4DR3C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 45
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr3C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr3C02
1ML8A 4JI1C 1N33C 4X66C 1ZB9A 4GKJC 1FJGC 1L2FA 4DV0C 2E7GA 4KHPC 2CY1A 2BJOA 2XR1A 5BR8C 1N34C 4OX9C 3J80D 4LF6C 2UUCC 1USPB 1HR0C 3AF5A 1N32C 4B3RC 1N2FA 3IEVA 3R9XA 4LFBC 2UXBC 4DR4C 4DR2C 2F4VC 1IBMC 4JI4C 2UU9C 1WH9A 3CJEA 2PT7G 3T1YC 4JI6C 2HHHC 4AQYC 2UUBC 4JV5C 4LFCC 2OPLA 1HNWC 2DYJA 2QL8A 1UKKA 4JYAC 1LQLA 1XMQC 4NXMC 2OPLB 2PN2A 2E8EA 4K0KC 4X64C 2D7VA 4DCSA 5LMUC 4LFAC 4DV5C 4B3TC 2E8FA 4LF7C 2ATWA 2UUAC 2KZFA 1I94C 4DV6C 4DR6C 4DUZC 5IT9D 1USPA 2JMPA 4DCUA 5FLXD 1HH2P 4NXNC 1MKYA 3AF6A 1JOSA 4DV3C 4B3MC 4YHHC 4LF9C 1QWIA 5IWAC 1IBLC 2UXCC 1N36C 5A2QD 2VQEC 1HNZC 4DCVA 1EGAA 3EERA 4DR3C 1VLAA 4DCTA 4B3SC 4JI5C 1KKGA 1ZB8A 4JI7C 4LF8C 5LMNC 2ASBA 1NYEA 2EGTA 2ZM6C 2ONFA 3OTOC 3R9WA 4DV2C 4MTNA 3GKUA 1IBKC 3J81D 3LUSA 4DR5C 4JI2C 4GKKC 4BSZA 4DR7C 3J7AD 1WF3A 4NOZA 4JI8C 1HNXC 1K0RA 2E8CA 4LF4C 2HJGA 2UXDC 3T1HC 1J5EC 4YY3C 3JAMD 4DUYC 1XNRC 4X62C 4JI3C 4LF5C 4XX2A 4DV4C 1PA4A 4DV7C 4DV1C 2CXCA 2E5LC 4DR1C 1XNQC 4X65C 3I07A 4MH4A 2VQFC 3IEUA 4JI0C 2YCBA 1XMOC
chains in the Genus database with same CATH superfamily
1XDXA 1ML8A 1O92A 2PROA 2MMAB 4I9FA 1UWDA 4D56A 2E7GA 1WCJA 5BUSA 4PUGA 1V60A 2YWCA 4RM3A 2MCQA 1HR0C 3NI2A 1NY8A 1VEHA 4BC9A 3UEBA 3CQ3A 5KEIA 3N54B 4JI4C 1WH9A 3T1YC 4WV3A 4JV5C 2YX1A 2VSQA 4NDNA 1HNWC 2QL8A 3NYRA 1XMQC 2P2QA 3E7XA 3UOWA 5E7QA 3IMLA 5BSWA 3K6RA 2ZZNA 4RMNA 3AY0A 3C5EA 4LF7C 1MXAA 4D4IA 1I94C 5ADZA 2Z51A 3DAYA 1HH2P 4NXNC 3B7WA 1MD9A 1PG3A 1JOSA 4ZLPA 3EQ6A 2WD9A 4OYCA 4R1MA 4LF9C 2D27A 1IBLC 2D1QA 5KYTA 4DCVA 1EGAA 4DCTA 4JI5C 2ASBA 1FUGA 2ONFA 4DV2C 5BSTA 2KDNA 3FCCA 4DR7C 1PU1A 4NOZA 2HJGA 3T1HC 4JI3C 2KZ0A 5KYVA 5BUQA 4D4GA 3R44A 1PA4A 4DV1C 2CXCA 3LNVA 4DR1C 1XNQC 1MXBA 3I07A 4MH4A 2VQFC 4FTFA 3O2EA 1YGTA 1BA3A 5AE1A 1ZB9A 2JNVA 2Y27A 1IB8A 2BJOA 1V25A 2XR1A 1FLOA 4OX9C 2QVZX 3J80D 5BSUA 4LF6C 2UUCC 1USPB 1N32C 4B3RC 1N2FA 4WS9A 3IEVA 3R9XA 4G37A 4DR2C 1ULTA 3CJEA 2PT7G 1P4EA 4AQYC 2BH1X 1P4EC 2AYAA 2OPLA 1RY2A 1UKKA 4R1LA 4DV5C 3N2QA 1TH5A 2KZFA 3CW9A 4DV6C 4DR6C 2JMPA 4FUTA 2OO4A 2P02A 1MKYA 3A4IA 5A19A 2M5HA 4R0MA 3CQ2A 3TDEA 2DHMA 5A2QD 2VQEC 5K85A 4BCAA 4DR3C 4IZ6A 4JI7C 3VNRA 2EGTA 3R9WA 3NYQA 1P7LA 1IBKC 3GKUA 3J81D 4DR5C 4JI2C 4GKKC 1WF3A 4IR7A 3UX2A 2CU6A 1HNXC 1K0RA 2D1SA 4LF4C 1J5EC 2M5OA 2D28C 4JM1A 4DV7C 3I08A 2E5LC 1QM4A 3IEUA 5T8SA 4PUIA 3RV2A 2Y4OA 5LCIA 5A1GA 1GPMA 1N33C 1T5DX 1L2FA 2QVXX 4DV0C 2CY1A 5BURA 5BR8C 1N34C 4BC7A 3A9UA 3PESA 3ETOA 3AF5A 3L8CA 2P2BA 4LFBC 4RVNA 4LE5A 2F4VC 1IBMC 4JI6C 1T5HX 2HHHC 3ETCA 4G36A 2DYJA 2V7BA 5GTDA 1LQLA 1XRBA 1PG4A 4NXMC 2PN2A 2E8EA 5K8FA 4DCSA 5LMUC 3FCEA 4LFAC 3CW8X 4D57A 4GXQA 2ATWA 2P20A 1XHJA 5IT9D 2PG1E 1USPA 4EATA 5FLXD 3GPCA 4I9GA 3FM7A 4RLQA 4GXRA 5DV9A 1QWIA 5IWAC 3A26A 4KTTA 1HNZC 1O93A 4RVOA 1VLAA 4U5YD 4B3SC 1KKGA 5H9UA 4LF8C 4PZPA 3TUFA 4PUHA 1NYEA 2ZM6C 1LCIA 3G7SA 3OTOC 2E0GA 2VZEA 4MTNA 2ZTBA 4L2ZA 3LUSA 3VNSA 3A9VA 4ZJZA 1XS3A 3VNQA 4K0BA 3UX3A 4ISBA 2UXDC 4DUYC 1XNRC 4X62C 5CZXA 3A25A 4XX2A 4DV4C 3H2TA 1MXCA 3KXWA 2P2FA 1O9TA 4X65C 1M6XA 1V26A 2YCBA 1XMOC 3NPDA 3DLPX 4JI1C 2Y4NA 3PBKA 4X66C 1FJGC 4GKJC 5BSRA 3TR3A 3LNOA 4G1IA 2OBVA 4KHPC 4RM2A 2MM9A 4PROC 1O90A 3E7WA 4DG9A 3IPLA 5BSVA 2UXBC 4DR4C 3PROC 2UU9C 5BSMA 2UUBC 1YJ7A 4LFCC 3S82A 5JRHA 5CZVA 4DG8A 4JYAC 4L7IA 1MDBA 2OPLB 4KTVA 3TQIA 4K0KC 4X64C 2D7VA 5A1IA 4B3TC 3GR0A 2E8FA 4TPSB 2UUAC 2QW0X 4DUZC 2NCLA 3DHVA 2WP0C 4DCUA 2ZZMA 1MDFA 3AF6A 4DV3C 4B3MC 4YHHC 2DPLA 1M6XC 3UZ0A 2UXCC 2D1RA 4PHTA 1N36C 5T8TA 4FUQA 3EERA 1ZB8A 4HPVA 4ODJA 4BBYA 1AMUA 5LMNC 2YWBA 2D1TA 4GS5A 3L95X 3SO4A 3RG2A 4BSZA 3GR1A 3J7AD 4JI8C 2E8CA 1XRAA 5AE3A 4YY3C 3JAMD 3CQ1A 4LF5C 4RLFA 4OXIA 5AE2A 2P2MA 2P2JA 1XRCA 3LAXA 1RG9A 5IFIA 3LGXA 4L4QA 4JI0C 2QVYX
chains in the Genus database with same CATH topology
1ML8A 1O92A 2PROA 4I9FA 4D56A 2E7GA 5BUSA 2YWCA 4RM3A 1HR0C 3NI2A 4BC9A 5KEIA 3N54B 4JI4C 1WH9A 3T1YC 4WV3A 4JV5C 2VSQA 4NDNA 1HNWC 2QL8A 3NYRA 1XMQC 2P2QA 3E7XA 3UOWA 5E7QA 3IMLA 5BSWA 4RMNA 3C5EA 4LF7C 1MXAA 4D4IA 1I94C 5ADZA 3DAYA 1HH2P 4NXNC 3B7WA 1MD9A 1PG3A 1JOSA 4ZLPA 3EQ6A 2WD9A 4OYCA 4R1MA 4LF9C 2D27A 1IBLC 2D1QA 5KYTA 4DCVA 1EGAA 4DCTA 4JI5C 2ASBA 1FUGA 2ONFA 4DV2C 5BSTA 3FCCA 4DR7C 4NOZA 2HJGA 3T1HC 4JI3C 5KYVA 5BUQA 4D4GA 3R44A 1PA4A 4DV1C 2CXCA 3LNVA 4DR1C 1XNQC 1MXBA 3I07A 4MH4A 2VQFC 4FTFA 1BA3A 5AE1A 1ZB9A 2Y27A 2BJOA 1V25A 2XR1A 4OX9C 2QVZX 3J80D 5BSUA 4LF6C 2UUCC 1USPB 1N32C 4B3RC 1N2FA 4WS9A 3IEVA 3R9XA 4G37A 4DR2C 1ULTA 3CJEA 2PT7G 4AQYC 2BH1X 2AYAA 2OPLA 1RY2A 1UKKA 4R1LA 4DV5C 3N2QA 2KZFA 3CW9A 4DV6C 4DR6C 2JMPA 4FUTA 2OO4A 2P02A 1MKYA 3A4IA 5A19A 4R0MA 3TDEA 5A2QD 2VQEC 5K85A 4BCAA 4DR3C 4IZ6A 4JI7C 3VNRA 2EGTA 3R9WA 3NYQA 1P7LA 1IBKC 3GKUA 3J81D 4DR5C 4JI2C 4GKKC 1WF3A 4IR7A 1HNXC 1K0RA 2D1SA 4LF4C 1J5EC 2D28C 4JM1A 4DV7C 3I08A 2E5LC 1QM4A 3IEUA 5T8SA 3RV2A 2Y4OA 5A1GA 1GPMA 1N33C 1T5DX 1L2FA 2QVXX 4DV0C 2CY1A 5BURA 5BR8C 1N34C 4BC7A 3A9UA 3PESA 3ETOA 3AF5A 3L8CA 2P2BA 4LFBC 4RVNA 4LE5A 2F4VC 1IBMC 4JI6C 1T5HX 2HHHC 3ETCA 4G36A 2DYJA 2V7BA 5GTDA 1LQLA 1XRBA 1PG4A 4NXMC 2PN2A 2E8EA 5K8FA 4DCSA 5LMUC 3FCEA 4LFAC 3CW8X 4D57A 4GXQA 2ATWA 2P20A 5IT9D 1USPA 4EATA 5FLXD 3GPCA 4I9GA 4RLQA 4GXRA 5DV9A 1QWIA 5IWAC 4KTTA 1HNZC 1O93A 4RVOA 1VLAA 4U5YD 4B3SC 1KKGA 5H9UA 4LF8C 4PZPA 3TUFA 1NYEA 2ZM6C 1LCIA 3G7SA 3OTOC 2E0GA 2VZEA 4MTNA 4L2ZA 3LUSA 3VNSA 3A9VA 4ZJZA 3VNQA 4K0BA 2UXDC 4ISBA 4DUYC 1XNRC 4X62C 5CZXA 4XX2A 4DV4C 3H2TA 1MXCA 3KXWA 2P2FA 1O9TA 4X65C 1V26A 2YCBA 1XMOC 3NPDA 3DLPX 4JI1C 2Y4NA 3PBKA 4X66C 1FJGC 4GKJC 5BSRA 4G1IA 2OBVA 4KHPC 4RM2A 4PROC 1O90A 3E7WA 4DG9A 3IPLA 5BSVA 2UXBC 4DR4C 3PROC 2UU9C 5BSMA 2UUBC 1YJ7A 4LFCC 3S82A 5JRHA 5CZVA 4DG8A 4JYAC 4L7IA 1MDBA 2OPLB 4KTVA 3TQIA 4K0KC 4X64C 2D7VA 5A1IA 4B3TC 3GR0A 2E8FA 4TPSB 2UUAC 2QW0X 4DUZC 3DHVA 2WP0C 4DCUA 1MDFA 3AF6A 4DV3C 4B3MC 4YHHC 2DPLA 3UZ0A 2UXCC 2D1RA 4PHTA 1N36C 5T8TA 4FUQA 3EERA 1ZB8A 4HPVA 4ODJA 4BBYA 1AMUA 5LMNC 2YWBA 2D1TA 4GS5A 3L95X 3SO4A 3RG2A 4BSZA 3GR1A 3J7AD 4JI8C 2E8CA 1XRAA 5AE3A 4YY3C 3JAMD 4LF5C 4RLFA 4OXIA 5AE2A 2P2MA 2P2JA 1XRCA 3LAXA 1RG9A 5IFIA 3LGXA 4L4QA 4JI0C 2QVYX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML8 A;  4JI1 C;  1N33 C;  4X66 C;  1ZB9 A;  4GKJ C;  1FJG C;  1L2F A;  4DV0 C;  2E7G A;  4KHP C;  2CY1 A;  2BJO A;  2XR1 A;  5BR8 C;  1N34 C;  4OX9 C;  3J80 D;  4LF6 C;  2UUC C;  1USP B;  1HR0 C;  3AF5 A;  1N32 C;  4B3R C;  1N2F A;  3IEV A;  3R9X A;  4LFB C;  2UXB C;  4DR4 C;  4DR2 C;  2F4V C;  1IBM C;  4JI4 C;  2UU9 C;  1WH9 A;  3CJE A;  2PT7 G;  3T1Y C;  4JI6 C;  2HHH C;  4AQY C;  2UUB C;  4JV5 C;  4LFC C;  2OPL A;  1HNW C;  2DYJ A;  2QL8 A;  1UKK A;  4JYA C;  1LQL A;  1XMQ C;  4NXM C;  2OPL B;  2PN2 A;  2E8E A;  4K0K C;  4X64 C;  2D7V A;  4DCS A;  5LMU C;  4LFA C;  4DV5 C;  4B3T C;  2E8F A;  4LF7 C;  2ATW A;  2UUA C;  2KZF A;  1I94 C;  4DV6 C;  4DR6 C;  4DUZ C;  5IT9 D;  1USP A;  2JMP A;  4DCU A;  5FLX D;  1HH2 P;  4NXN C;  1MKY A;  3AF6 A;  1JOS A;  4DV3 C;  4B3M C;  4YHH C;  4LF9 C;  1QWI A;  5IWA C;  1IBL C;  2UXC C;  1N36 C;  5A2Q D;  2VQE C;  1HNZ C;  4DCV A;  1EGA A;  3EER A;  4DR3 C;  1VLA A;  4DCT A;  4B3S C;  4JI5 C;  1KKG A;  1ZB8 A;  4JI7 C;  4LF8 C;  5LMN C;  2ASB A;  1NYE A;  2EGT A;  2ZM6 C;  2ONF A;  3OTO C;  3R9W A;  4DV2 C;  4MTN A;  3GKU A;  1IBK C;  3J81 D;  3LUS A;  4DR5 C;  4JI2 C;  4GKK C;  4BSZ A;  4DR7 C;  3J7A D;  1WF3 A;  4NOZ A;  4JI8 C;  1HNX C;  1K0R A;  2E8C A;  4LF4 C;  2HJG A;  2UXD C;  3T1H C;  1J5E C;  4YY3 C;  3JAM D;  4DUY C;  1XNR C;  4X62 C;  4JI3 C;  4LF5 C;  4XX2 A;  4DV4 C;  1PA4 A;  4DV7 C;  4DV1 C;  2CXC A;  2E5L C;  4DR1 C;  1XNQ C;  4X65 C;  3I07 A;  4MH4 A;  2VQF C;  3IEU A;  4JI0 C;  2YCB A;  1XMO C; 
#chains in the Genus database with same CATH topology
 1XDX A;  1ML8 A;  1O92 A;  2PRO A;  2MMA B;  4I9F A;  1UWD A;  4D56 A;  2E7G A;  1WCJ A;  5BUS A;  4PUG A;  1V60 A;  2YWC A;  4RM3 A;  2MCQ A;  1HR0 C;  3NI2 A;  1NY8 A;  1VEH A;  4BC9 A;  3UEB A;  3CQ3 A;  5KEI A;  3N54 B;  4JI4 C;  1WH9 A;  3T1Y C;  4WV3 A;  4JV5 C;  2YX1 A;  2VSQ A;  4NDN A;  1HNW C;  2QL8 A;  3NYR A;  1XMQ C;  2P2Q A;  3E7X A;  3UOW A;  5E7Q A;  3IML A;  5BSW A;  3K6R A;  2ZZN A;  4RMN A;  3AY0 A;  3C5E A;  4LF7 C;  1MXA A;  4D4I A;  1I94 C;  5ADZ A;  2Z51 A;  3DAY A;  1HH2 P;  4NXN C;  3B7W A;  1MD9 A;  1PG3 A;  1JOS A;  4ZLP A;  3EQ6 A;  2WD9 A;  4OYC A;  4R1M A;  4LF9 C;  2D27 A;  1IBL C;  2D1Q A;  5KYT A;  4DCV A;  1EGA A;  4DCT A;  4JI5 C;  2ASB A;  1FUG A;  2ONF A;  4DV2 C;  5BST A;  2KDN A;  3FCC A;  4DR7 C;  1PU1 A;  4NOZ A;  2HJG A;  3T1H C;  4JI3 C;  2KZ0 A;  5KYV A;  5BUQ A;  4D4G A;  3R44 A;  1PA4 A;  4DV1 C;  2CXC A;  3LNV A;  4DR1 C;  1XNQ C;  1MXB A;  3I07 A;  4MH4 A;  2VQF C;  4FTF A;  3O2E A;  1YGT A;  1BA3 A;  5AE1 A;  1ZB9 A;  2JNV A;  2Y27 A;  1IB8 A;  2BJO A;  1V25 A;  2XR1 A;  1FLO A;  4OX9 C;  2QVZ X;  3J80 D;  5BSU A;  4LF6 C;  2UUC C;  1USP B;  1N32 C;  4B3R C;  1N2F A;  4WS9 A;  3IEV A;  3R9X A;  4G37 A;  4DR2 C;  1ULT A;  3CJE A;  2PT7 G;  1P4E A;  4AQY C;  2BH1 X;  1P4E C;  2AYA A;  2OPL A;  1RY2 A;  1UKK A;  4R1L A;  4DV5 C;  3N2Q A;  1TH5 A;  2KZF A;  3CW9 A;  4DV6 C;  4DR6 C;  2JMP A;  4FUT A;  2OO4 A;  2P02 A;  1MKY A;  3A4I A;  5A19 A;  2M5H A;  4R0M A;  3CQ2 A;  3TDE A;  2DHM A;  5A2Q D;  2VQE C;  5K85 A;  4BCA A;  4DR3 C;  4IZ6 A;  4JI7 C;  3VNR A;  2EGT A;  3R9W A;  3NYQ A;  1P7L A;  1IBK C;  3GKU A;  3J81 D;  4DR5 C;  4JI2 C;  4GKK C;  1WF3 A;  4IR7 A;  3UX2 A;  2CU6 A;  1HNX C;  1K0R A;  2D1S A;  4LF4 C;  1J5E C;  2M5O A;  2D28 C;  4JM1 A;  4DV7 C;  3I08 A;  2E5L C;  1QM4 A;  3IEU A;  5T8S A;  4PUI A;  3RV2 A;  2Y4O A;  5LCI A;  5A1G A;  1GPM A;  1N33 C;  1T5D X;  1L2F A;  2QVX X;  4DV0 C;  2CY1 A;  5BUR A;  5BR8 C;  1N34 C;  4BC7 A;  3A9U A;  3PES A;  3ETO A;  3AF5 A;  3L8C A;  2P2B A;  4LFB C;  4RVN A;  4LE5 A;  2F4V C;  1IBM C;  4JI6 C;  1T5H X;  2HHH C;  3ETC A;  4G36 A;  2DYJ A;  2V7B A;  5GTD A;  1LQL A;  1XRB A;  1PG4 A;  4NXM C;  2PN2 A;  2E8E A;  5K8F A;  4DCS A;  5LMU C;  3FCE A;  4LFA C;  3CW8 X;  4D57 A;  4GXQ A;  2ATW A;  2P20 A;  1XHJ A;  5IT9 D;  2PG1 E;  1USP A;  4EAT A;  5FLX D;  3GPC A;  4I9G A;  3FM7 A;  4RLQ A;  4GXR A;  5DV9 A;  1QWI A;  5IWA C;  3A26 A;  4KTT A;  1HNZ C;  1O93 A;  4RVO A;  1VLA A;  4U5Y D;  4B3S C;  1KKG A;  5H9U A;  4LF8 C;  4PZP A;  3TUF A;  4PUH A;  1NYE A;  2ZM6 C;  1LCI A;  3G7S A;  3OTO C;  2E0G A;  2VZE A;  4MTN A;  2ZTB A;  4L2Z A;  3LUS A;  3VNS A;  3A9V A;  4ZJZ A;  1XS3 A;  3VNQ A;  4K0B A;  3UX3 A;  4ISB A;  2UXD C;  4DUY C;  1XNR C;  4X62 C;  5CZX A;  3A25 A;  4XX2 A;  4DV4 C;  3H2T A;  1MXC A;  3KXW A;  2P2F A;  1O9T A;  4X65 C;  1M6X A;  1V26 A;  2YCB A;  1XMO C;  3NPD A;  3DLP X;  4JI1 C;  2Y4N A;  3PBK A;  4X66 C;  1FJG C;  4GKJ C;  5BSR A;  3TR3 A;  3LNO A;  4G1I A;  2OBV A;  4KHP C;  4RM2 A;  2MM9 A;  4PRO C;  1O90 A;  3E7W A;  4DG9 A;  3IPL A;  5BSV A;  2UXB C;  4DR4 C;  3PRO C;  2UU9 C;  5BSM A;  2UUB C;  1YJ7 A;  4LFC C;  3S82 A;  5JRH A;  5CZV A;  4DG8 A;  4JYA C;  4L7I A;  1MDB A;  2OPL B;  4KTV A;  3TQI A;  4K0K C;  4X64 C;  2D7V A;  5A1I A;  4B3T C;  3GR0 A;  2E8F A;  4TPS B;  2UUA C;  2QW0 X;  4DUZ C;  2NCL A;  3DHV A;  2WP0 C;  4DCU A;  2ZZM A;  1MDF A;  3AF6 A;  4DV3 C;  4B3M C;  4YHH C;  2DPL A;  1M6X C;  3UZ0 A;  2UXC C;  2D1R A;  4PHT A;  1N36 C;  5T8T A;  4FUQ A;  3EER A;  1ZB8 A;  4HPV A;  4ODJ A;  4BBY A;  1AMU A;  5LMN C;  2YWB A;  2D1T A;  4GS5 A;  3L95 X;  3SO4 A;  3RG2 A;  4BSZ A;  3GR1 A;  3J7A D;  4JI8 C;  2E8C A;  1XRA A;  5AE3 A;  4YY3 C;  3JAM D;  3CQ1 A;  4LF5 C;  4RLF A;  4OXI A;  5AE2 A;  2P2M A;  2P2J A;  1XRC A;  3LAX A;  1RG9 A;  5IFI A;  3LGX A;  4L4Q A;  4JI0 C;  2QVY X; 
#chains in the Genus database with same CATH homology
 1ML8 A;  1O92 A;  2PRO A;  4I9F A;  4D56 A;  2E7G A;  5BUS A;  2YWC A;  4RM3 A;  1HR0 C;  3NI2 A;  4BC9 A;  5KEI A;  3N54 B;  4JI4 C;  1WH9 A;  3T1Y C;  4WV3 A;  4JV5 C;  2VSQ A;  4NDN A;  1HNW C;  2QL8 A;  3NYR A;  1XMQ C;  2P2Q A;  3E7X A;  3UOW A;  5E7Q A;  3IML A;  5BSW A;  4RMN A;  3C5E A;  4LF7 C;  1MXA A;  4D4I A;  1I94 C;  5ADZ A;  3DAY A;  1HH2 P;  4NXN C;  3B7W A;  1MD9 A;  1PG3 A;  1JOS A;  4ZLP A;  3EQ6 A;  2WD9 A;  4OYC A;  4R1M A;  4LF9 C;  2D27 A;  1IBL C;  2D1Q A;  5KYT A;  4DCV A;  1EGA A;  4DCT A;  4JI5 C;  2ASB A;  1FUG A;  2ONF A;  4DV2 C;  5BST A;  3FCC A;  4DR7 C;  4NOZ A;  2HJG A;  3T1H C;  4JI3 C;  5KYV A;  5BUQ A;  4D4G A;  3R44 A;  1PA4 A;  4DV1 C;  2CXC A;  3LNV A;  4DR1 C;  1XNQ C;  1MXB A;  3I07 A;  4MH4 A;  2VQF C;  4FTF A;  1BA3 A;  5AE1 A;  1ZB9 A;  2Y27 A;  2BJO A;  1V25 A;  2XR1 A;  4OX9 C;  2QVZ X;  3J80 D;  5BSU A;  4LF6 C;  2UUC C;  1USP B;  1N32 C;  4B3R C;  1N2F A;  4WS9 A;  3IEV A;  3R9X A;  4G37 A;  4DR2 C;  1ULT A;  3CJE A;  2PT7 G;  4AQY C;  2BH1 X;  2AYA A;  2OPL A;  1RY2 A;  1UKK A;  4R1L A;  4DV5 C;  3N2Q A;  2KZF A;  3CW9 A;  4DV6 C;  4DR6 C;  2JMP A;  4FUT A;  2OO4 A;  2P02 A;  1MKY A;  3A4I A;  5A19 A;  4R0M A;  3TDE A;  5A2Q D;  2VQE C;  5K85 A;  4BCA A;  4DR3 C;  4IZ6 A;  4JI7 C;  3VNR A;  2EGT A;  3R9W A;  3NYQ A;  1P7L A;  1IBK C;  3GKU A;  3J81 D;  4DR5 C;  4JI2 C;  4GKK C;  1WF3 A;  4IR7 A;  1HNX C;  1K0R A;  2D1S A;  4LF4 C;  1J5E C;  2D28 C;  4JM1 A;  4DV7 C;  3I08 A;  2E5L C;  1QM4 A;  3IEU A;  5T8S A;  3RV2 A;  2Y4O A;  5A1G A;  1GPM A;  1N33 C;  1T5D X;  1L2F A;  2QVX X;  4DV0 C;  2CY1 A;  5BUR A;  5BR8 C;  1N34 C;  4BC7 A;  3A9U A;  3PES A;  3ETO A;  3AF5 A;  3L8C A;  2P2B A;  4LFB C;  4RVN A;  4LE5 A;  2F4V C;  1IBM C;  4JI6 C;  1T5H X;  2HHH C;  3ETC A;  4G36 A;  2DYJ A;  2V7B A;  5GTD A;  1LQL A;  1XRB A;  1PG4 A;  4NXM C;  2PN2 A;  2E8E A;  5K8F A;  4DCS A;  5LMU C;  3FCE A;  4LFA C;  3CW8 X;  4D57 A;  4GXQ A;  2ATW A;  2P20 A;  5IT9 D;  1USP A;  4EAT A;  5FLX D;  3GPC A;  4I9G A;  4RLQ A;  4GXR A;  5DV9 A;  1QWI A;  5IWA C;  4KTT A;  1HNZ C;  1O93 A;  4RVO A;  1VLA A;  4U5Y D;  4B3S C;  1KKG A;  5H9U A;  4LF8 C;  4PZP A;  3TUF A;  1NYE A;  2ZM6 C;  1LCI A;  3G7S A;  3OTO C;  2E0G A;  2VZE A;  4MTN A;  4L2Z A;  3LUS A;  3VNS A;  3A9V A;  4ZJZ A;  3VNQ A;  4K0B A;  2UXD C;  4ISB A;  4DUY C;  1XNR C;  4X62 C;  5CZX A;  4XX2 A;  4DV4 C;  3H2T A;  1MXC A;  3KXW A;  2P2F A;  1O9T A;  4X65 C;  1V26 A;  2YCB A;  1XMO C;  3NPD A;  3DLP X;  4JI1 C;  2Y4N A;  3PBK A;  4X66 C;  1FJG C;  4GKJ C;  5BSR A;  4G1I A;  2OBV A;  4KHP C;  4RM2 A;  4PRO C;  1O90 A;  3E7W A;  4DG9 A;  3IPL A;  5BSV A;  2UXB C;  4DR4 C;  3PRO C;  2UU9 C;  5BSM A;  2UUB C;  1YJ7 A;  4LFC C;  3S82 A;  5JRH A;  5CZV A;  4DG8 A;  4JYA C;  4L7I A;  1MDB A;  2OPL B;  4KTV A;  3TQI A;  4K0K C;  4X64 C;  2D7V A;  5A1I A;  4B3T C;  3GR0 A;  2E8F A;  4TPS B;  2UUA C;  2QW0 X;  4DUZ C;  3DHV A;  2WP0 C;  4DCU A;  1MDF A;  3AF6 A;  4DV3 C;  4B3M C;  4YHH C;  2DPL A;  3UZ0 A;  2UXC C;  2D1R A;  4PHT A;  1N36 C;  5T8T A;  4FUQ A;  3EER A;  1ZB8 A;  4HPV A;  4ODJ A;  4BBY A;  1AMU A;  5LMN C;  2YWB A;  2D1T A;  4GS5 A;  3L95 X;  3SO4 A;  3RG2 A;  4BSZ A;  3GR1 A;  3J7A D;  4JI8 C;  2E8C A;  1XRA A;  5AE3 A;  4YY3 C;  3JAM D;  4LF5 C;  4RLF A;  4OXI A;  5AE2 A;  2P2M A;  2P2J A;  1XRC A;  3LAX A;  1RG9 A;  5IFI A;  3LGX A;  4L4Q A;  4JI0 C;  2QVY X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...