UZ0A 4GXQA 3NPDA 4ZJZA 4IZ6A 3N54B 1ULTA 1XRAA 4GKJC 1ZB8A 3A4IA 4G36A 1PA4A 1O90A 4DV1C 4YHHC 2E5LC 2D1QA 2E8FA 4JM1A 1XNRC 4JI5C 2AYAA 4DR6C 3C5EA 5A1IA 1HR0C 2E8CA 1XMQC 4HPVA 4LFBC 3ETOA 1T5DX 1WH9A 4OX9C 4I9GA 5E7QA 4DV7C 2QVXX 1V25A 2P2BA 5BSRA 4LF4C 2DYJA 4RMNA 4LF9C 1N32C 3JAMD 4G37A 3RV2A 2Y27A 4DV4C 2OBVA 4DR2C 4FUQA 2BH1X 2F4VC 1L2FA 2E0GA 1VLAA 2D1SA 4B3RC 5CZVA 1V26A 1IBKC 5BR8C 3R9XA 5A2QD 1MDFA 2VSQA 1MDBA 1P7LA 4B3SC 3CW9A 4RM3A 4X62C 4XX2A 4MH4A 5JRHA 3R44A 1I94C 4LF8C 4RVOA 1MXAA 5KEIA 1O93A 4DV5C 2UXDC 3E7WA 5A19A 5IFIA 2QVYX 1XMOC 3G7SA 4JI1C 3B7WA 4JI0C 3IEVA 3LNVA 2ZM6C 5KYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8F A;  4DCS A;  4KHP C;  1ML8 A;  2PN2 A;  4JI5 C;  1XNR C;  4JV5 C;  4DR4 C;  2EGT A;  2E8E A;  2PT7 G;  3IEU A;  4DR6 C;  4DR7 C;  1HR0 C;  2HJG A;  2E8C A;  1XMQ C;  2OPL A;  4JI2 C;  3T1H C;  2UUC C;  2UXC C;  1UKK A;  2VQE C;  4LFB C;  3T1Y C;  4JI8 C;  4K0K C;  1USP A;  4DV2 C;  1WF3 A;  1NYE A;  5FLX D;  4DV3 C;  4JI7 C;  4NXN C;  1WH9 A;  4OX9 C;  2ATW A;  4DCT A;  3LUS A;  4DV7 C;  4B3M C;  5LMN C;  4X65 C;  1HNZ C;  1N34 C;  2D7V A;  4JI3 C;  4LFA C;  1ZB9 A;  2CXC A;  4DUY C;  2JMP A;  3EER A;  1N36 C;  2DYJ A;  4LF4 C;  1IBM C;  5IWA C;  4LF9 C;  3I07 A;  1N2F A;  4DR5 C;  1N32 C;  3JAM D;  2OPL B;  4NXM C;  2XR1 A;  5IT9 D;  4DR1 C;  1IBL C;  2UUB C;  1USP B;  2YCB A;  1QWI A;  4BSZ A;  4DV4 C;  4DR2 C;  2QL8 A;  3GKU A;  4LF6 C;  3AF5 A;  4JYA C;  1HNX C;  4NOZ A;  4AQY C;  4LF7 C;  4GKK C;  2BJO A;  1J5E C;  3J81 D;  2F4V C;  4JI4 C;  2ONF A;  4DCV A;  2VQF C;  1MKY A;  1L2F A;  5LMU C;  1VLA A;  2CY1 A;  1EGA A;  4B3R C;  1IBK C;  3OTO C;  2E7G A;  1XNQ C;  5BR8 C;  3J80 D;  4DR3 C;  4JI6 C;  3R9X A;  5A2Q D;  2UU9 C;  4DV0 C;  3AF6 A;  4LFC C;  4B3S C;  2UUA C;  4X62 C;  4XX2 A;  4MH4 A;  2UXB C;  1I94 C;  4DCU A;  4LF8 C;  1JOS A;  1FJG C;  4DV6 C;  4B3T C;  1K0R A;  4DV5 C;  2UXD C;  4X64 C;  2KZF A;  1N33 C;  4MTN A;  1HH2 P;  4DUZ C;  2HHH C;  3J7A D;  1KKG A;  2ASB A;  4LF5 C;  4YY3 C;  1XMO C;  4GKJ C;  1ZB8 A;  4JI1 C;  3IEV A;  4JI0 C;  1PA4 A;  3R9W A;  2ZM6 C;  4DV1 C;  3CJE A;  4YHH C;  2E5L C;  1HNW C;  4X66 C;  1LQL A; 
#chains in the Genus database with same CATH topology
 5DV9 A;  4JV5 C;  3GR1 A;  2EGT A;  2E8E A;  3IEU A;  3PBK A;  2YWC A;  1MD9 A;  2D28 C;  1TH5 A;  4FTF A;  2UUC C;  4I9F A;  4K0K C;  5K8F A;  1O92 A;  4DV2 C;  4PRO C;  2JNV A;  4JI7 C;  1PG4 A;  4RVN A;  4DCT A;  3LUS A;  1FUG A;  4BBY A;  3I08 A;  1N34 C;  4OYC A;  3K6R A;  3CQ1 A;  4LE5 A;  5BUR A;  2CXC A;  4PUG A;  4L4Q A;  3IPL A;  1MXB A;  1IBM C;  1N2F A;  4DR5 C;  1XDX A;  2Z51 A;  4NXM C;  5AE3 A;  4DR1 C;  2UUB C;  4BSZ A;  2YWB A;  2QL8 A;  4JYA C;  1QM4 A;  4NOZ A;  2VQF C;  1EGA A;  3OTO C;  2D27 A;  1XNQ C;  1YGT A;  4ZLP A;  4DR3 C;  4JI6 C;  3CQ3 A;  2UU9 C;  3AF6 A;  4LFC C;  3NYR A;  3RG2 A;  5AE1 A;  2UUA C;  3DLP X;  3UX2 A;  1RY2 A;  3EQ6 A;  4DCU A;  5BUQ A;  2P20 A;  4X64 C;  1N33 C;  4DUZ C;  5H9U A;  5LCI A;  2DPL A;  2M5O A;  1KKG A;  4LF5 C;  4NDN A;  4WV3 A;  4YY3 C;  3FM7 A;  4X66 C;  2KZ0 A;  1LQL A;  2PRO A;  3L95 X;  2P2J A;  3A9V A;  4DCS A;  2DHM A;  3A9U A;  3CQ2 A;  4KHP C;  3NYQ A;  2PT7 G;  3LNO A;  4L2Z A;  2Y4O A;  3TDE A;  2CU6 A;  3KXW A;  2V7B A;  4PZP A;  5T8T A;  3TUF A;  2OO4 A;  1UKK A;  4DG9 A;  1PU1 A;  4JI8 C;  1USP A;  1WF3 A;  4D57 A;  2ZTB A;  2Y4N A;  5K85 A;  4TPS B;  2D1T A;  1FLO A;  4X65 C;  5AE2 A;  2WD9 A;  4D4G A;  3A26 A;  2D7V A;  4JI3 C;  3DHV A;  4LFA C;  1ZB9 A;  3UX3 A;  4DUY C;  3PRO C;  3EER A;  4PHT A;  5BST A;  4FUT A;  3I07 A;  3L8C A;  1AMU A;  4BC7 A;  1YJ7 A;  2XR1 A;  4GXR A;  1USP B;  1QWI A;  3FCC A;  4IR7 A;  3AF5 A;  4RLF A;  1HNX C;  1XRC A;  4LF7 C;  3DAY A;  3J81 D;  4RLQ A;  4RM2 A;  4JI4 C;  3LGX A;  5ADZ A;  2ONF A;  2WP0 C;  4DCV A;  5BUS A;  3CW8 X;  5LMU C;  4WS9 A;  1M6X A;  4D4I A;  4R1M A;  1P4E A;  2D1R A;  3AY0 A;  3SO4 A;  3VNS A;  3ETC A;  3PES A;  1V60 A;  1XRB A;  2YX1 A;  2MCQ A;  4U5Y D;  1RG9 A;  3TR3 A;  1WCJ A;  1UWD A;  4DV6 C;  4B3T C;  4KTT A;  1VEH A;  2P02 A;  4KTV A;  5KYV A;  3H2T A;  2HHH C;  3J7A D;  5BSM A;  3E7X A;  2ASB A;  2QW0 X;  1NY8 A;  3N2Q A;  2ZZN A;  3VNQ A;  3UEB A;  3LAX A;  1M6X C;  3S82 A;  3R9W A;  1PG3 A;  2ZZM A;  2VZE A;  3CJE A;  1HNW C;  1GPM A;  1ML8 A;  2PN2 A;  5A1G A;  4DR4 C;  4L7I A;  4BC9 A;  5GTD A;  4K0B A;  4DR7 C;  2HJG A;  2OPL A;  4JI2 C;  3T1H C;  4R0M A;  2UXC C;  3GPC A;  2VQE C;  4PUI A;  3T1Y C;  3UOW A;  4EAT A;  1NYE A;  4G1I A;  5FLX D;  4DV3 C;  4NXN C;  2ATW A;  1T5H X;  4B3M C;  5LMN C;  1HNZ C;  1LCI A;  5T8S A;  4R1L A;  1BA3 A;  2JMP A;  1N36 C;  5IWA C;  1MXC A;  3TQI A;  5BSU A;  4ISB A;  4DG8 A;  2OPL B;  3VNR A;  4GS5 A;  5IT9 D;  1IBL C;  1O9T A;  2YCB A;  3IML A;  3GKU A;  4LF6 C;  4AQY C;  4GKK C;  2BJO A;  3NI2 A;  1J5E C;  1MKY A;  2P2M A;  2CY1 A;  2E7G A;  4ODJ A;  3J80 D;  3GR0 A;  4DV0 C;  1IB8 A;  3FCE A;  5CZX A;  5BSV A;  2M5H A;  2P2F A;  4OXI A;  2UXB C;  1JOS A;  1FJG C;  2P2Q A;  2QVZ X;  1K0R A;  4D56 A;  2KZF A;  4BCA A;  4MTN A;  1HH2 P;  5BSW A;  3UZ0 A;  1XHJ A;  4GXQ A;  3NPD A;  4ZJZ A;  4IZ6 A;  3N54 B;  1ULT A;  1XRA A;  4GKJ C;  1ZB8 A;  3A4I A;  4G36 A;  1PA4 A;  1O90 A;  4DV1 C;  4YHH C;  2E5L C;  2D1Q A;  2MMA B;  2E8F A;  4JM1 A;  1XNR C;  4JI5 C;  2AYA A;  2KDN A;  4DR6 C;  3C5E A;  5A1I A;  1HR0 C;  2E8C A;  4PUH A;  1XMQ C;  4HPV A;  4LFB C;  3ETO A;  1T5D X;  1WH9 A;  4OX9 C;  1P4E C;  4I9G A;  5E7Q A;  4DV7 C;  2QVX X;  1V25 A;  2P2B A;  5BSR A;  3A25 A;  4LF4 C;  2DYJ A;  4RMN A;  4LF9 C;  1N32 C;  3JAM D;  4G37 A;  3RV2 A;  2Y27 A;  4DV4 C;  2OBV A;  4DR2 C;  4FUQ A;  2BH1 X;  2NCL A;  2F4V C;  2PG1 E;  1L2F A;  2E0G A;  1VLA A;  2D1S A;  4B3R C;  5CZV A;  1V26 A;  1IBK C;  5BR8 C;  3R9X A;  5A2Q D;  1MDF A;  2VSQ A;  1MDB A;  1P7L A;  4B3S C;  3CW9 A;  4RM3 A;  4X62 C;  4XX2 A;  4MH4 A;  5JRH A;  3R44 A;  1I94 C;  4LF8 C;  4RVO A;  1MXA A;  5KEI A;  1O93 A;  4DV5 C;  2UXD C;  3E7W A;  5A19 A;  5IFI A;  2MM9 A;  2QVY X;  1XS3 A;  1XMO C;  3G7S A;  4JI1 C;  3B7W A;  4JI0 C;  3IEV A;  3LNV A;  2ZM6 C;  5KYT A;  3O2E A; 
#chains in the Genus database with same CATH homology
 5DV9 A;  4JV5 C;  3GR1 A;  2EGT A;  2E8E A;  3IEU A;  3PBK A;  2YWC A;  1MD9 A;  2D28 C;  4FTF A;  2UUC C;  4I9F A;  4K0K C;  5K8F A;  1O92 A;  4DV2 C;  4PRO C;  4JI7 C;  1PG4 A;  4RVN A;  4DCT A;  3LUS A;  1FUG A;  4BBY A;  3I08 A;  1N34 C;  4OYC A;  4LE5 A;  5BUR A;  2CXC A;  4L4Q A;  3IPL A;  1MXB A;  1IBM C;  1N2F A;  4DR5 C;  4NXM C;  5AE3 A;  4DR1 C;  2UUB C;  4BSZ A;  2YWB A;  2QL8 A;  4JYA C;  1QM4 A;  4NOZ A;  2VQF C;  1EGA A;  3OTO C;  2D27 A;  1XNQ C;  4ZLP A;  4DR3 C;  4JI6 C;  2UU9 C;  3AF6 A;  4LFC C;  3NYR A;  3RG2 A;  5AE1 A;  2UUA C;  3DLP X;  1RY2 A;  3EQ6 A;  4DCU A;  5BUQ A;  2P20 A;  4X64 C;  1N33 C;  4DUZ C;  5H9U A;  2DPL A;  1KKG A;  4LF5 C;  4NDN A;  4WV3 A;  4YY3 C;  4X66 C;  1LQL A;  2PRO A;  3L95 X;  2P2J A;  3A9V A;  4DCS A;  3A9U A;  4KHP C;  3NYQ A;  2PT7 G;  4L2Z A;  2Y4O A;  3TDE A;  3KXW A;  4PZP A;  2V7B A;  5T8T A;  3TUF A;  2OO4 A;  1UKK A;  4DG9 A;  4JI8 C;  1USP A;  1WF3 A;  4D57 A;  2Y4N A;  5K85 A;  4TPS B;  2D1T A;  4X65 C;  5AE2 A;  2WD9 A;  4D4G A;  2D7V A;  4JI3 C;  3DHV A;  4LFA C;  1ZB9 A;  4DUY C;  3PRO C;  3EER A;  4PHT A;  5BST A;  4FUT A;  3I07 A;  3L8C A;  1AMU A;  4BC7 A;  1YJ7 A;  2XR1 A;  4GXR A;  1USP B;  1QWI A;  3FCC A;  4IR7 A;  3AF5 A;  4RLF A;  1HNX C;  1XRC A;  4LF7 C;  3DAY A;  3J81 D;  4RLQ A;  4RM2 A;  4JI4 C;  3LGX A;  5ADZ A;  2ONF A;  2WP0 C;  4DCV A;  5BUS A;  3CW8 X;  5LMU C;  4WS9 A;  4D4I A;  4R1M A;  2D1R A;  3SO4 A;  3VNS A;  3ETC A;  3PES A;  1XRB A;  4U5Y D;  1RG9 A;  4DV6 C;  4B3T C;  4KTT A;  2P02 A;  4KTV A;  5KYV A;  3H2T A;  2HHH C;  3J7A D;  5BSM A;  3E7X A;  2ASB A;  2QW0 X;  3N2Q A;  3VNQ A;  3LAX A;  3S82 A;  3R9W A;  1PG3 A;  2VZE A;  3CJE A;  1HNW C;  1GPM A;  1ML8 A;  2PN2 A;  5A1G A;  4DR4 C;  4L7I A;  4BC9 A;  5GTD A;  4K0B A;  4DR7 C;  2HJG A;  2OPL A;  4JI2 C;  3T1H C;  4R0M A;  2UXC C;  3GPC A;  2VQE C;  3T1Y C;  3UOW A;  4EAT A;  1NYE A;  4G1I A;  5FLX D;  4DV3 C;  4NXN C;  2ATW A;  1T5H X;  4B3M C;  5LMN C;  1HNZ C;  1LCI A;  5T8S A;  4R1L A;  1BA3 A;  2JMP A;  1N36 C;  5IWA C;  1MXC A;  3TQI A;  5BSU A;  4ISB A;  4DG8 A;  2OPL B;  3VNR A;  4GS5 A;  5IT9 D;  1IBL C;  1O9T A;  2YCB A;  3IML A;  3GKU A;  4LF6 C;  4AQY C;  4GKK C;  2BJO A;  3NI2 A;  1J5E C;  1MKY A;  2P2M A;  2CY1 A;  2E7G A;  4ODJ A;  3J80 D;  3GR0 A;  4DV0 C;  3FCE A;  5CZX A;  5BSV A;  2P2F A;  4OXI A;  2UXB C;  1JOS A;  1FJG C;  2P2Q A;  2QVZ X;  1K0R A;  4D56 A;  2KZF A;  4BCA A;  4MTN A;  1HH2 P;  5BSW A;  3UZ0 A;  4GXQ A;  3NPD A;  4ZJZ A;  4IZ6 A;  3N54 B;  1ULT A;  1XRA A;  4GKJ C;  1ZB8 A;  3A4I A;  4G36 A;  1PA4 A;  1O90 A;  4DV1 C;  4YHH C;  2E5L C;  2D1Q A;  2E8F A;  4JM1 A;  1XNR C;  4JI5 C;  2AYA A;  4DR6 C;  3C5E A;  5A1I A;  1HR0 C;  2E8C A;  1XMQ C;  4HPV A;  4LFB C;  3ETO A;  1T5D X;  1WH9 A;  4OX9 C;  4I9G A;  5E7Q A;  4DV7 C;  2QVX X;  1V25 A;  2P2B A;  5BSR A;  4LF4 C;  2DYJ A;  4RMN A;  4LF9 C;  1N32 C;  3JAM D;  4G37 A;  3RV2 A;  2Y27 A;  4DV4 C;  2OBV A;  4DR2 C;  4FUQ A;  2BH1 X;  2F4V C;  1L2F A;  2E0G A;  1VLA A;  2D1S A;  4B3R C;  5CZV A;  1V26 A;  1IBK C;  5BR8 C;  3R9X A;  5A2Q D;  1MDF A;  2VSQ A;  1MDB A;  1P7L A;  4B3S C;  3CW9 A;  4RM3 A;  4X62 C;  4XX2 A;  4MH4 A;  5JRH A;  3R44 A;  1I94 C;  4LF8 C;  4RVO A;  1MXA A;  5KEI A;  1O93 A;  4DV5 C;  2UXD C;  3E7W A;  5A19 A;  5IFI A;  2QVY X;  1XMO C;  3G7S A;  4JI1 C;  3B7W A;  4JI0 C;  3IEV A;  3LNV A;  2ZM6 C;  5KYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...