4DR3C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 45
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr3C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr3C02
2BJOA 1ZB9A 3T1HC 1XNQC 2PT7G 2ASBA 4AQYC 4YY3C 4KHPC 4JV5C 4NOZA 5FLXD 4DCTA 4OX9C 3JAMD 2VQFC 1UKKA 2DYJA 1EGAA 2CY1A 4YHHC 1HNWC 4X62C 4JI3C 4LFAC 3J7AD 3GKUA 4MH4A 4LF9C 4JI7C 1XNRC 1HNXC 4DV4C 4DR1C 1N32C 2HHHC 2JMPA 4B3MC 4DR2C 2E8FA 4XX2A 1L2FA 2E8CA 5IWAC 4DR3C 1LQLA 2D7VA 3J81D 1J5EC 5LMNC 1MKYA 1ZB8A 2ZM6C 2EGTA 1USPA 4DV0C 1WH9A 2UUBC 4B3TC 2CXCA 1XMQC 1K0RA 5A2QD 4JI0C 2YCBA 4LF8C 4LF4C 4K0KC 4NXMC 4JYAC 3IEVA 2OPLB 4NXNC 4DR4C 4DV6C 3EERA 4JI8C 1I94C 3J80D 3IEUA 4MTNA 4X65C 4LF7C 4GKKC 2UXDC 1XMOC 5LMUC 4B3RC 1ML8A 3CJEA 4B3SC 2E5LC 2VQEC 5IT9D 1JOSA 4LF6C 4DV2C 1N33C 1HR0C 3R9XA 1N2FA 2ATWA 2XR1A 2QL8A 1IBLC 4BSZA 3I07A 4DUZC 2F4VC 4JI1C 4DR5C 2PN2A 2ONFA 2E7GA 1PA4A 2KZFA 4JI4C 3OTOC 4DV3C 3LUSA 2OPLA 4DV1C 1WF3A 1N34C 1IBKC 4LFCC 2UUAC 1FJGC 2UXBC 4DR7C 4DR6C 4JI2C 4JI6C 1NYEA 4LF5C 2UXCC 1KKGA 2E8EA 3R9WA 4X64C 2UU9C 4GKJC 1N36C 1QWIA 1HH2P 4DCUA 1IBMC 3T1YC 4JI5C 5BR8C 4LFBC 4DCVA 4DV5C 1HNZC 1USPB 4X66C 2UUCC 3AF6A 4DV7C 4DCSA 2HJGA 3AF5A 4DUYC 1VLAA
chains in the Genus database with same CATH superfamily
2BJOA 2PG1E 4D56A 2MMAB 3R44A 4IR7A 2QW0X 3JAMD 1HNWC 3VNSA 4YHHC 5BSWA 2D1SA 3J7AD 3N2QA 4DV4C 1YGTA 2HHHC 4DR2C 3B7WA 2P2JA 2E8CA 1QM4A 2YWCA 1LQLA 2D7VA 2QVXX 1J5EC 2OBVA 1MKYA 4G37A 2EGTA 1WH9A 2UUBC 5AE3A 3EQ6A 4LF8C 4LF4C 2CU6A 3ETOA 3E7XA 4RLFA 1FUGA 5LMUC 1MD9A 1LCIA 4DG9A 4NDNA 3TR3A 3R9XA 1N2FA 3I08A 2P2MA 1IBLC 2V7BA 4BSZA 4ZJZA 2DHMA 5BSMA 3UX2A 4DUZC 2D28C 2PN2A 1P7LA 3GPCA 5H9UA 2ONFA 4RMNA 1PA4A 2KZFA 3DLPX 4ODJA 4PZPA 4LE5A 4JI4C 4LFCC 1WF3A 1IBKC 5AE2A 3C5EA 2NCLA 3A9UA 4DG8A 4D57A 4JI2C 1MDBA 3IMLA 1KKGA 1GPMA 5KEIA 4PUIA 2UU9C 1QWIA 4GS5A 4I9GA 3A26A 2KZ0A 4RM2A 2ZTBA 4L2ZA 1USPB 2UUCC 4DV7C 3RG2A 3NYRA 3AF5A 4DUYC 5T8TA 3T1HC 3PESA 4AQYC 4ZLPA 3GR0A 4KHPC 4WV3A 5FLXD 2WP0C 4DCTA 4OX9C 2DYJA 3H2TA 1XS3A 4LFAC 2D1TA 4LF9C 5BSTA 1N32C 2QVZX 1L2FA 5IWAC 4IZ6A 3LNVA 1PG3A 5GTDA 3J81D 3PBKA 5JRHA 1ZB8A 4G36A 1USPA 1XRCA 3RV2A 1UWDA 4G1IA 2CXCA 2Y4OA 1K0RA 3VNQA 4JI0C 3CW8X 2OPLB 3PROC 3SO4A 4NXNC 4GXQA 4JI8C 4PUGA 2Z51A 3IEUA 4X65C 3J80D 1XMOC 3L8CA 3TDEA 4B3RC 1MXCA 2Y27A 1FLOA 4B3SC 3ETCA 2BH1X 1N33C 3S82A 1RY2A 2ATWA 2OO4A 1MDFA 4DR5C 1XRBA 1PU1A 4TPSB 4D4GA 4OXIA 5A1GA 3VNRA 3G7SA 4DV3C 2OPLA 1XDXA 1V25A 1TH5A 5AE1A 4DV1C 1N34C 2UUAC 2ZZNA 1MXBA 5A1IA 4DR7C 4DR6C 4JI6C 2UXCC 2YX1A 2MM9A 4K0BA 4GKJC 5BUQA 4DCUA 1XRAA 1YJ7A 4LFBC 1WCJA 2P2QA 1HNZC 2VZEA 2HJGA 3LNOA 1O9TA 4OYCA 3E7WA 5CZVA 1XNQC 2ASBA 4BC7A 4RLQA 4JV5C 4NOZA 2WD9A 4WS9A 2VQFC 1EGAA 1O92A 1P4EC 2VSQA 5K8FA 3GKUA 4RVNA 5ADZA 5DV9A 4JI7C 1XNRC 3A9VA 4DR1C 2QVYX 2JMPA 4BC9A 4RVOA 4DR3C 1XHJA 5LMNC 4DV0C 5K85A 1XMQC 1V60A 4KTVA 4L7IA 5T8SA 5A2QD 4K0KC 5KYTA 3IEVA 5BSRA 4DV6C 4GKKC 3KXWA 4BBYA 3K6RA 3CJEA 4I9FA 2P02A 1JOSA 4LF6C 1ULTA 1T5HX 5E7QA 4JM1A 5CZXA 3I07A 4KTTA 4JI1C 4FUTA 2M5OA 4PHTA 2PROA 1AMUA 3CQ3A 3LUSA 4L4QA 3UZ0A 1NY8A 2D1QA 2D27A 4GXRA 5BUSA 2YWBA 1VEHA 2M5HA 4LF5C 1O93A 3CQ1A 2JNVA 2ZZMA 3NYQA 3GR1A 4RM3A 4R0MA 4HPVA 4DV5C 2D1RA 4X66C 3AF6A 3CW9A 1ZB9A 2PT7G 4BCAA 4R1MA 4YY3C 3O2EA 2KDNA 1T5DX 1UKKA 2CY1A 4X62C 3DHVA 4JI3C 4MH4A 3IPLA 4U5YD 3UX3A 1HNXC 2P20A 3A4IA 1V26A 4B3MC 1BA3A 3L95X 2E8FA 4XX2A 3LGXA 4R1LA 3NPDA 4FUQA 4FTFA 2ZM6C 4B3TC 3UEBA 1P4EA 4ISBA 5BURA 2YCBA 2MCQA 1IB8A 4NXMC 4JYAC 2DPLA 3FM7A 4DR4C 3EERA 4LF7C 1I94C 3TUFA 4MTNA 2UXDC 1ML8A 1MXAA 2P2FA 5KYVA 5BSVA 3LAXA 4D4IA 2E5LC 2VQEC 5IT9D 4DV2C 1HR0C 2XR1A 2QL8A 5A19A 5LCIA 3N54B 2E0GA 2F4VC 2AYAA 2Y4NA 2E7GA 3FCCA 3OTOC 3NI2A 5BSUA 3AY0A 4PUHA 5IFIA 1FJGC 4PROC 3TQIA 3FCEA 2UXBC 2P2BA 1PG4A 3DAYA 1NYEA 2E8EA 3R9WA 4X64C 1O90A 1RG9A 1N36C 1HH2P 1M6XA 1IBMC 3T1YC 4JI5C 5BR8C 3UOWA 1M6XC 4DCVA 3A25A 4DCSA 3CQ2A 4EATA 1VLAA
chains in the Genus database with same CATH topology
2BJOA 4D56A 3R44A 4IR7A 2QW0X 3JAMD 1HNWC 3VNSA 4YHHC 5BSWA 2D1SA 3J7AD 3N2QA 4DV4C 2HHHC 4DR2C 3B7WA 2P2JA 2E8CA 1QM4A 2YWCA 1LQLA 2D7VA 2QVXX 1J5EC 2OBVA 1MKYA 4G37A 2EGTA 1WH9A 2UUBC 5AE3A 3EQ6A 4LF8C 4LF4C 3ETOA 3E7XA 4RLFA 1FUGA 5LMUC 1MD9A 1LCIA 4DG9A 4NDNA 3R9XA 1N2FA 3I08A 2P2MA 1IBLC 2V7BA 4BSZA 4ZJZA 5BSMA 4DUZC 2D28C 2PN2A 1P7LA 3GPCA 5H9UA 2ONFA 4RMNA 1PA4A 2KZFA 3DLPX 4ODJA 4PZPA 4LE5A 4JI4C 4LFCC 1WF3A 1IBKC 5AE2A 3C5EA 3A9UA 4DG8A 4D57A 4JI2C 1MDBA 3IMLA 1KKGA 1GPMA 5KEIA 2UU9C 1QWIA 4GS5A 4I9GA 4RM2A 4L2ZA 1USPB 2UUCC 4DV7C 3RG2A 3NYRA 3AF5A 4DUYC 5T8TA 3T1HC 3PESA 4AQYC 4ZLPA 3GR0A 4KHPC 4WV3A 5FLXD 2WP0C 4DCTA 4OX9C 2DYJA 3H2TA 4LFAC 2D1TA 4LF9C 5BSTA 1N32C 2QVZX 1L2FA 5IWAC 3LNVA 4IZ6A 1PG3A 5GTDA 3J81D 3PBKA 5JRHA 1ZB8A 4G36A 1USPA 1XRCA 3RV2A 4G1IA 2CXCA 2Y4OA 1K0RA 3VNQA 4JI0C 3CW8X 2OPLB 3PROC 3SO4A 4NXNC 4GXQA 4JI8C 3J80D 3IEUA 4X65C 1XMOC 3L8CA 3TDEA 4B3RC 1MXCA 2Y27A 4B3SC 3ETCA 2BH1X 1N33C 3S82A 1RY2A 2ATWA 2OO4A 1MDFA 4DR5C 1XRBA 4TPSB 4D4GA 4OXIA 5A1GA 3VNRA 3G7SA 4DV3C 2OPLA 1V25A 5AE1A 4DV1C 1N34C 2UUAC 1MXBA 5A1IA 4DR7C 4DR6C 4JI6C 2UXCC 4K0BA 4GKJC 5BUQA 4DCUA 1XRAA 1YJ7A 4LFBC 2P2QA 1HNZC 2VZEA 2HJGA 1O9TA 4OYCA 3E7WA 5CZVA 1XNQC 2ASBA 4BC7A 4RLQA 4JV5C 4NOZA 2WD9A 4WS9A 2VQFC 1EGAA 1O92A 2VSQA 5K8FA 3GKUA 4RVNA 5ADZA 5DV9A 4JI7C 1XNRC 3A9VA 4DR1C 2QVYX 2JMPA 4BC9A 4RVOA 4DR3C 5LMNC 4DV0C 5K85A 1XMQC 4L7IA 4KTVA 5T8SA 5A2QD 4K0KC 5KYTA 3IEVA 5BSRA 4DV6C 4GKKC 3KXWA 4BBYA 3CJEA 4I9FA 2P02A 1JOSA 4LF6C 1ULTA 1T5HX 5E7QA 4JM1A 5CZXA 3I07A 4KTTA 4JI1C 4FUTA 4PHTA 2PROA 1AMUA 3LUSA 4L4QA 3UZ0A 2D1QA 2D27A 4GXRA 5BUSA 2YWBA 4LF5C 1O93A 3NYQA 3GR1A 4RM3A 4R0MA 4HPVA 4DV5C 2D1RA 4X66C 3AF6A 3CW9A 1ZB9A 2PT7G 4BCAA 4R1MA 4YY3C 1T5DX 1UKKA 2CY1A 4X62C 3DHVA 4JI3C 4MH4A 3IPLA 4U5YD 1HNXC 2P20A 3A4IA 1V26A 4B3MC 1BA3A 3L95X 2E8FA 4XX2A 3LGXA 4R1LA 3NPDA 4FUQA 4FTFA 2ZM6C 4B3TC 4ISBA 5BURA 2YCBA 4NXMC 4JYAC 2DPLA 4DR4C 3EERA 4LF7C 1I94C 3TUFA 4MTNA 2UXDC 1ML8A 1MXAA 2P2FA 5KYVA 5BSVA 3LAXA 4D4IA 2E5LC 2VQEC 5IT9D 4DV2C 1HR0C 2XR1A 2QL8A 5A19A 3N54B 2E0GA 2F4VC 2AYAA 2Y4NA 2E7GA 3FCCA 3OTOC 3NI2A 5BSUA 5IFIA 1FJGC 4PROC 3TQIA 3FCEA 2UXBC 2P2BA 1PG4A 3DAYA 1NYEA 2E8EA 3R9WA 4X64C 1O90A 1RG9A 1N36C 1HH2P 1IBMC 3T1YC 4JI5C 5BR8C 3UOWA 4DCVA 4DCSA 4EATA 1VLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJO A;  1ZB9 A;  3T1H C;  1XNQ C;  2PT7 G;  2ASB A;  4AQY C;  4YY3 C;  4KHP C;  4JV5 C;  4NOZ A;  5FLX D;  4DCT A;  4OX9 C;  3JAM D;  2VQF C;  1UKK A;  2DYJ A;  1EGA A;  2CY1 A;  4YHH C;  1HNW C;  4X62 C;  4JI3 C;  4LFA C;  3J7A D;  3GKU A;  4MH4 A;  4LF9 C;  4JI7 C;  1XNR C;  1HNX C;  4DV4 C;  4DR1 C;  1N32 C;  2HHH C;  2JMP A;  4B3M C;  4DR2 C;  2E8F A;  4XX2 A;  1L2F A;  2E8C A;  5IWA C;  4DR3 C;  1LQL A;  2D7V A;  3J81 D;  1J5E C;  5LMN C;  1MKY A;  1ZB8 A;  2ZM6 C;  2EGT A;  1USP A;  4DV0 C;  1WH9 A;  2UUB C;  4B3T C;  2CXC A;  1XMQ C;  1K0R A;  5A2Q D;  4JI0 C;  2YCB A;  4LF8 C;  4LF4 C;  4K0K C;  4NXM C;  4JYA C;  3IEV A;  2OPL B;  4NXN C;  4DR4 C;  4DV6 C;  3EER A;  4JI8 C;  1I94 C;  3J80 D;  3IEU A;  4MTN A;  4X65 C;  4LF7 C;  4GKK C;  2UXD C;  1XMO C;  5LMU C;  4B3R C;  1ML8 A;  3CJE A;  4B3S C;  2E5L C;  2VQE C;  5IT9 D;  1JOS A;  4LF6 C;  4DV2 C;  1N33 C;  1HR0 C;  3R9X A;  1N2F A;  2ATW A;  2XR1 A;  2QL8 A;  1IBL C;  4BSZ A;  3I07 A;  4DUZ C;  2F4V C;  4JI1 C;  4DR5 C;  2PN2 A;  2ONF A;  2E7G A;  1PA4 A;  2KZF A;  4JI4 C;  3OTO C;  4DV3 C;  3LUS A;  2OPL A;  4DV1 C;  1WF3 A;  1N34 C;  1IBK C;  4LFC C;  2UUA C;  1FJG C;  2UXB C;  4DR7 C;  4DR6 C;  4JI2 C;  4JI6 C;  1NYE A;  4LF5 C;  2UXC C;  1KKG A;  2E8E A;  3R9W A;  4X64 C;  2UU9 C;  4GKJ C;  1N36 C;  1QWI A;  1HH2 P;  4DCU A;  1IBM C;  3T1Y C;  4JI5 C;  5BR8 C;  4LFB C;  4DCV A;  4DV5 C;  1HNZ C;  1USP B;  4X66 C;  2UUC C;  3AF6 A;  4DV7 C;  4DCS A;  2HJG A;  3AF5 A;  4DUY C;  1VLA A; 
#chains in the Genus database with same CATH topology
 2BJO A;  2PG1 E;  4D56 A;  2MMA B;  3R44 A;  4IR7 A;  2QW0 X;  3JAM D;  1HNW C;  3VNS A;  4YHH C;  5BSW A;  2D1S A;  3J7A D;  3N2Q A;  4DV4 C;  1YGT A;  2HHH C;  4DR2 C;  3B7W A;  2P2J A;  2E8C A;  1QM4 A;  2YWC A;  1LQL A;  2D7V A;  2QVX X;  1J5E C;  2OBV A;  1MKY A;  4G37 A;  2EGT A;  1WH9 A;  2UUB C;  5AE3 A;  3EQ6 A;  4LF8 C;  4LF4 C;  2CU6 A;  3ETO A;  3E7X A;  4RLF A;  1FUG A;  5LMU C;  1MD9 A;  1LCI A;  4DG9 A;  4NDN A;  3TR3 A;  3R9X A;  1N2F A;  3I08 A;  2P2M A;  1IBL C;  2V7B A;  4BSZ A;  4ZJZ A;  2DHM A;  5BSM A;  3UX2 A;  4DUZ C;  2D28 C;  2PN2 A;  1P7L A;  3GPC A;  5H9U A;  2ONF A;  4RMN A;  1PA4 A;  2KZF A;  3DLP X;  4ODJ A;  4PZP A;  4LE5 A;  4JI4 C;  4LFC C;  1WF3 A;  1IBK C;  5AE2 A;  3C5E A;  2NCL A;  3A9U A;  4DG8 A;  4D57 A;  4JI2 C;  1MDB A;  3IML A;  1KKG A;  1GPM A;  5KEI A;  4PUI A;  2UU9 C;  1QWI A;  4GS5 A;  4I9G A;  3A26 A;  2KZ0 A;  4RM2 A;  2ZTB A;  4L2Z A;  1USP B;  2UUC C;  4DV7 C;  3RG2 A;  3NYR A;  3AF5 A;  4DUY C;  5T8T A;  3T1H C;  3PES A;  4AQY C;  4ZLP A;  3GR0 A;  4KHP C;  4WV3 A;  5FLX D;  2WP0 C;  4DCT A;  4OX9 C;  2DYJ A;  3H2T A;  1XS3 A;  4LFA C;  2D1T A;  4LF9 C;  5BST A;  1N32 C;  2QVZ X;  1L2F A;  5IWA C;  4IZ6 A;  3LNV A;  1PG3 A;  5GTD A;  3J81 D;  3PBK A;  5JRH A;  1ZB8 A;  4G36 A;  1USP A;  1XRC A;  3RV2 A;  1UWD A;  4G1I A;  2CXC A;  2Y4O A;  1K0R A;  3VNQ A;  4JI0 C;  3CW8 X;  2OPL B;  3PRO C;  3SO4 A;  4NXN C;  4GXQ A;  4JI8 C;  4PUG A;  2Z51 A;  3IEU A;  4X65 C;  3J80 D;  1XMO C;  3L8C A;  3TDE A;  4B3R C;  1MXC A;  2Y27 A;  1FLO A;  4B3S C;  3ETC A;  2BH1 X;  1N33 C;  3S82 A;  1RY2 A;  2ATW A;  2OO4 A;  1MDF A;  4DR5 C;  1XRB A;  1PU1 A;  4TPS B;  4D4G A;  4OXI A;  5A1G A;  3VNR A;  3G7S A;  4DV3 C;  2OPL A;  1XDX A;  1V25 A;  1TH5 A;  5AE1 A;  4DV1 C;  1N34 C;  2UUA C;  2ZZN A;  1MXB A;  5A1I A;  4DR7 C;  4DR6 C;  4JI6 C;  2UXC C;  2YX1 A;  2MM9 A;  4K0B A;  4GKJ C;  5BUQ A;  4DCU A;  1XRA A;  1YJ7 A;  4LFB C;  1WCJ A;  2P2Q A;  1HNZ C;  2VZE A;  2HJG A;  3LNO A;  1O9T A;  4OYC A;  3E7W A;  5CZV A;  1XNQ C;  2ASB A;  4BC7 A;  4RLQ A;  4JV5 C;  4NOZ A;  2WD9 A;  4WS9 A;  2VQF C;  1EGA A;  1O92 A;  1P4E C;  2VSQ A;  5K8F A;  3GKU A;  4RVN A;  5ADZ A;  5DV9 A;  4JI7 C;  1XNR C;  3A9V A;  4DR1 C;  2QVY X;  2JMP A;  4BC9 A;  4RVO A;  4DR3 C;  1XHJ A;  5LMN C;  4DV0 C;  5K85 A;  1XMQ C;  1V60 A;  4KTV A;  4L7I A;  5T8S A;  5A2Q D;  4K0K C;  5KYT A;  3IEV A;  5BSR A;  4DV6 C;  4GKK C;  3KXW A;  4BBY A;  3K6R A;  3CJE A;  4I9F A;  2P02 A;  1JOS A;  4LF6 C;  1ULT A;  1T5H X;  5E7Q A;  4JM1 A;  5CZX A;  3I07 A;  4KTT A;  4JI1 C;  4FUT A;  2M5O A;  4PHT A;  2PRO A;  1AMU A;  3CQ3 A;  3LUS A;  4L4Q A;  3UZ0 A;  1NY8 A;  2D1Q A;  2D27 A;  4GXR A;  5BUS A;  2YWB A;  1VEH A;  2M5H A;  4LF5 C;  1O93 A;  3CQ1 A;  2JNV A;  2ZZM A;  3NYQ A;  3GR1 A;  4RM3 A;  4R0M A;  4HPV A;  4DV5 C;  2D1R A;  4X66 C;  3AF6 A;  3CW9 A;  1ZB9 A;  2PT7 G;  4BCA A;  4R1M A;  4YY3 C;  3O2E A;  2KDN A;  1T5D X;  1UKK A;  2CY1 A;  4X62 C;  3DHV A;  4JI3 C;  4MH4 A;  3IPL A;  4U5Y D;  3UX3 A;  1HNX C;  2P20 A;  3A4I A;  1V26 A;  4B3M C;  1BA3 A;  3L95 X;  2E8F A;  4XX2 A;  3LGX A;  4R1L A;  3NPD A;  4FUQ A;  4FTF A;  2ZM6 C;  4B3T C;  3UEB A;  1P4E A;  4ISB A;  5BUR A;  2YCB A;  2MCQ A;  1IB8 A;  4NXM C;  4JYA C;  2DPL A;  3FM7 A;  4DR4 C;  3EER A;  4LF7 C;  1I94 C;  3TUF A;  4MTN A;  2UXD C;  1ML8 A;  1MXA A;  2P2F A;  5KYV A;  5BSV A;  3LAX A;  4D4I A;  2E5L C;  2VQE C;  5IT9 D;  4DV2 C;  1HR0 C;  2XR1 A;  2QL8 A;  5A19 A;  5LCI A;  3N54 B;  2E0G A;  2F4V C;  2AYA A;  2Y4N A;  2E7G A;  3FCC A;  3OTO C;  3NI2 A;  5BSU A;  3AY0 A;  4PUH A;  5IFI A;  1FJG C;  4PRO C;  3TQI A;  3FCE A;  2UXB C;  2P2B A;  1PG4 A;  3DAY A;  1NYE A;  2E8E A;  3R9W A;  4X64 C;  1O90 A;  1RG9 A;  1N36 C;  1HH2 P;  1M6X A;  1IBM C;  3T1Y C;  4JI5 C;  5BR8 C;  3UOW A;  1M6X C;  4DCV A;  3A25 A;  4DCS A;  3CQ2 A;  4EAT A;  1VLA A; 
#chains in the Genus database with same CATH homology
 2BJO A;  4D56 A;  3R44 A;  4IR7 A;  2QW0 X;  3JAM D;  1HNW C;  3VNS A;  4YHH C;  5BSW A;  2D1S A;  3J7A D;  3N2Q A;  4DV4 C;  2HHH C;  4DR2 C;  3B7W A;  2P2J A;  2E8C A;  1QM4 A;  2YWC A;  1LQL A;  2D7V A;  2QVX X;  1J5E C;  2OBV A;  1MKY A;  4G37 A;  2EGT A;  1WH9 A;  2UUB C;  5AE3 A;  3EQ6 A;  4LF8 C;  4LF4 C;  3ETO A;  3E7X A;  4RLF A;  1FUG A;  5LMU C;  1MD9 A;  1LCI A;  4DG9 A;  4NDN A;  3R9X A;  1N2F A;  3I08 A;  2P2M A;  1IBL C;  2V7B A;  4BSZ A;  4ZJZ A;  5BSM A;  4DUZ C;  2D28 C;  2PN2 A;  1P7L A;  3GPC A;  5H9U A;  2ONF A;  4RMN A;  1PA4 A;  2KZF A;  3DLP X;  4ODJ A;  4PZP A;  4LE5 A;  4JI4 C;  4LFC C;  1WF3 A;  1IBK C;  5AE2 A;  3C5E A;  3A9U A;  4DG8 A;  4D57 A;  4JI2 C;  1MDB A;  3IML A;  1KKG A;  1GPM A;  5KEI A;  2UU9 C;  1QWI A;  4GS5 A;  4I9G A;  4RM2 A;  4L2Z A;  1USP B;  2UUC C;  4DV7 C;  3RG2 A;  3NYR A;  3AF5 A;  4DUY C;  5T8T A;  3T1H C;  3PES A;  4AQY C;  4ZLP A;  3GR0 A;  4KHP C;  4WV3 A;  5FLX D;  2WP0 C;  4DCT A;  4OX9 C;  2DYJ A;  3H2T A;  4LFA C;  2D1T A;  4LF9 C;  5BST A;  1N32 C;  2QVZ X;  1L2F A;  5IWA C;  3LNV A;  4IZ6 A;  1PG3 A;  5GTD A;  3J81 D;  3PBK A;  5JRH A;  1ZB8 A;  4G36 A;  1USP A;  1XRC A;  3RV2 A;  4G1I A;  2CXC A;  2Y4O A;  1K0R A;  3VNQ A;  4JI0 C;  3CW8 X;  2OPL B;  3PRO C;  3SO4 A;  4NXN C;  4GXQ A;  4JI8 C;  3J80 D;  3IEU A;  4X65 C;  1XMO C;  3L8C A;  3TDE A;  4B3R C;  1MXC A;  2Y27 A;  4B3S C;  3ETC A;  2BH1 X;  1N33 C;  3S82 A;  1RY2 A;  2ATW A;  2OO4 A;  1MDF A;  4DR5 C;  1XRB A;  4TPS B;  4D4G A;  4OXI A;  5A1G A;  3VNR A;  3G7S A;  4DV3 C;  2OPL A;  1V25 A;  5AE1 A;  4DV1 C;  1N34 C;  2UUA C;  1MXB A;  5A1I A;  4DR7 C;  4DR6 C;  4JI6 C;  2UXC C;  4K0B A;  4GKJ C;  5BUQ A;  4DCU A;  1XRA A;  1YJ7 A;  4LFB C;  2P2Q A;  1HNZ C;  2VZE A;  2HJG A;  1O9T A;  4OYC A;  3E7W A;  5CZV A;  1XNQ C;  2ASB A;  4BC7 A;  4RLQ A;  4JV5 C;  4NOZ A;  2WD9 A;  4WS9 A;  2VQF C;  1EGA A;  1O92 A;  2VSQ A;  5K8F A;  3GKU A;  4RVN A;  5ADZ A;  5DV9 A;  4JI7 C;  1XNR C;  3A9V A;  4DR1 C;  2QVY X;  2JMP A;  4BC9 A;  4RVO A;  4DR3 C;  5LMN C;  4DV0 C;  5K85 A;  1XMQ C;  4L7I A;  4KTV A;  5T8S A;  5A2Q D;  4K0K C;  5KYT A;  3IEV A;  5BSR A;  4DV6 C;  4GKK C;  3KXW A;  4BBY A;  3CJE A;  4I9F A;  2P02 A;  1JOS A;  4LF6 C;  1ULT A;  1T5H X;  5E7Q A;  4JM1 A;  5CZX A;  3I07 A;  4KTT A;  4JI1 C;  4FUT A;  4PHT A;  2PRO A;  1AMU A;  3LUS A;  4L4Q A;  3UZ0 A;  2D1Q A;  2D27 A;  4GXR A;  5BUS A;  2YWB A;  4LF5 C;  1O93 A;  3NYQ A;  3GR1 A;  4RM3 A;  4R0M A;  4HPV A;  4DV5 C;  2D1R A;  4X66 C;  3AF6 A;  3CW9 A;  1ZB9 A;  2PT7 G;  4BCA A;  4R1M A;  4YY3 C;  1T5D X;  1UKK A;  2CY1 A;  4X62 C;  3DHV A;  4JI3 C;  4MH4 A;  3IPL A;  4U5Y D;  1HNX C;  2P20 A;  3A4I A;  1V26 A;  4B3M C;  1BA3 A;  3L95 X;  2E8F A;  4XX2 A;  3LGX A;  4R1L A;  3NPD A;  4FUQ A;  4FTF A;  2ZM6 C;  4B3T C;  4ISB A;  5BUR A;  2YCB A;  4NXM C;  4JYA C;  2DPL A;  4DR4 C;  3EER A;  4LF7 C;  1I94 C;  3TUF A;  4MTN A;  2UXD C;  1ML8 A;  1MXA A;  2P2F A;  5KYV A;  5BSV A;  3LAX A;  4D4I A;  2E5L C;  2VQE C;  5IT9 D;  4DV2 C;  1HR0 C;  2XR1 A;  2QL8 A;  5A19 A;  3N54 B;  2E0G A;  2F4V C;  2AYA A;  2Y4N A;  2E7G A;  3FCC A;  3OTO C;  3NI2 A;  5BSU A;  5IFI A;  1FJG C;  4PRO C;  3TQI A;  3FCE A;  2UXB C;  2P2B A;  1PG4 A;  3DAY A;  1NYE A;  2E8E A;  3R9W A;  4X64 C;  1O90 A;  1RG9 A;  1N36 C;  1HH2 P;  1IBM C;  3T1Y C;  4JI5 C;  5BR8 C;  3UOW A;  4DCV A;  4DCS A;  4EAT A;  1VLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...