4DR3C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 45
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr3C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr3C02
1PA4A 3IEUA 3J81D 4KHPC 2ATWA 1ZB9A 4B3RC 1JOSA 1NYEA 4LF8C 2E8EA 2CXCA 3LUSA 4DV2C 4JI4C 2PT7G 4DV5C 4YHHC 4JI6C 4JI1C 3R9WA 4LF6C 5LMNC 5IT9D 4YY3C 4B3MC 4DV3C 1USPB 4LF5C 2UU9C 1HH2P 3T1HC 4DV6C 1IBMC 3IEVA 4JI3C 4DR7C 2OPLA 4MH4A 4DUYC 4AQYC 1WH9A 4LFBC 2BJOA 1QWIA 1XMOC 1IBKC 1LQLA 3T1YC 2XR1A 2VQFC 2UXCC 1HNXC 3OTOC 4GKJC 2VQEC 4DV7C 4XX2A 1N36C 4DR1C 2HJGA 2UXDC 4DCSA 5FLXD 2CY1A 3JAMD 4X64C 2PN2A 3J7AD 4DR4C 4NXNC 1N32C 4LF7C 3EERA 2OPLB 1HNZC 2E8CA 2E7GA 4B3SC 4GKKC 3AF5A 2DYJA 4DR2C 1N34C 1WF3A 4LF9C 2HHHC 4DV0C 2UXBC 4JI2C 2ASBA 2UUBC 1KKGA 4NOZA 1VLAA 1XNRC 4B3TC 2JMPA 1MKYA 4NXMC 1FJGC 4LFCC 4K0KC 4LF4C 1ML8A 3CJEA 3J80D 2E8FA 4X66C 5IWAC 3GKUA 5A2QD 2F4VC 1HNWC 1J5EC 2D7VA 2KZFA 4DV4C 4DUZC 2QL8A 2UUAC 4X65C 4DR5C 5BR8C 4OX9C 2ZM6C 1N2FA 2E5LC 3AF6A 4JI0C 4X62C 4DV1C 4JV5C 1N33C 4DR3C 4JI7C 2EGTA 3I07A 4BSZA 1XNQC 4MTNA 1ZB8A 4DR6C 5LMUC 1I94C 4DCUA 2YCBA 1K0RA 4JI5C 4JYAC 1UKKA 1XMQC 1USPA 1HR0C 2ONFA 4LFAC 1L2FA 2UUCC 4JI8C 3R9XA 4DCVA 4DCTA 1EGAA 1IBLC
chains in the Genus database with same CATH superfamily
5E7QA 4KHPC 2ATWA 4G1IA 1P4EA 1ULTA 3AY0A 4B3RC 2M5OA 5A1IA 1NYEA 5BSWA 2CXCA 2M5HA 2VSQA 4LF6C 4LE5A 4D56A 4ZJZA 1HH2P 3E7WA 4DV6C 3ETOA 2CU6A 4JI3C 3LNOA 2D1RA 1AMUA 3LGXA 1IBKC 2VZEA 3T1YC 5AE1A 3GR0A 4KTVA 1HNXC 3OTOC 3C5EA 2VQEC 1V60A 1N36C 4DR1C 3A4IA 4RM3A 2YWBA 5JRHA 2JNVA 4NXNC 1N32C 2OPLB 4BCAA 3TQIA 4LF9C 2HHHC 4D57A 3PESA 1P4EC 4RMNA 4FUQA 3UX3A 4NOZA 4ZLPA 2OO4A 5T8TA 1MKYA 1FJGC 4R0MA 1P7LA 4JM1A 3J80D 5A2QD 1HNWC 2D7VA 2ZTBA 2D1SA 2QL8A 2UUAC 4DR5C 3L8CA 3AF6A 4JI0C 4BC7A 4JV5C 4DR3C 2PG1E 1T5HX 5LMUC 1MXAA 4ISBA 4RLFA 3I08A 2P2FA 2UUCC 5AE3A 2YX1A 3R9XA 4DCVA 1IBLC 5BSTA 3PROC 3EQ6A 2MM9A 2E8EA 4JI4C 2BH1X 4I9FA 3R9WA 1MDBA 5IT9D 1XRBA 4NDNA 1MXCA 3UX2A 5A19A 2P2BA 2UU9C 4RLQA 3T1HC 3N54B 1IBMC 4G36A 2OPLA 4DUYC 1YJ7A 3NI2A 5BSVA 1WH9A 4LFBC 1LQLA 3GR1A 4PROC 4R1MA 3NYQA 2D1QA 2VQFC 4I9GA 3O2EA 3A9VA 4GKJC 1PU1A 1LCIA 4DV7C 2MMAB 1O92A 2DHMA 1MXBA 4X64C 2PN2A 5BSRA 3LAXA 5BURA 3EERA 5GTDA 1HNZC 3RV2A 2DYJA 3G7SA 1WF3A 5AE2A 2UXBC 5T8SA 2D28C 2ASBA 2QVYX 1VLAA 5CZXA 2OBVA 2Y27A 1GPMA 1VEHA 3GPCA 4TPSB 2NCLA 4LFCC 4K0KC 3NPDA 3GKUA 1O90A 2KZFA 3VNQA 4DUZC 3ETCA 4X65C 1IB8A 5BUQA 1N2FA 3CQ1A 4BSZA 2KDNA 1XNQC 4DG8A 4HPVA 1ZB8A 1XMQC 4LFAC 1EGAA 1XS3A 2PROA 3IPLA 3IEUA 3J81D 5BUSA 1ZB9A 4L2ZA 3A9UA 4DG9A 1PG4A 3CW8X 3LUSA 2PT7G 4YHHC 4BBYA 2ZZNA 2Z51A 1WCJA 1O9TA 5LMNC 4YY3C 4B3MC 3VNSA 4DV3C 2P2QA 4LF5C 4BC9A 5LCIA 5K85A 4RVNA 3IEVA 2P20A 4L7IA 4ODJA 4MH4A 4PUHA 4AQYC 2BJOA 1XMOC 5KYVA 3UZ0A 2UXCC 1T5DX 4RVOA 4WV3A 3DHVA 3SO4A 4PUGA 1XDXA 5FLXD 5DV9A 1PG3A 2QVZX 2D27A 1MDFA 3CQ2A 4LF7C 2E7GA 4B3SC 3DLPX 4GKKC 4DV0C 5A1GA 1QM4A 3LNVA 4JI2C 1KKGA 3CW9A 2YWCA 4K0BA 5ADZA 1XNRC 3K6RA 3FCCA 4PZPA 3H2TA 2JMPA 2P2JA 2QW0X 5CZVA 1XRCA 3DAYA 4OYCA 4LF4C 3CJEA 4X66C 5IWAC 2F4VC 4DV4C 3KXWA 2Y4NA 5KYTA 4RM2A 5BR8C 2E5LC 4IR7A 3CQ3A 4DV1C 5H9UA 2EGTA 1UWDA 3TDEA 2WP0C 4JI5C 4JYAC 1XRAA 1HR0C 1FLOA 2ONFA 5IFIA 1V25A 4JI8C 3VNRA 1PA4A 4FTFA 2V7BA 1V26A 1JOSA 4LF8C 4DV2C 1O93A 4DV5C 2ZZMA 3IMLA 4JI6C 4JI1C 2Y4OA 5BSUA 1NY8A 4GXQA 1USPB 3S82A 2AYAA 4EATA 4R1LA 3FM7A 1XHJA 4U5YD 1M6XA 4PHTA 3PBKA 4DR7C 1MD9A 3TUFA 3TR3A 1QWIA 3FCEA 4GXRA 4KTTA 2DPLA 2XR1A 2KZ0A 4IZ6A 4PUIA 3B7WA 4OXIA 1FUGA 4XX2A 2HJGA 2WD9A 2MCQA 2UXDC 4DCSA 1RY2A 2CY1A 3JAMD 1YGTA 4FUTA 5K8FA 3J7AD 4DR4C 3E7XA 4D4GA 2P02A 2E8CA 4GS5A 3A26A 3AF5A 1N34C 4DR2C 2UUBC 5KEIA 4B3TC 4L4QA 1RG9A 2P2MA 4WS9A 4NXMC 1TH5A 1ML8A 2E8FA 1J5EC 3RG2A 3NYRA 1M6XC 4OX9C 3A25A 1BA3A 2ZM6C 4X62C 1N33C 4JI7C 3I07A 5BSMA 2D1TA 4G37A 3UEBA 3L95X 3R44A 4MTNA 2E0GA 4DR6C 1I94C 4DCUA 2YCBA 1K0RA 3N2QA 3UOWA 1UKKA 2QVXX 1USPA 4D4IA 1L2FA 4DCTA
chains in the Genus database with same CATH topology
5E7QA 4KHPC 2ATWA 4G1IA 1ULTA 4B3RC 5A1IA 1NYEA 5BSWA 2CXCA 2VSQA 4LF6C 4LE5A 4D56A 4ZJZA 1HH2P 3E7WA 4DV6C 3ETOA 4JI3C 2D1RA 1AMUA 3LGXA 1IBKC 2VZEA 3T1YC 5AE1A 3GR0A 4KTVA 1HNXC 3OTOC 3C5EA 2VQEC 1N36C 4DR1C 3A4IA 4RM3A 2YWBA 5JRHA 4NXNC 1N32C 2OPLB 4BCAA 3TQIA 4LF9C 2HHHC 4D57A 3PESA 4RMNA 4FUQA 4NOZA 4ZLPA 2OO4A 5T8TA 1MKYA 1FJGC 4R0MA 1P7LA 4JM1A 3J80D 5A2QD 1HNWC 2D7VA 2D1SA 2QL8A 2UUAC 4DR5C 3L8CA 3AF6A 4JI0C 4BC7A 4JV5C 4DR3C 1T5HX 5LMUC 1MXAA 4ISBA 4RLFA 3I08A 2P2FA 2UUCC 5AE3A 3R9XA 4DCVA 1IBLC 5BSTA 3PROC 3EQ6A 2E8EA 4JI4C 2BH1X 4I9FA 3R9WA 1MDBA 5IT9D 1XRBA 4NDNA 1MXCA 5A19A 2P2BA 2UU9C 4RLQA 3T1HC 3N54B 1IBMC 4G36A 2OPLA 4DUYC 1YJ7A 3NI2A 5BSVA 1WH9A 4LFBC 1LQLA 3GR1A 4PROC 4R1MA 3NYQA 2D1QA 2VQFC 4I9GA 3A9VA 4GKJC 1LCIA 4DV7C 1O92A 1MXBA 4X64C 2PN2A 5BSRA 3LAXA 5BURA 3EERA 5GTDA 1HNZC 3RV2A 2DYJA 3G7SA 1WF3A 5AE2A 2UXBC 5T8SA 2D28C 2ASBA 2QVYX 1VLAA 5CZXA 2OBVA 2Y27A 1GPMA 3GPCA 4TPSB 4LFCC 4K0KC 3NPDA 3GKUA 2KZFA 1O90A 3VNQA 4DUZC 3ETCA 4X65C 5BUQA 1N2FA 4BSZA 1XNQC 4DG8A 4HPVA 1ZB8A 1XMQC 4LFAC 1EGAA 2PROA 3IPLA 3IEUA 3J81D 5BUSA 1ZB9A 4L2ZA 3A9UA 4DG9A 1PG4A 3CW8X 3LUSA 2PT7G 4YHHC 4BBYA 1O9TA 5LMNC 4YY3C 4B3MC 3VNSA 4DV3C 2P2QA 4LF5C 4BC9A 5K85A 4RVNA 3IEVA 2P20A 4L7IA 4ODJA 4MH4A 4AQYC 2BJOA 1XMOC 5KYVA 3UZ0A 2UXCC 1T5DX 4RVOA 4WV3A 3DHVA 3SO4A 5FLXD 5DV9A 1PG3A 2QVZX 2D27A 1MDFA 4LF7C 2E7GA 4B3SC 3DLPX 4GKKC 4DCTA 4DV0C 5A1GA 1QM4A 3LNVA 4JI2C 1KKGA 3CW9A 2YWCA 4K0BA 5ADZA 1XNRC 3FCCA 4PZPA 3H2TA 2JMPA 2P2JA 2QW0X 5CZVA 1XRCA 3DAYA 4OYCA 4LF4C 3CJEA 4X66C 5IWAC 2F4VC 4DV4C 3KXWA 2Y4NA 5KYTA 4RM2A 5BR8C 2E5LC 4IR7A 4DV1C 5H9UA 2EGTA 3TDEA 2WP0C 4JI5C 4JYAC 1XRAA 1HR0C 2ONFA 5IFIA 1V25A 4JI8C 3VNRA 1PA4A 4FTFA 2V7BA 1V26A 1JOSA 4LF8C 4DV2C 1O93A 4DV5C 3IMLA 4JI6C 4JI1C 2Y4OA 5BSUA 4GXQA 1USPB 3S82A 2AYAA 4EATA 4R1LA 4U5YD 4PHTA 3PBKA 4DR7C 1MD9A 3TUFA 1QWIA 3FCEA 4GXRA 4KTTA 2DPLA 2XR1A 4IZ6A 3B7WA 4OXIA 1FUGA 4XX2A 2HJGA 2WD9A 2UXDC 4DCSA 1RY2A 2CY1A 3JAMD 4FUTA 5K8FA 3J7AD 4DR4C 3E7XA 4D4GA 2P02A 2E8CA 4GS5A 3AF5A 4DR2C 2UUBC 5KEIA 4B3TC 4L4QA 1RG9A 2P2MA 4WS9A 4NXMC 1ML8A 2E8FA 1J5EC 3RG2A 3NYRA 4OX9C 1BA3A 2ZM6C 4X62C 1N33C 4JI7C 3I07A 5BSMA 2D1TA 4G37A 3L95X 3R44A 4MTNA 2E0GA 4DR6C 1I94C 4DCUA 2YCBA 1K0RA 3N2QA 3UOWA 1UKKA 2QVXX 1USPA 4D4IA 1L2FA 1N34C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PA4 A;  3IEU A;  3J81 D;  4KHP C;  2ATW A;  1ZB9 A;  4B3R C;  1JOS A;  1NYE A;  4LF8 C;  2E8E A;  2CXC A;  3LUS A;  4DV2 C;  4JI4 C;  2PT7 G;  4DV5 C;  4YHH C;  4JI6 C;  4JI1 C;  3R9W A;  4LF6 C;  5LMN C;  5IT9 D;  4YY3 C;  4B3M C;  4DV3 C;  1USP B;  4LF5 C;  2UU9 C;  1HH2 P;  3T1H C;  4DV6 C;  1IBM C;  3IEV A;  4JI3 C;  4DR7 C;  2OPL A;  4MH4 A;  4DUY C;  4AQY C;  1WH9 A;  4LFB C;  2BJO A;  1QWI A;  1XMO C;  1IBK C;  1LQL A;  3T1Y C;  2XR1 A;  2VQF C;  2UXC C;  1HNX C;  3OTO C;  4GKJ C;  2VQE C;  4DV7 C;  4XX2 A;  1N36 C;  4DR1 C;  2HJG A;  2UXD C;  4DCS A;  5FLX D;  2CY1 A;  3JAM D;  4X64 C;  2PN2 A;  3J7A D;  4DR4 C;  4NXN C;  1N32 C;  4LF7 C;  3EER A;  2OPL B;  1HNZ C;  2E8C A;  2E7G A;  4B3S C;  4GKK C;  3AF5 A;  2DYJ A;  4DR2 C;  1N34 C;  1WF3 A;  4LF9 C;  2HHH C;  4DV0 C;  2UXB C;  4JI2 C;  2ASB A;  2UUB C;  1KKG A;  4NOZ A;  1VLA A;  1XNR C;  4B3T C;  2JMP A;  1MKY A;  4NXM C;  1FJG C;  4LFC C;  4K0K C;  4LF4 C;  1ML8 A;  3CJE A;  3J80 D;  2E8F A;  4X66 C;  5IWA C;  3GKU A;  5A2Q D;  2F4V C;  1HNW C;  1J5E C;  2D7V A;  2KZF A;  4DV4 C;  4DUZ C;  2QL8 A;  2UUA C;  4X65 C;  4DR5 C;  5BR8 C;  4OX9 C;  2ZM6 C;  1N2F A;  2E5L C;  3AF6 A;  4JI0 C;  4X62 C;  4DV1 C;  4JV5 C;  1N33 C;  4DR3 C;  4JI7 C;  2EGT A;  3I07 A;  4BSZ A;  1XNQ C;  4MTN A;  1ZB8 A;  4DR6 C;  5LMU C;  1I94 C;  4DCU A;  2YCB A;  1K0R A;  4JI5 C;  4JYA C;  1UKK A;  1XMQ C;  1USP A;  1HR0 C;  2ONF A;  4LFA C;  1L2F A;  2UUC C;  4JI8 C;  3R9X A;  4DCV A;  4DCT A;  1EGA A;  1IBL C; 
#chains in the Genus database with same CATH topology
 5E7Q A;  4KHP C;  2ATW A;  4G1I A;  1P4E A;  1ULT A;  3AY0 A;  4B3R C;  2M5O A;  5A1I A;  1NYE A;  5BSW A;  2CXC A;  2M5H A;  2VSQ A;  4LF6 C;  4LE5 A;  4D56 A;  4ZJZ A;  1HH2 P;  3E7W A;  4DV6 C;  3ETO A;  2CU6 A;  4JI3 C;  3LNO A;  2D1R A;  1AMU A;  3LGX A;  1IBK C;  2VZE A;  3T1Y C;  5AE1 A;  3GR0 A;  4KTV A;  1HNX C;  3OTO C;  3C5E A;  2VQE C;  1V60 A;  1N36 C;  4DR1 C;  3A4I A;  4RM3 A;  2YWB A;  5JRH A;  2JNV A;  4NXN C;  1N32 C;  2OPL B;  4BCA A;  3TQI A;  4LF9 C;  2HHH C;  4D57 A;  3PES A;  1P4E C;  4RMN A;  4FUQ A;  3UX3 A;  4NOZ A;  4ZLP A;  2OO4 A;  5T8T A;  1MKY A;  1FJG C;  4R0M A;  1P7L A;  4JM1 A;  3J80 D;  5A2Q D;  1HNW C;  2D7V A;  2ZTB A;  2D1S A;  2QL8 A;  2UUA C;  4DR5 C;  3L8C A;  3AF6 A;  4JI0 C;  4BC7 A;  4JV5 C;  4DR3 C;  2PG1 E;  1T5H X;  5LMU C;  1MXA A;  4ISB A;  4RLF A;  3I08 A;  2P2F A;  2UUC C;  5AE3 A;  2YX1 A;  3R9X A;  4DCV A;  1IBL C;  5BST A;  3PRO C;  3EQ6 A;  2MM9 A;  2E8E A;  4JI4 C;  2BH1 X;  4I9F A;  3R9W A;  1MDB A;  5IT9 D;  1XRB A;  4NDN A;  1MXC A;  3UX2 A;  5A19 A;  2P2B A;  2UU9 C;  4RLQ A;  3T1H C;  3N54 B;  1IBM C;  4G36 A;  2OPL A;  4DUY C;  1YJ7 A;  3NI2 A;  5BSV A;  1WH9 A;  4LFB C;  1LQL A;  3GR1 A;  4PRO C;  4R1M A;  3NYQ A;  2D1Q A;  2VQF C;  4I9G A;  3O2E A;  3A9V A;  4GKJ C;  1PU1 A;  1LCI A;  4DV7 C;  2MMA B;  1O92 A;  2DHM A;  1MXB A;  4X64 C;  2PN2 A;  5BSR A;  3LAX A;  5BUR A;  3EER A;  5GTD A;  1HNZ C;  3RV2 A;  2DYJ A;  3G7S A;  1WF3 A;  5AE2 A;  2UXB C;  5T8S A;  2D28 C;  2ASB A;  2QVY X;  1VLA A;  5CZX A;  2OBV A;  2Y27 A;  1GPM A;  1VEH A;  3GPC A;  4TPS B;  2NCL A;  4LFC C;  4K0K C;  3NPD A;  3GKU A;  1O90 A;  2KZF A;  3VNQ A;  4DUZ C;  3ETC A;  4X65 C;  1IB8 A;  5BUQ A;  1N2F A;  3CQ1 A;  4BSZ A;  2KDN A;  1XNQ C;  4DG8 A;  4HPV A;  1ZB8 A;  1XMQ C;  4LFA C;  1EGA A;  1XS3 A;  2PRO A;  3IPL A;  3IEU A;  3J81 D;  5BUS A;  1ZB9 A;  4L2Z A;  3A9U A;  4DG9 A;  1PG4 A;  3CW8 X;  3LUS A;  2PT7 G;  4YHH C;  4BBY A;  2ZZN A;  2Z51 A;  1WCJ A;  1O9T A;  5LMN C;  4YY3 C;  4B3M C;  3VNS A;  4DV3 C;  2P2Q A;  4LF5 C;  4BC9 A;  5LCI A;  5K85 A;  4RVN A;  3IEV A;  2P20 A;  4L7I A;  4ODJ A;  4MH4 A;  4PUH A;  4AQY C;  2BJO A;  1XMO C;  5KYV A;  3UZ0 A;  2UXC C;  1T5D X;  4RVO A;  4WV3 A;  3DHV A;  3SO4 A;  4PUG A;  1XDX A;  5FLX D;  5DV9 A;  1PG3 A;  2QVZ X;  2D27 A;  1MDF A;  3CQ2 A;  4LF7 C;  2E7G A;  4B3S C;  3DLP X;  4GKK C;  4DV0 C;  5A1G A;  1QM4 A;  3LNV A;  4JI2 C;  1KKG A;  3CW9 A;  2YWC A;  4K0B A;  5ADZ A;  1XNR C;  3K6R A;  3FCC A;  4PZP A;  3H2T A;  2JMP A;  2P2J A;  2QW0 X;  5CZV A;  1XRC A;  3DAY A;  4OYC A;  4LF4 C;  3CJE A;  4X66 C;  5IWA C;  2F4V C;  4DV4 C;  3KXW A;  2Y4N A;  5KYT A;  4RM2 A;  5BR8 C;  2E5L C;  4IR7 A;  3CQ3 A;  4DV1 C;  5H9U A;  2EGT A;  1UWD A;  3TDE A;  2WP0 C;  4JI5 C;  4JYA C;  1XRA A;  1HR0 C;  1FLO A;  2ONF A;  5IFI A;  1V25 A;  4JI8 C;  3VNR A;  1PA4 A;  4FTF A;  2V7B A;  1V26 A;  1JOS A;  4LF8 C;  4DV2 C;  1O93 A;  4DV5 C;  2ZZM A;  3IML A;  4JI6 C;  4JI1 C;  2Y4O A;  5BSU A;  1NY8 A;  4GXQ A;  1USP B;  3S82 A;  2AYA A;  4EAT A;  4R1L A;  3FM7 A;  1XHJ A;  4U5Y D;  1M6X A;  4PHT A;  3PBK A;  4DR7 C;  1MD9 A;  3TUF A;  3TR3 A;  1QWI A;  3FCE A;  4GXR A;  4KTT A;  2DPL A;  2XR1 A;  2KZ0 A;  4IZ6 A;  4PUI A;  3B7W A;  4OXI A;  1FUG A;  4XX2 A;  2HJG A;  2WD9 A;  2MCQ A;  2UXD C;  4DCS A;  1RY2 A;  2CY1 A;  3JAM D;  1YGT A;  4FUT A;  5K8F A;  3J7A D;  4DR4 C;  3E7X A;  4D4G A;  2P02 A;  2E8C A;  4GS5 A;  3A26 A;  3AF5 A;  1N34 C;  4DR2 C;  2UUB C;  5KEI A;  4B3T C;  4L4Q A;  1RG9 A;  2P2M A;  4WS9 A;  4NXM C;  1TH5 A;  1ML8 A;  2E8F A;  1J5E C;  3RG2 A;  3NYR A;  1M6X C;  4OX9 C;  3A25 A;  1BA3 A;  2ZM6 C;  4X62 C;  1N33 C;  4JI7 C;  3I07 A;  5BSM A;  2D1T A;  4G37 A;  3UEB A;  3L95 X;  3R44 A;  4MTN A;  2E0G A;  4DR6 C;  1I94 C;  4DCU A;  2YCB A;  1K0R A;  3N2Q A;  3UOW A;  1UKK A;  2QVX X;  1USP A;  4D4I A;  1L2F A;  4DCT A; 
#chains in the Genus database with same CATH homology
 5E7Q A;  4KHP C;  2ATW A;  4G1I A;  1ULT A;  4B3R C;  5A1I A;  1NYE A;  5BSW A;  2CXC A;  2VSQ A;  4LF6 C;  4LE5 A;  4D56 A;  4ZJZ A;  1HH2 P;  3E7W A;  4DV6 C;  3ETO A;  4JI3 C;  2D1R A;  1AMU A;  3LGX A;  1IBK C;  2VZE A;  3T1Y C;  5AE1 A;  3GR0 A;  4KTV A;  1HNX C;  3OTO C;  3C5E A;  2VQE C;  1N36 C;  4DR1 C;  3A4I A;  4RM3 A;  2YWB A;  5JRH A;  4NXN C;  1N32 C;  2OPL B;  4BCA A;  3TQI A;  4LF9 C;  2HHH C;  4D57 A;  3PES A;  4RMN A;  4FUQ A;  4NOZ A;  4ZLP A;  2OO4 A;  5T8T A;  1MKY A;  1FJG C;  4R0M A;  1P7L A;  4JM1 A;  3J80 D;  5A2Q D;  1HNW C;  2D7V A;  2D1S A;  2QL8 A;  2UUA C;  4DR5 C;  3L8C A;  3AF6 A;  4JI0 C;  4BC7 A;  4JV5 C;  4DR3 C;  1T5H X;  5LMU C;  1MXA A;  4ISB A;  4RLF A;  3I08 A;  2P2F A;  2UUC C;  5AE3 A;  3R9X A;  4DCV A;  1IBL C;  5BST A;  3PRO C;  3EQ6 A;  2E8E A;  4JI4 C;  2BH1 X;  4I9F A;  3R9W A;  1MDB A;  5IT9 D;  1XRB A;  4NDN A;  1MXC A;  5A19 A;  2P2B A;  2UU9 C;  4RLQ A;  3T1H C;  3N54 B;  1IBM C;  4G36 A;  2OPL A;  4DUY C;  1YJ7 A;  3NI2 A;  5BSV A;  1WH9 A;  4LFB C;  1LQL A;  3GR1 A;  4PRO C;  4R1M A;  3NYQ A;  2D1Q A;  2VQF C;  4I9G A;  3A9V A;  4GKJ C;  1LCI A;  4DV7 C;  1O92 A;  1MXB A;  4X64 C;  2PN2 A;  5BSR A;  3LAX A;  5BUR A;  3EER A;  5GTD A;  1HNZ C;  3RV2 A;  2DYJ A;  3G7S A;  1WF3 A;  5AE2 A;  2UXB C;  5T8S A;  2D28 C;  2ASB A;  2QVY X;  1VLA A;  5CZX A;  2OBV A;  2Y27 A;  1GPM A;  3GPC A;  4TPS B;  4LFC C;  4K0K C;  3NPD A;  3GKU A;  2KZF A;  1O90 A;  3VNQ A;  4DUZ C;  3ETC A;  4X65 C;  5BUQ A;  1N2F A;  4BSZ A;  1XNQ C;  4DG8 A;  4HPV A;  1ZB8 A;  1XMQ C;  4LFA C;  1EGA A;  2PRO A;  3IPL A;  3IEU A;  3J81 D;  5BUS A;  1ZB9 A;  4L2Z A;  3A9U A;  4DG9 A;  1PG4 A;  3CW8 X;  3LUS A;  2PT7 G;  4YHH C;  4BBY A;  1O9T A;  5LMN C;  4YY3 C;  4B3M C;  3VNS A;  4DV3 C;  2P2Q A;  4LF5 C;  4BC9 A;  5K85 A;  4RVN A;  3IEV A;  2P20 A;  4L7I A;  4ODJ A;  4MH4 A;  4AQY C;  2BJO A;  1XMO C;  5KYV A;  3UZ0 A;  2UXC C;  1T5D X;  4RVO A;  4WV3 A;  3DHV A;  3SO4 A;  5FLX D;  5DV9 A;  1PG3 A;  2QVZ X;  2D27 A;  1MDF A;  4LF7 C;  2E7G A;  4B3S C;  3DLP X;  4GKK C;  4DCT A;  4DV0 C;  5A1G A;  1QM4 A;  3LNV A;  4JI2 C;  1KKG A;  3CW9 A;  2YWC A;  4K0B A;  5ADZ A;  1XNR C;  3FCC A;  4PZP A;  3H2T A;  2JMP A;  2P2J A;  2QW0 X;  5CZV A;  1XRC A;  3DAY A;  4OYC A;  4LF4 C;  3CJE A;  4X66 C;  5IWA C;  2F4V C;  4DV4 C;  3KXW A;  2Y4N A;  5KYT A;  4RM2 A;  5BR8 C;  2E5L C;  4IR7 A;  4DV1 C;  5H9U A;  2EGT A;  3TDE A;  2WP0 C;  4JI5 C;  4JYA C;  1XRA A;  1HR0 C;  2ONF A;  5IFI A;  1V25 A;  4JI8 C;  3VNR A;  1PA4 A;  4FTF A;  2V7B A;  1V26 A;  1JOS A;  4LF8 C;  4DV2 C;  1O93 A;  4DV5 C;  3IML A;  4JI6 C;  4JI1 C;  2Y4O A;  5BSU A;  4GXQ A;  1USP B;  3S82 A;  2AYA A;  4EAT A;  4R1L A;  4U5Y D;  4PHT A;  3PBK A;  4DR7 C;  1MD9 A;  3TUF A;  1QWI A;  3FCE A;  4GXR A;  4KTT A;  2DPL A;  2XR1 A;  4IZ6 A;  3B7W A;  4OXI A;  1FUG A;  4XX2 A;  2HJG A;  2WD9 A;  2UXD C;  4DCS A;  1RY2 A;  2CY1 A;  3JAM D;  4FUT A;  5K8F A;  3J7A D;  4DR4 C;  3E7X A;  4D4G A;  2P02 A;  2E8C A;  4GS5 A;  3AF5 A;  4DR2 C;  2UUB C;  5KEI A;  4B3T C;  4L4Q A;  1RG9 A;  2P2M A;  4WS9 A;  4NXM C;  1ML8 A;  2E8F A;  1J5E C;  3RG2 A;  3NYR A;  4OX9 C;  1BA3 A;  2ZM6 C;  4X62 C;  1N33 C;  4JI7 C;  3I07 A;  5BSM A;  2D1T A;  4G37 A;  3L95 X;  3R44 A;  4MTN A;  2E0G A;  4DR6 C;  1I94 C;  4DCU A;  2YCB A;  1K0R A;  3N2Q A;  3UOW A;  1UKK A;  2QVX X;  1USP A;  4D4I A;  1L2F A;  1N34 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...