4DR3C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 45
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr3C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr3C02
5LMNC 4DV3C 4JI7C 4LF7C 1N34C 4JI6C 1LQLA 2ATWA 2UXCC 1MKYA 3J81D 1N36C 1QWIA 3AF5A 1FJGC 4X64C 1HNWC 4BSZA 4LF9C 1ZB8A 4B3MC 5FLXD 2DYJA 2OPLB 4GKKC 2E8EA 4X65C 4DV0C 4NXNC 4DR3C 2VQEC 1JOSA 2UUCC 4LF8C 4JI1C 1L2FA 3OTOC 1WF3A 3J80D 4YHHC 4DCTA 3J7AD 4GKJC 4MTNA 4DCVA 4DCUA 1USPB 4DV7C 3R9WA 4B3TC 4LF4C 4DV2C 2E8FA 5A2QD 1PA4A 4LFAC 4DV6C 3I07A 4JYAC 2ONFA 5LMUC 2CY1A 2ASBA 4DR7C 1HNXC 1I94C 2HHHC 3IEUA 2UUBC 2E7GA 3EERA 4DV5C 2PN2A 2UU9C 2KZFA 3T1HC 3LUSA 3GKUA 3AF6A 4DR5C 1XMQC 1N33C 4NOZA 1EGAA 1K0RA 2XR1A 4JI5C 2OPLA 3CJEA 1WH9A 4KHPC 4YY3C 4DR2C 1NYEA 4LF6C 1HNZC 4DCSA 4JI8C 4X62C 1IBLC 4AQYC 1HH2P 1ZB9A 1N2FA 1J5EC 1VLAA 4JI3C 3R9XA 2JMPA 4XX2A 4OX9C 1IBMC 2PT7G 4DR4C 4DV4C 1N32C 1KKGA 4JI2C 3IEVA 4LFCC 4JV5C 4NXMC 2HJGA 1USPA 4X66C 2QL8A 2F4VC 2E8CA 4DR6C 2YCBA 2UUAC 1XNRC 4B3SC 3JAMD 4DUYC 2VQFC 1IBKC 5IT9D 4MH4A 4JI4C 4DR1C 4LFBC 4K0KC 2CXCA 2ZM6C 1UKKA 4DUZC 3T1YC 2UXBC 5BR8C 4DV1C 1XNQC 1ML8A 2E5LC 4JI0C 2D7VA 2EGTA 2BJOA 2UXDC 1XMOC 1HR0C 4B3RC 5IWAC 4LF5C
chains in the Genus database with same CATH superfamily
4RVNA 5A1IA 4LF7C 5A19A 2D1SA 3FCCA 3J81D 3UX3A 1QWIA 3A25A 4BSZA 4LF9C 1PG4A 3TR3A 4GKKC 5CZXA 4DV0C 2DPLA 2VQEC 1JOSA 4KTTA 2P2BA 4R0MA 1V60A 2QVZX 3G7SA 4RVOA 1USPB 3N2QA 4G1IA 4LF4C 2D1RA 4DV2C 2E8FA 1LCIA 5A2QD 4PHTA 2HHHC 1RG9A 5DV9A 5BSUA 3AF6A 1XMQC 4BC7A 3E7WA 1EGAA 1K0RA 3NYRA 2OPLA 3VNSA 3LNVA 1NYEA 4DCSA 5IFIA 3LAXA 1ZB9A 3GPCA 4JM1A 3GR1A 4L2ZA 1TH5A 5AE2A 2PT7G 4DV4C 1N32C 3AY0A 4JI2C 3CW8X 1YJ7A 1USPA 4X66C 2DHMA 2F4VC 1XNRC 2ZTBA 2VQFC 4MH4A 4JI4C 1V25A 4BC9A 3UOWA 3UX2A 4DUZC 2QVYX 4IZ6A 1XNQC 3R44A 2D7VA 4RLQA 2BJOA 2UXDC 2P2FA 4IR7A 5BSVA 2PG1E 5LMNC 4DV3C 4D57A 1N34C 4JI6C 1LQLA 1MDFA 5BURA 2UXCC 3AF5A 1M6XA 4TPSB 1YGTA 5FLXD 3RG2A 4X65C 2QW0X 4NXNC 4DR3C 4RLFA 4LF8C 1XRBA 4PZPA 4PROC 3J80D 4YHHC 4DCTA 1UWDA 4MTNA 1XRAA 2BH1X 4B3TC 4R1MA 1PA4A 4LFAC 4DV6C 4ODJA 4JYAC 5LMUC 2CY1A 3K6RA 1HNXC 3DLPX 4ZLPA 3EERA 2OO4A 2PN2A 5BUSA 3CQ2A 2Z51A 4NOZA 1IB8A 3PBKA 2XR1A 3L8CA 3VNRA 4L4QA 4YY3C 4G36A 2KZ0A 1HNZC 1MDBA 3NI2A 1J5EC 1VLAA 2JNVA 2MM9A 3R9XA 4XX2A 4OX9C 2D28C 4WS9A 3UZ0A 2VSQA 2P2JA 3KXWA 4NXMC 1O92A 2HJGA 1QM4A 2NCLA 1FLOA 2YCBA 4GS5A 5CZVA 3NPDA 3ETCA 4PUGA 1IBKC 5IT9D 2CXCA 4PUIA 3T1YC 3TQIA 2E5LC 4R1LA 2D27A 5AE1A 1HR0C 3TUFA 1XDXA 4JI7C 4D56A 2E0GA 1MXBA 3CW9A 3LGXA 3N54B 2CU6A 2D1TA 1FJGC 4DG9A 5ADZA 1HNWC 1VEHA 1ZB8A 5BSWA 1O90A 2YX1A 3IPLA 5BUQA 4B3MC 5KEIA 1FUGA 4PUHA 4JI1C 1L2FA 2OBVA 1P7LA 4GKJC 4KTVA 2MMAB 1PG3A 3C5EA 1MXAA 3I07A 4BCAA 4EATA 1I94C 2UUBC 2YWCA 3L95X 4DV5C 3B7WA 4I9GA 2KZFA 3CQ3A 3T1HC 5T8TA 3LUSA 4DR5C 3CQ1A 3VNQA 2P02A 4JI5C 1WH9A 1T5HX 2Y27A 1V26A 4RMNA 2D1QA 5BSRA 1GPMA 4DR2C 1P4EC 2ZZNA 4FUQA 4LF6C 4BBYA 3UEBA 4JI8C 4X62C 1IBLC 1N2FA 5KYVA 4JI3C 2JMPA 4D4IA 3DHVA 1IBMC 4DR4C 1KKGA 4LFCC 4JV5C 2P20A 4D4GA 2M5OA 2QL8A 3FCEA 5K8FA 2E8CA 2UUAC 4U5YD 2ZZMA 4RM2A 4DUYC 4HPVA 4WV3A 3A4IA 4K0KC 5H9UA 3SO4A 1UKKA 3PROC 5A1GA 2V7BA 5JRHA 5BR8C 3H2TA 1ML8A 2M5HA 4FTFA 4JI0C 1M6XC 2PROA 1XMOC 4B3RC 5IWAC 2P2MA 1PU1A 1O93A 1MD9A 4OYCA 3EQ6A 2AYAA 2WP0C 2ATWA 3DAYA 2QVXX 4K0BA 3O2EA 1MKYA 1N36C 3A9VA 4X64C 1O9TA 1MXCA 2DYJA 2OPLB 3E7XA 2E8EA 2YWBA 1P4EA 2UUCC 1RY2A 1XHJA 3OTOC 1WF3A 3J7AD 4DCVA 3NYQA 5LCIA 4DCUA 4DV7C 3R9WA 4OXIA 4NDNA 4DG8A 2ONFA 5BSMA 3ETOA 2P2QA 2ASBA 4DR7C 3IEUA 2E7GA 2WD9A 2UU9C 4ISBA 4LE5A 3GKUA 1N33C 2Y4NA 1T5DX 5BSTA 4GXQA 3A9UA 1XRCA 3CJEA 4KHPC 4L7IA 2Y4OA 4FUTA 3RV2A 5K85A 4ZJZA 4AQYC 1HH2P 5T8SA 4I9FA 4GXRA 3A26A 5KYTA 3IEVA 1AMUA 1WCJA 2KDNA 3TDEA 1ULTA 4DR6C 5AE3A 3S82A 4G37A 5E7QA 3I08A 1NY8A 3PESA 3JAMD 1BA3A 4B3SC 3GR0A 1XS3A 3FM7A 4LFBC 4DR1C 2ZM6C 2UXBC 4DV1C 2MCQA 2EGTA 5GTDA 2VZEA 4RM3A 4LF5C 3LNOA 3IMLA
chains in the Genus database with same CATH topology
4RVNA 5A1IA 4LF7C 5A19A 2D1SA 3FCCA 3J81D 1QWIA 4BSZA 4LF9C 1PG4A 4GKKC 5CZXA 4DV0C 2DPLA 2VQEC 1JOSA 4KTTA 2P2BA 4R0MA 2QVZX 3G7SA 4RVOA 1USPB 3N2QA 4G1IA 4LF4C 2D1RA 4DV2C 2E8FA 1LCIA 5A2QD 4PHTA 2HHHC 1RG9A 5DV9A 5BSUA 3AF6A 1XMQC 4BC7A 3E7WA 1EGAA 1K0RA 3NYRA 2OPLA 3VNSA 3LNVA 1NYEA 4DCSA 5IFIA 3LAXA 1ZB9A 3GPCA 4JM1A 3GR1A 4L2ZA 5AE2A 2PT7G 4DV4C 1N32C 4JI2C 3CW8X 1YJ7A 1USPA 4X66C 2F4VC 1XNRC 2VQFC 4MH4A 4JI4C 1V25A 4BC9A 3UOWA 4DUZC 2QVYX 4IZ6A 1XNQC 3R44A 2D7VA 4RLQA 2BJOA 2UXDC 2P2FA 4IR7A 5BSVA 5LMNC 4DV3C 4D57A 1N34C 4JI6C 1LQLA 1MDFA 5BURA 2UXCC 3AF5A 4TPSB 5FLXD 3RG2A 4X65C 2QW0X 4NXNC 4DR3C 4RLFA 4LF8C 1XRBA 4PZPA 4PROC 3J80D 4YHHC 4DCTA 4MTNA 1XRAA 2BH1X 4B3TC 4R1MA 1PA4A 4LFAC 4DV6C 4ODJA 4JYAC 5LMUC 2CY1A 1HNXC 3DLPX 4ZLPA 3EERA 2OO4A 2PN2A 5BUSA 4NOZA 3PBKA 2XR1A 3L8CA 3VNRA 4L4QA 4YY3C 4G36A 1HNZC 1MDBA 3NI2A 1J5EC 1VLAA 3R9XA 4XX2A 4OX9C 2D28C 4WS9A 3UZ0A 2VSQA 2P2JA 3KXWA 4NXMC 1O92A 2HJGA 1QM4A 2YCBA 4GS5A 5CZVA 3NPDA 3ETCA 1IBKC 5IT9D 2CXCA 3T1YC 3TQIA 2E5LC 4R1LA 2D27A 5AE1A 1HR0C 3TUFA 4JI7C 4D56A 2E0GA 1MXBA 3CW9A 3LGXA 3N54B 2D1TA 1FJGC 4DG9A 5ADZA 1HNWC 1ZB8A 5BSWA 1O90A 3IPLA 5BUQA 4B3MC 5KEIA 1FUGA 4JI1C 1L2FA 2OBVA 1P7LA 4GKJC 4KTVA 1PG3A 3C5EA 1MXAA 3I07A 4BCAA 4EATA 1I94C 2UUBC 2YWCA 3L95X 4DV5C 3B7WA 4I9GA 2KZFA 3T1HC 5T8TA 3LUSA 4DR5C 3VNQA 2P02A 4JI5C 1WH9A 1T5HX 2Y27A 1V26A 4RMNA 2D1QA 5BSRA 1GPMA 4DR2C 4FUQA 4LF6C 4BBYA 4JI8C 4X62C 1IBLC 1N2FA 5KYVA 4JI3C 2JMPA 4D4IA 3DHVA 1IBMC 4DR4C 1KKGA 4LFCC 4JV5C 2P20A 4D4GA 2QL8A 3FCEA 5K8FA 2E8CA 2UUAC 4U5YD 4RM2A 4DUYC 4HPVA 4WV3A 3A4IA 4K0KC 5H9UA 3SO4A 1UKKA 3PROC 5A1GA 2V7BA 5JRHA 5BR8C 3H2TA 1ML8A 4FTFA 4JI0C 2PROA 1XMOC 4B3RC 5IWAC 2P2MA 1O93A 1MD9A 4OYCA 3EQ6A 2AYAA 2WP0C 2ATWA 3DAYA 2QVXX 4K0BA 1MKYA 1N36C 3A9VA 4X64C 1O9TA 1MXCA 2DYJA 2OPLB 3E7XA 2E8EA 2YWBA 2UUCC 1RY2A 3OTOC 1WF3A 3J7AD 4DCVA 3NYQA 4DCUA 4DV7C 3R9WA 4OXIA 4NDNA 4DG8A 2ONFA 5BSMA 3ETOA 2P2QA 2ASBA 4DR7C 3IEUA 2E7GA 2WD9A 2UU9C 4ISBA 4LE5A 3GKUA 1N33C 2Y4NA 1T5DX 5BSTA 4GXQA 3A9UA 1XRCA 3CJEA 4KHPC 4L7IA 2Y4OA 4FUTA 3RV2A 5K85A 4ZJZA 4AQYC 1HH2P 5T8SA 4I9FA 4GXRA 5KYTA 3IEVA 1AMUA 3TDEA 1ULTA 4DR6C 5AE3A 3S82A 4G37A 5E7QA 3I08A 3PESA 4B3SC 3JAMD 1BA3A 3GR0A 4LFBC 4DR1C 2ZM6C 2UXBC 4DV1C 2EGTA 5GTDA 2VZEA 4RM3A 4LF5C 3IMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN C;  4DV3 C;  4JI7 C;  4LF7 C;  1N34 C;  4JI6 C;  1LQL A;  2ATW A;  2UXC C;  1MKY A;  3J81 D;  1N36 C;  1QWI A;  3AF5 A;  1FJG C;  4X64 C;  1HNW C;  4BSZ A;  4LF9 C;  1ZB8 A;  4B3M C;  5FLX D;  2DYJ A;  2OPL B;  4GKK C;  2E8E A;  4X65 C;  4DV0 C;  4NXN C;  4DR3 C;  2VQE C;  1JOS A;  2UUC C;  4LF8 C;  4JI1 C;  1L2F A;  3OTO C;  1WF3 A;  3J80 D;  4YHH C;  4DCT A;  3J7A D;  4GKJ C;  4MTN A;  4DCV A;  4DCU A;  1USP B;  4DV7 C;  3R9W A;  4B3T C;  4LF4 C;  4DV2 C;  2E8F A;  5A2Q D;  1PA4 A;  4LFA C;  4DV6 C;  3I07 A;  4JYA C;  2ONF A;  5LMU C;  2CY1 A;  2ASB A;  4DR7 C;  1HNX C;  1I94 C;  2HHH C;  3IEU A;  2UUB C;  2E7G A;  3EER A;  4DV5 C;  2PN2 A;  2UU9 C;  2KZF A;  3T1H C;  3LUS A;  3GKU A;  3AF6 A;  4DR5 C;  1XMQ C;  1N33 C;  4NOZ A;  1EGA A;  1K0R A;  2XR1 A;  4JI5 C;  2OPL A;  3CJE A;  1WH9 A;  4KHP C;  4YY3 C;  4DR2 C;  1NYE A;  4LF6 C;  1HNZ C;  4DCS A;  4JI8 C;  4X62 C;  1IBL C;  4AQY C;  1HH2 P;  1ZB9 A;  1N2F A;  1J5E C;  1VLA A;  4JI3 C;  3R9X A;  2JMP A;  4XX2 A;  4OX9 C;  1IBM C;  2PT7 G;  4DR4 C;  4DV4 C;  1N32 C;  1KKG A;  4JI2 C;  3IEV A;  4LFC C;  4JV5 C;  4NXM C;  2HJG A;  1USP A;  4X66 C;  2QL8 A;  2F4V C;  2E8C A;  4DR6 C;  2YCB A;  2UUA C;  1XNR C;  4B3S C;  3JAM D;  4DUY C;  2VQF C;  1IBK C;  5IT9 D;  4MH4 A;  4JI4 C;  4DR1 C;  4LFB C;  4K0K C;  2CXC A;  2ZM6 C;  1UKK A;  4DUZ C;  3T1Y C;  2UXB C;  5BR8 C;  4DV1 C;  1XNQ C;  1ML8 A;  2E5L C;  4JI0 C;  2D7V A;  2EGT A;  2BJO A;  2UXD C;  1XMO C;  1HR0 C;  4B3R C;  5IWA C;  4LF5 C; 
#chains in the Genus database with same CATH topology
 4RVN A;  5A1I A;  4LF7 C;  5A19 A;  2D1S A;  3FCC A;  3J81 D;  3UX3 A;  1QWI A;  3A25 A;  4BSZ A;  4LF9 C;  1PG4 A;  3TR3 A;  4GKK C;  5CZX A;  4DV0 C;  2DPL A;  2VQE C;  1JOS A;  4KTT A;  2P2B A;  4R0M A;  1V60 A;  2QVZ X;  3G7S A;  4RVO A;  1USP B;  3N2Q A;  4G1I A;  4LF4 C;  2D1R A;  4DV2 C;  2E8F A;  1LCI A;  5A2Q D;  4PHT A;  2HHH C;  1RG9 A;  5DV9 A;  5BSU A;  3AF6 A;  1XMQ C;  4BC7 A;  3E7W A;  1EGA A;  1K0R A;  3NYR A;  2OPL A;  3VNS A;  3LNV A;  1NYE A;  4DCS A;  5IFI A;  3LAX A;  1ZB9 A;  3GPC A;  4JM1 A;  3GR1 A;  4L2Z A;  1TH5 A;  5AE2 A;  2PT7 G;  4DV4 C;  1N32 C;  3AY0 A;  4JI2 C;  3CW8 X;  1YJ7 A;  1USP A;  4X66 C;  2DHM A;  2F4V C;  1XNR C;  2ZTB A;  2VQF C;  4MH4 A;  4JI4 C;  1V25 A;  4BC9 A;  3UOW A;  3UX2 A;  4DUZ C;  2QVY X;  4IZ6 A;  1XNQ C;  3R44 A;  2D7V A;  4RLQ A;  2BJO A;  2UXD C;  2P2F A;  4IR7 A;  5BSV A;  2PG1 E;  5LMN C;  4DV3 C;  4D57 A;  1N34 C;  4JI6 C;  1LQL A;  1MDF A;  5BUR A;  2UXC C;  3AF5 A;  1M6X A;  4TPS B;  1YGT A;  5FLX D;  3RG2 A;  4X65 C;  2QW0 X;  4NXN C;  4DR3 C;  4RLF A;  4LF8 C;  1XRB A;  4PZP A;  4PRO C;  3J80 D;  4YHH C;  4DCT A;  1UWD A;  4MTN A;  1XRA A;  2BH1 X;  4B3T C;  4R1M A;  1PA4 A;  4LFA C;  4DV6 C;  4ODJ A;  4JYA C;  5LMU C;  2CY1 A;  3K6R A;  1HNX C;  3DLP X;  4ZLP A;  3EER A;  2OO4 A;  2PN2 A;  5BUS A;  3CQ2 A;  2Z51 A;  4NOZ A;  1IB8 A;  3PBK A;  2XR1 A;  3L8C A;  3VNR A;  4L4Q A;  4YY3 C;  4G36 A;  2KZ0 A;  1HNZ C;  1MDB A;  3NI2 A;  1J5E C;  1VLA A;  2JNV A;  2MM9 A;  3R9X A;  4XX2 A;  4OX9 C;  2D28 C;  4WS9 A;  3UZ0 A;  2VSQ A;  2P2J A;  3KXW A;  4NXM C;  1O92 A;  2HJG A;  1QM4 A;  2NCL A;  1FLO A;  2YCB A;  4GS5 A;  5CZV A;  3NPD A;  3ETC A;  4PUG A;  1IBK C;  5IT9 D;  2CXC A;  4PUI A;  3T1Y C;  3TQI A;  2E5L C;  4R1L A;  2D27 A;  5AE1 A;  1HR0 C;  3TUF A;  1XDX A;  4JI7 C;  4D56 A;  2E0G A;  1MXB A;  3CW9 A;  3LGX A;  3N54 B;  2CU6 A;  2D1T A;  1FJG C;  4DG9 A;  5ADZ A;  1HNW C;  1VEH A;  1ZB8 A;  5BSW A;  1O90 A;  2YX1 A;  3IPL A;  5BUQ A;  4B3M C;  5KEI A;  1FUG A;  4PUH A;  4JI1 C;  1L2F A;  2OBV A;  1P7L A;  4GKJ C;  4KTV A;  2MMA B;  1PG3 A;  3C5E A;  1MXA A;  3I07 A;  4BCA A;  4EAT A;  1I94 C;  2UUB C;  2YWC A;  3L95 X;  4DV5 C;  3B7W A;  4I9G A;  2KZF A;  3CQ3 A;  3T1H C;  5T8T A;  3LUS A;  4DR5 C;  3CQ1 A;  3VNQ A;  2P02 A;  4JI5 C;  1WH9 A;  1T5H X;  2Y27 A;  1V26 A;  4RMN A;  2D1Q A;  5BSR A;  1GPM A;  4DR2 C;  1P4E C;  2ZZN A;  4FUQ A;  4LF6 C;  4BBY A;  3UEB A;  4JI8 C;  4X62 C;  1IBL C;  1N2F A;  5KYV A;  4JI3 C;  2JMP A;  4D4I A;  3DHV A;  1IBM C;  4DR4 C;  1KKG A;  4LFC C;  4JV5 C;  2P20 A;  4D4G A;  2M5O A;  2QL8 A;  3FCE A;  5K8F A;  2E8C A;  2UUA C;  4U5Y D;  2ZZM A;  4RM2 A;  4DUY C;  4HPV A;  4WV3 A;  3A4I A;  4K0K C;  5H9U A;  3SO4 A;  1UKK A;  3PRO C;  5A1G A;  2V7B A;  5JRH A;  5BR8 C;  3H2T A;  1ML8 A;  2M5H A;  4FTF A;  4JI0 C;  1M6X C;  2PRO A;  1XMO C;  4B3R C;  5IWA C;  2P2M A;  1PU1 A;  1O93 A;  1MD9 A;  4OYC A;  3EQ6 A;  2AYA A;  2WP0 C;  2ATW A;  3DAY A;  2QVX X;  4K0B A;  3O2E A;  1MKY A;  1N36 C;  3A9V A;  4X64 C;  1O9T A;  1MXC A;  2DYJ A;  2OPL B;  3E7X A;  2E8E A;  2YWB A;  1P4E A;  2UUC C;  1RY2 A;  1XHJ A;  3OTO C;  1WF3 A;  3J7A D;  4DCV A;  3NYQ A;  5LCI A;  4DCU A;  4DV7 C;  3R9W A;  4OXI A;  4NDN A;  4DG8 A;  2ONF A;  5BSM A;  3ETO A;  2P2Q A;  2ASB A;  4DR7 C;  3IEU A;  2E7G A;  2WD9 A;  2UU9 C;  4ISB A;  4LE5 A;  3GKU A;  1N33 C;  2Y4N A;  1T5D X;  5BST A;  4GXQ A;  3A9U A;  1XRC A;  3CJE A;  4KHP C;  4L7I A;  2Y4O A;  4FUT A;  3RV2 A;  5K85 A;  4ZJZ A;  4AQY C;  1HH2 P;  5T8S A;  4I9F A;  4GXR A;  3A26 A;  5KYT A;  3IEV A;  1AMU A;  1WCJ A;  2KDN A;  3TDE A;  1ULT A;  4DR6 C;  5AE3 A;  3S82 A;  4G37 A;  5E7Q A;  3I08 A;  1NY8 A;  3PES A;  3JAM D;  1BA3 A;  4B3S C;  3GR0 A;  1XS3 A;  3FM7 A;  4LFB C;  4DR1 C;  2ZM6 C;  2UXB C;  4DV1 C;  2MCQ A;  2EGT A;  5GTD A;  2VZE A;  4RM3 A;  4LF5 C;  3LNO A;  3IML A; 
#chains in the Genus database with same CATH homology
 4RVN A;  5A1I A;  4LF7 C;  5A19 A;  2D1S A;  3FCC A;  3J81 D;  1QWI A;  4BSZ A;  4LF9 C;  1PG4 A;  4GKK C;  5CZX A;  4DV0 C;  2DPL A;  2VQE C;  1JOS A;  4KTT A;  2P2B A;  4R0M A;  2QVZ X;  3G7S A;  4RVO A;  1USP B;  3N2Q A;  4G1I A;  4LF4 C;  2D1R A;  4DV2 C;  2E8F A;  1LCI A;  5A2Q D;  4PHT A;  2HHH C;  1RG9 A;  5DV9 A;  5BSU A;  3AF6 A;  1XMQ C;  4BC7 A;  3E7W A;  1EGA A;  1K0R A;  3NYR A;  2OPL A;  3VNS A;  3LNV A;  1NYE A;  4DCS A;  5IFI A;  3LAX A;  1ZB9 A;  3GPC A;  4JM1 A;  3GR1 A;  4L2Z A;  5AE2 A;  2PT7 G;  4DV4 C;  1N32 C;  4JI2 C;  3CW8 X;  1YJ7 A;  1USP A;  4X66 C;  2F4V C;  1XNR C;  2VQF C;  4MH4 A;  4JI4 C;  1V25 A;  4BC9 A;  3UOW A;  4DUZ C;  2QVY X;  4IZ6 A;  1XNQ C;  3R44 A;  2D7V A;  4RLQ A;  2BJO A;  2UXD C;  2P2F A;  4IR7 A;  5BSV A;  5LMN C;  4DV3 C;  4D57 A;  1N34 C;  4JI6 C;  1LQL A;  1MDF A;  5BUR A;  2UXC C;  3AF5 A;  4TPS B;  5FLX D;  3RG2 A;  4X65 C;  2QW0 X;  4NXN C;  4DR3 C;  4RLF A;  4LF8 C;  1XRB A;  4PZP A;  4PRO C;  3J80 D;  4YHH C;  4DCT A;  4MTN A;  1XRA A;  2BH1 X;  4B3T C;  4R1M A;  1PA4 A;  4LFA C;  4DV6 C;  4ODJ A;  4JYA C;  5LMU C;  2CY1 A;  1HNX C;  3DLP X;  4ZLP A;  3EER A;  2OO4 A;  2PN2 A;  5BUS A;  4NOZ A;  3PBK A;  2XR1 A;  3L8C A;  3VNR A;  4L4Q A;  4YY3 C;  4G36 A;  1HNZ C;  1MDB A;  3NI2 A;  1J5E C;  1VLA A;  3R9X A;  4XX2 A;  4OX9 C;  2D28 C;  4WS9 A;  3UZ0 A;  2VSQ A;  2P2J A;  3KXW A;  4NXM C;  1O92 A;  2HJG A;  1QM4 A;  2YCB A;  4GS5 A;  5CZV A;  3NPD A;  3ETC A;  1IBK C;  5IT9 D;  2CXC A;  3T1Y C;  3TQI A;  2E5L C;  4R1L A;  2D27 A;  5AE1 A;  1HR0 C;  3TUF A;  4JI7 C;  4D56 A;  2E0G A;  1MXB A;  3CW9 A;  3LGX A;  3N54 B;  2D1T A;  1FJG C;  4DG9 A;  5ADZ A;  1HNW C;  1ZB8 A;  5BSW A;  1O90 A;  3IPL A;  5BUQ A;  4B3M C;  5KEI A;  1FUG A;  4JI1 C;  1L2F A;  2OBV A;  1P7L A;  4GKJ C;  4KTV A;  1PG3 A;  3C5E A;  1MXA A;  3I07 A;  4BCA A;  4EAT A;  1I94 C;  2UUB C;  2YWC A;  3L95 X;  4DV5 C;  3B7W A;  4I9G A;  2KZF A;  3T1H C;  5T8T A;  3LUS A;  4DR5 C;  3VNQ A;  2P02 A;  4JI5 C;  1WH9 A;  1T5H X;  2Y27 A;  1V26 A;  4RMN A;  2D1Q A;  5BSR A;  1GPM A;  4DR2 C;  4FUQ A;  4LF6 C;  4BBY A;  4JI8 C;  4X62 C;  1IBL C;  1N2F A;  5KYV A;  4JI3 C;  2JMP A;  4D4I A;  3DHV A;  1IBM C;  4DR4 C;  1KKG A;  4LFC C;  4JV5 C;  2P20 A;  4D4G A;  2QL8 A;  3FCE A;  5K8F A;  2E8C A;  2UUA C;  4U5Y D;  4RM2 A;  4DUY C;  4HPV A;  4WV3 A;  3A4I A;  4K0K C;  5H9U A;  3SO4 A;  1UKK A;  3PRO C;  5A1G A;  2V7B A;  5JRH A;  5BR8 C;  3H2T A;  1ML8 A;  4FTF A;  4JI0 C;  2PRO A;  1XMO C;  4B3R C;  5IWA C;  2P2M A;  1O93 A;  1MD9 A;  4OYC A;  3EQ6 A;  2AYA A;  2WP0 C;  2ATW A;  3DAY A;  2QVX X;  4K0B A;  1MKY A;  1N36 C;  3A9V A;  4X64 C;  1O9T A;  1MXC A;  2DYJ A;  2OPL B;  3E7X A;  2E8E A;  2YWB A;  2UUC C;  1RY2 A;  3OTO C;  1WF3 A;  3J7A D;  4DCV A;  3NYQ A;  4DCU A;  4DV7 C;  3R9W A;  4OXI A;  4NDN A;  4DG8 A;  2ONF A;  5BSM A;  3ETO A;  2P2Q A;  2ASB A;  4DR7 C;  3IEU A;  2E7G A;  2WD9 A;  2UU9 C;  4ISB A;  4LE5 A;  3GKU A;  1N33 C;  2Y4N A;  1T5D X;  5BST A;  4GXQ A;  3A9U A;  1XRC A;  3CJE A;  4KHP C;  4L7I A;  2Y4O A;  4FUT A;  3RV2 A;  5K85 A;  4ZJZ A;  4AQY C;  1HH2 P;  5T8S A;  4I9F A;  4GXR A;  5KYT A;  3IEV A;  1AMU A;  3TDE A;  1ULT A;  4DR6 C;  5AE3 A;  3S82 A;  4G37 A;  5E7Q A;  3I08 A;  3PES A;  4B3S C;  3JAM D;  1BA3 A;  3GR0 A;  4LFB C;  4DR1 C;  2ZM6 C;  2UXB C;  4DV1 C;  2EGT A;  5GTD A;  2VZE A;  4RM3 A;  4LF5 C;  3IML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...