3OTOC

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
total genus 41
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3otoC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3otoC02
3I07A 4JYAC 4B3MC 4NOZA 2XR1A 1WF3A 1J5EC 4DV2C 1EGAA 1ML8A 1UKKA 3AF5A 4DCTA 1N2FA 3T1HC 2EGTA 4LF9C 1VLAA 1WH9A 1N33C 4NXMC 2E7GA 4OX9C 2UU9C 4AQYC 1XNQC 2JMPA 1HH2P 2PN2A 1IBKC 4DR7C 4DUYC 1L2FA 5A2QD 4DV6C 2DYJA 3CJEA 4JI2C 4X62C 2UUAC 4GKKC 1USPB 4K0KC 1QWIA 2PT7G 3IEUA 2CY1A 2OPLB 5BR8C 3J80D 1HR0C 2D7VA 4LF6C 4JI6C 1JOSA 4X65C 4DR5C 4YHHC 4YY3C 4JI8C 4KHPC 3GKUA 2ASBA 2HHHC 4LFAC 2ATWA 4MTNA 3J7AD 4X64C 2QL8A 3JAMD 2UXDC 5LMUC 4DV5C 2UXCC 3T1YC 4DV0C 2BJOA 4DCVA 2UXBC 3J81D 2HJGA 1NYEA 4DR1C 4DV7C 1IBMC 2E8CA 1HNZC 4XX2A 4JV5C 1K0RA 1HNWC 4DUZC 2CXCA 1ZB8A 1N36C 4LF4C 5LMNC 2E5LC 2UUCC 4JI5C 1KKGA 1LQLA 2ZM6C 1XMQC 4JI1C 3AF6A 1PA4A 2E8FA 3EERA 4NXNC 3IEVA 4MH4A 4LFCC 3R9XA 1HNXC 1XMOC 5FLXD 1IBLC 4BSZA 1XNRC 1N32C 3LUSA 3OTOC 4JI0C 2E8EA 1MKYA 4B3RC 4JI7C 4GKJC 2UUBC 4B3TC 4DV3C 2YCBA 5IWAC 4DR3C 4JI3C 4LF7C 4LF8C 4B3SC 1FJGC 2F4VC 4DCSA 2VQFC 4DCUA 5IT9D 4DV1C 4LF5C 3R9WA 4JI4C 4DR2C 4LFBC 1ZB9A 2KZFA 4DR6C 1USPA 2ONFA 1N34C 4DR4C 4X66C 2VQEC 2OPLA 4DV4C 1I94C
chains in the Genus database with same CATH superfamily
2D1TA 2P20A 4B3MC 1J5EC 3B7WA 1IB8A 4DCTA 4KTTA 4G1IA 3E7WA 2E7GA 3E7XA 5LCIA 4OX9C 4LE5A 4I9FA 2JMPA 1HH2P 2PN2A 2DYJA 3CJEA 3IPLA 4FTFA 1BA3A 4JI2C 2Y4NA 3NYRA 4K0KC 2PT7G 3R44A 5KEIA 5BR8C 4TPSB 3LNVA 5AE1A 5KYVA 2PROA 4LFAC 3UX3A 1UWDA 4MTNA 3J7AD 1LCIA 4G36A 2UXDC 5A1IA 2UXCC 4DV0C 2BJOA 4OXIA 2ZZNA 4JM1A 3FCEA 5H9UA 3RV2A 3J81D 1GPMA 2HJGA 1IBMC 1T5DX 3LNOA 2D1RA 4JV5C 1K0RA 1P7LA 1MDBA 2E5LC 4RM3A 4D4GA 2OBVA 4PHTA 2DPLA 1P4EC 3EERA 3KXWA 3IEVA 4BCAA 4RLFA 2D28C 2Y27A 5FLXD 1N32C 2Y4OA 5CZVA 3I08A 2KDNA 5BSRA 2CU6A 2MCQA 1MKYA 4B3RC 5BSWA 4JI7C 3GR0A 1FLOA 4GKJC 2UUBC 3N54B 5IWAC 3DAYA 3ETCA 4DR3C 4JI3C 4PUHA 2F4VC 4DCSA 4LFBC 2JNVA 3FCCA 2ONFA 4L4QA 4X66C 1I94C 1M6XC 4JYAC 2XR1A 1WF3A 4FUTA 1O90A 4DV2C 2WP0C 1O9TA 1UKKA 2EGTA 3GR1A 1FUGA 2AYAA 1WH9A 3LGXA 4AQYC 1XNQC 1XHJA 4DUYC 1L2FA 5A2QD 4DV6C 4R1MA 4IZ6A 2ZZMA 4X62C 4RVNA 1MD9A 4IR7A 2ZTBA 3J80D 4D56A 1RY2A 2D7VA 1HR0C 4LF6C 1MXBA 3NYQA 4X65C 4KHPC 2ASBA 1AMUA 4I9GA 5A19A 1O93A 4RM2A 4X64C 2QL8A 3JAMD 1O92A 5LMUC 4DV5C 4OYCA 3T1YC 4D4IA 2NCLA 1XDXA 1PU1A 1NYEA 4DR1C 4DV7C 2KZ0A 2E8CA 3G7SA 4ISBA 1N36C 4LF4C 5LMNC 3CW8X 4JI5C 2ZM6C 1WCJA 1XMQC 4JI1C 1PA4A 4DG8A 5AE3A 1HNXC 3DLPX 2M5OA 1IBLC 4PZPA 5BURA 3IMLA 1RG9A 4R1LA 3UEBA 5CZXA 1V25A 3NPDA 1PG4A 4LF8C 5IT9D 4DV1C 4JI4C 4D57A 3CQ3A 1ZB9A 1USPA 4RVOA 3EQ6A 2VQEC 2OPLA 4FUQA 3I07A 3C5EA 1ML8A 5BUSA 3NI2A 4PUGA 1N2FA 3SO4A 1MXAA 1T5HX 1VLAA 3LAXA 4NXMC 2YX1A 4G37A 2MMAB 2PG1E 1IBKC 2P2JA 3L95X 3ETOA 4GKKC 3VNQA 3IEUA 2CY1A 2D1QA 4BC9A 5ADZA 1JOSA 4DR5C 4JI8C 1P4EA 2ATWA 4BBYA 5KYTA 5JRHA 4HPVA 2P2QA 4DCVA 4RMNA 5GTDA 3K6RA 5DV9A 3TQIA 1XRAA 3O2EA 5BSMA 4XX2A 1HNZC 2WD9A 2QW0X 4DUZC 3CQ1A 2UUCC 5T8SA 1KKGA 4R0MA 3UX2A 1LQLA 1MXCA 3AF6A 2VSQA 4DG9A 1V60A 2YWCA 3A26A 3R9XA 2MM9A 5BSUA 1XMOC 3A25A 3RG2A 2E0GA 1M6XA 1XNRC 3LUSA 4JI0C 4ZJZA 4B3TC 3PESA 2QVZX 3TUFA 2Z51A 3PROC 3UOWA 2V7BA 2D1SA 1ULTA 3R9WA 4KTVA 4L7IA 2OO4A 1XRBA 1N34C 1MDFA 3DHVA 3FM7A 5AE2A 3PBKA 3S82A 4RLQA 4NOZA 1EGAA 3A4IA 4EATA 4NDNA 3AF5A 3T1HC 4LF9C 3AY0A 1N33C 2P02A 4GS5A 2YWBA 2UU9C 3A9VA 4U5YD 1XRCA 4ZLPA 4DR7C 3UZ0A 3A9UA 5K85A 3TDEA 2UUAC 5K8FA 1USPB 1QWIA 2OPLB 3VNSA 4L2ZA 5BUQA 4K0BA 2QVXX 1YGTA 2P2MA 4JI6C 4WS9A 4YY3C 4YHHC 3GKUA 2HHHC 5IFIA 1V26A 4GXRA 1PG3A 4PUIA 3L8CA 3VNRA 2UXBC 1XS3A 2P2FA 1HNWC 3TR3A 2CXCA 5BSVA 1TH5A 1ZB8A 3GPCA 2BH1X 1YJ7A 4ODJA 2P2BA 3CW9A 5BSTA 2E8FA 4NXNC 4MH4A 4BC7A 4LFCC 2VZEA 1VEHA 4BSZA 5E7QA 3OTOC 5A1GA 2E8EA 1NY8A 2D27A 2M5HA 4PROC 1QM4A 3N2QA 4DV3C 2YCBA 5T8TA 3CQ2A 4LF7C 2DHMA 4B3SC 1FJGC 2VQFC 4DCUA 4LF5C 4DR2C 2KZFA 3H2TA 4DR6C 4DR4C 2QVYX 4GXQA 4DV4C 4WV3A
chains in the Genus database with same CATH topology
2D1TA 2P20A 4B3MC 1J5EC 3B7WA 4DCTA 4KTTA 4G1IA 3E7WA 2E7GA 3E7XA 4OX9C 4LE5A 4I9FA 2JMPA 1HH2P 2PN2A 2DYJA 3CJEA 3IPLA 4FTFA 1BA3A 4JI2C 2Y4NA 3NYRA 4K0KC 2PT7G 3R44A 5KEIA 5BR8C 4TPSB 3LNVA 5AE1A 5KYVA 2PROA 4LFAC 4MTNA 3J7AD 1LCIA 4G36A 2UXDC 5A1IA 2UXCC 4DV0C 2BJOA 4OXIA 4JM1A 3FCEA 5H9UA 3RV2A 3J81D 2HJGA 1GPMA 1IBMC 1T5DX 2D1RA 4JV5C 1K0RA 1P7LA 1MDBA 2E5LC 4RM3A 4D4GA 2OBVA 4PHTA 2DPLA 3EERA 3KXWA 3IEVA 4BCAA 4RLFA 2D28C 2Y27A 5FLXD 1N32C 2Y4OA 5CZVA 3I08A 5BSRA 1MKYA 4B3RC 5BSWA 4JI7C 3GR0A 4GKJC 2UUBC 3N54B 5IWAC 3DAYA 3ETCA 4DR3C 4JI3C 2F4VC 4DCSA 4LFBC 3FCCA 2ONFA 4L4QA 4X66C 1I94C 4JYAC 2XR1A 1WF3A 4FUTA 1O90A 4DV2C 2WP0C 1O9TA 1UKKA 2EGTA 3GR1A 1FUGA 2AYAA 1WH9A 3LGXA 4AQYC 1XNQC 4DUYC 1L2FA 5A2QD 4DV6C 4R1MA 4IZ6A 4X62C 4RVNA 1MD9A 4IR7A 3J80D 4D56A 1RY2A 2D7VA 1HR0C 4LF6C 1MXBA 3NYQA 4X65C 4KHPC 2ASBA 1AMUA 4I9GA 5A19A 1O93A 4RM2A 4X64C 2QL8A 3JAMD 1O92A 5LMUC 4DV5C 4OYCA 3T1YC 4D4IA 1NYEA 4DR1C 4DV7C 2E8CA 3G7SA 4ISBA 1N36C 4LF4C 5LMNC 3CW8X 4JI5C 2ZM6C 1XMQC 4JI1C 1PA4A 4DG8A 5AE3A 1HNXC 3DLPX 1IBLC 4PZPA 5BURA 3IMLA 1RG9A 4R1LA 5CZXA 1V25A 3NPDA 1PG4A 4LF8C 5IT9D 4DV1C 4JI4C 4D57A 1ZB9A 1USPA 4RVOA 3EQ6A 2VQEC 2OPLA 4FUQA 3I07A 3C5EA 1ML8A 5BUSA 3NI2A 1N2FA 3SO4A 1MXAA 1T5HX 1VLAA 3LAXA 4NXMC 4G37A 1IBKC 2P2JA 3L95X 3ETOA 4GKKC 3VNQA 3IEUA 2CY1A 2D1QA 4BC9A 5ADZA 1JOSA 4DR5C 4JI8C 2ATWA 4BBYA 5KYTA 5JRHA 4HPVA 2P2QA 4DCVA 4RMNA 5GTDA 5DV9A 3TQIA 1XRAA 5BSMA 4XX2A 1HNZC 2WD9A 2QW0X 4DUZC 2UUCC 5T8SA 1KKGA 4R0MA 1LQLA 1MXCA 3AF6A 2VSQA 4DG9A 2YWCA 3R9XA 5BSUA 1XMOC 3RG2A 2E0GA 1XNRC 3LUSA 4JI0C 4ZJZA 4B3TC 3PESA 2QVZX 3TUFA 3PROC 3UOWA 2V7BA 2D1SA 1ULTA 3R9WA 4KTVA 4L7IA 2OO4A 1XRBA 1N34C 1MDFA 3DHVA 5AE2A 3PBKA 3S82A 4RLQA 4NOZA 1EGAA 3A4IA 4EATA 4NDNA 3AF5A 3T1HC 4LF9C 1N33C 2P02A 4GS5A 2YWBA 2UU9C 3A9VA 4U5YD 1XRCA 4ZLPA 4DR7C 3UZ0A 3A9UA 5K85A 3TDEA 2UUAC 5K8FA 1USPB 1QWIA 2OPLB 3VNSA 4L2ZA 5BUQA 4K0BA 2QVXX 2P2MA 4JI6C 4WS9A 4YY3C 4YHHC 3GKUA 2HHHC 5IFIA 1V26A 4GXRA 1PG3A 3L8CA 3VNRA 2UXBC 2P2FA 1HNWC 2CXCA 5BSVA 1ZB8A 3GPCA 2BH1X 1YJ7A 4ODJA 2P2BA 3CW9A 5BSTA 2E8FA 4NXNC 4MH4A 4BC7A 4LFCC 2VZEA 4BSZA 5E7QA 3OTOC 5A1GA 2E8EA 2D27A 4PROC 1QM4A 3N2QA 4DV3C 2YCBA 5T8TA 4LF7C 4B3SC 1FJGC 2VQFC 4DCUA 4LF5C 4DR2C 2KZFA 3H2TA 4DR6C 4DR4C 2QVYX 4GXQA 4DV4C 4WV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I07 A;  4JYA C;  4B3M C;  4NOZ A;  2XR1 A;  1WF3 A;  1J5E C;  4DV2 C;  1EGA A;  1ML8 A;  1UKK A;  3AF5 A;  4DCT A;  1N2F A;  3T1H C;  2EGT A;  4LF9 C;  1VLA A;  1WH9 A;  1N33 C;  4NXM C;  2E7G A;  4OX9 C;  2UU9 C;  4AQY C;  1XNQ C;  2JMP A;  1HH2 P;  2PN2 A;  1IBK C;  4DR7 C;  4DUY C;  1L2F A;  5A2Q D;  4DV6 C;  2DYJ A;  3CJE A;  4JI2 C;  4X62 C;  2UUA C;  4GKK C;  1USP B;  4K0K C;  1QWI A;  2PT7 G;  3IEU A;  2CY1 A;  2OPL B;  5BR8 C;  3J80 D;  1HR0 C;  2D7V A;  4LF6 C;  4JI6 C;  1JOS A;  4X65 C;  4DR5 C;  4YHH C;  4YY3 C;  4JI8 C;  4KHP C;  3GKU A;  2ASB A;  2HHH C;  4LFA C;  2ATW A;  4MTN A;  3J7A D;  4X64 C;  2QL8 A;  3JAM D;  2UXD C;  5LMU C;  4DV5 C;  2UXC C;  3T1Y C;  4DV0 C;  2BJO A;  4DCV A;  2UXB C;  3J81 D;  2HJG A;  1NYE A;  4DR1 C;  4DV7 C;  1IBM C;  2E8C A;  1HNZ C;  4XX2 A;  4JV5 C;  1K0R A;  1HNW C;  4DUZ C;  2CXC A;  1ZB8 A;  1N36 C;  4LF4 C;  5LMN C;  2E5L C;  2UUC C;  4JI5 C;  1KKG A;  1LQL A;  2ZM6 C;  1XMQ C;  4JI1 C;  3AF6 A;  1PA4 A;  2E8F A;  3EER A;  4NXN C;  3IEV A;  4MH4 A;  4LFC C;  3R9X A;  1HNX C;  1XMO C;  5FLX D;  1IBL C;  4BSZ A;  1XNR C;  1N32 C;  3LUS A;  3OTO C;  4JI0 C;  2E8E A;  1MKY A;  4B3R C;  4JI7 C;  4GKJ C;  2UUB C;  4B3T C;  4DV3 C;  2YCB A;  5IWA C;  4DR3 C;  4JI3 C;  4LF7 C;  4LF8 C;  4B3S C;  1FJG C;  2F4V C;  4DCS A;  2VQF C;  4DCU A;  5IT9 D;  4DV1 C;  4LF5 C;  3R9W A;  4JI4 C;  4DR2 C;  4LFB C;  1ZB9 A;  2KZF A;  4DR6 C;  1USP A;  2ONF A;  1N34 C;  4DR4 C;  4X66 C;  2VQE C;  2OPL A;  4DV4 C;  1I94 C; 
#chains in the Genus database with same CATH topology
 2D1T A;  2P20 A;  4B3M C;  1J5E C;  3B7W A;  1IB8 A;  4DCT A;  4KTT A;  4G1I A;  3E7W A;  2E7G A;  3E7X A;  5LCI A;  4OX9 C;  4LE5 A;  4I9F A;  2JMP A;  1HH2 P;  2PN2 A;  2DYJ A;  3CJE A;  3IPL A;  4FTF A;  1BA3 A;  4JI2 C;  2Y4N A;  3NYR A;  4K0K C;  2PT7 G;  3R44 A;  5KEI A;  5BR8 C;  4TPS B;  3LNV A;  5AE1 A;  5KYV A;  2PRO A;  4LFA C;  3UX3 A;  1UWD A;  4MTN A;  3J7A D;  1LCI A;  4G36 A;  2UXD C;  5A1I A;  2UXC C;  4DV0 C;  2BJO A;  4OXI A;  2ZZN A;  4JM1 A;  3FCE A;  5H9U A;  3RV2 A;  3J81 D;  1GPM A;  2HJG A;  1IBM C;  1T5D X;  3LNO A;  2D1R A;  4JV5 C;  1K0R A;  1P7L A;  1MDB A;  2E5L C;  4RM3 A;  4D4G A;  2OBV A;  4PHT A;  2DPL A;  1P4E C;  3EER A;  3KXW A;  3IEV A;  4BCA A;  4RLF A;  2D28 C;  2Y27 A;  5FLX D;  1N32 C;  2Y4O A;  5CZV A;  3I08 A;  2KDN A;  5BSR A;  2CU6 A;  2MCQ A;  1MKY A;  4B3R C;  5BSW A;  4JI7 C;  3GR0 A;  1FLO A;  4GKJ C;  2UUB C;  3N54 B;  5IWA C;  3DAY A;  3ETC A;  4DR3 C;  4JI3 C;  4PUH A;  2F4V C;  4DCS A;  4LFB C;  2JNV A;  3FCC A;  2ONF A;  4L4Q A;  4X66 C;  1I94 C;  1M6X C;  4JYA C;  2XR1 A;  1WF3 A;  4FUT A;  1O90 A;  4DV2 C;  2WP0 C;  1O9T A;  1UKK A;  2EGT A;  3GR1 A;  1FUG A;  2AYA A;  1WH9 A;  3LGX A;  4AQY C;  1XNQ C;  1XHJ A;  4DUY C;  1L2F A;  5A2Q D;  4DV6 C;  4R1M A;  4IZ6 A;  2ZZM A;  4X62 C;  4RVN A;  1MD9 A;  4IR7 A;  2ZTB A;  3J80 D;  4D56 A;  1RY2 A;  2D7V A;  1HR0 C;  4LF6 C;  1MXB A;  3NYQ A;  4X65 C;  4KHP C;  2ASB A;  1AMU A;  4I9G A;  5A19 A;  1O93 A;  4RM2 A;  4X64 C;  2QL8 A;  3JAM D;  1O92 A;  5LMU C;  4DV5 C;  4OYC A;  3T1Y C;  4D4I A;  2NCL A;  1XDX A;  1PU1 A;  1NYE A;  4DR1 C;  4DV7 C;  2KZ0 A;  2E8C A;  3G7S A;  4ISB A;  1N36 C;  4LF4 C;  5LMN C;  3CW8 X;  4JI5 C;  2ZM6 C;  1WCJ A;  1XMQ C;  4JI1 C;  1PA4 A;  4DG8 A;  5AE3 A;  1HNX C;  3DLP X;  2M5O A;  1IBL C;  4PZP A;  5BUR A;  3IML A;  1RG9 A;  4R1L A;  3UEB A;  5CZX A;  1V25 A;  3NPD A;  1PG4 A;  4LF8 C;  5IT9 D;  4DV1 C;  4JI4 C;  4D57 A;  3CQ3 A;  1ZB9 A;  1USP A;  4RVO A;  3EQ6 A;  2VQE C;  2OPL A;  4FUQ A;  3I07 A;  3C5E A;  1ML8 A;  5BUS A;  3NI2 A;  4PUG A;  1N2F A;  3SO4 A;  1MXA A;  1T5H X;  1VLA A;  3LAX A;  4NXM C;  2YX1 A;  4G37 A;  2MMA B;  2PG1 E;  1IBK C;  2P2J A;  3L95 X;  3ETO A;  4GKK C;  3VNQ A;  3IEU A;  2CY1 A;  2D1Q A;  4BC9 A;  5ADZ A;  1JOS A;  4DR5 C;  4JI8 C;  1P4E A;  2ATW A;  4BBY A;  5KYT A;  5JRH A;  4HPV A;  2P2Q A;  4DCV A;  4RMN A;  5GTD A;  3K6R A;  5DV9 A;  3TQI A;  1XRA A;  3O2E A;  5BSM A;  4XX2 A;  1HNZ C;  2WD9 A;  2QW0 X;  4DUZ C;  3CQ1 A;  2UUC C;  5T8S A;  1KKG A;  4R0M A;  3UX2 A;  1LQL A;  1MXC A;  3AF6 A;  2VSQ A;  4DG9 A;  1V60 A;  2YWC A;  3A26 A;  3R9X A;  2MM9 A;  5BSU A;  1XMO C;  3A25 A;  3RG2 A;  2E0G A;  1M6X A;  1XNR C;  3LUS A;  4JI0 C;  4ZJZ A;  4B3T C;  3PES A;  2QVZ X;  3TUF A;  2Z51 A;  3PRO C;  3UOW A;  2V7B A;  2D1S A;  1ULT A;  3R9W A;  4KTV A;  4L7I A;  2OO4 A;  1XRB A;  1N34 C;  1MDF A;  3DHV A;  3FM7 A;  5AE2 A;  3PBK A;  3S82 A;  4RLQ A;  4NOZ A;  1EGA A;  3A4I A;  4EAT A;  4NDN A;  3AF5 A;  3T1H C;  4LF9 C;  3AY0 A;  1N33 C;  2P02 A;  4GS5 A;  2YWB A;  2UU9 C;  3A9V A;  4U5Y D;  1XRC A;  4ZLP A;  4DR7 C;  3UZ0 A;  3A9U A;  5K85 A;  3TDE A;  2UUA C;  5K8F A;  1USP B;  1QWI A;  2OPL B;  3VNS A;  4L2Z A;  5BUQ A;  4K0B A;  2QVX X;  1YGT A;  2P2M A;  4JI6 C;  4WS9 A;  4YY3 C;  4YHH C;  3GKU A;  2HHH C;  5IFI A;  1V26 A;  4GXR A;  1PG3 A;  4PUI A;  3L8C A;  3VNR A;  2UXB C;  1XS3 A;  2P2F A;  1HNW C;  3TR3 A;  2CXC A;  5BSV A;  1TH5 A;  1ZB8 A;  3GPC A;  2BH1 X;  1YJ7 A;  4ODJ A;  2P2B A;  3CW9 A;  5BST A;  2E8F A;  4NXN C;  4MH4 A;  4BC7 A;  4LFC C;  2VZE A;  1VEH A;  4BSZ A;  5E7Q A;  3OTO C;  5A1G A;  2E8E A;  1NY8 A;  2D27 A;  2M5H A;  4PRO C;  1QM4 A;  3N2Q A;  4DV3 C;  2YCB A;  5T8T A;  3CQ2 A;  4LF7 C;  2DHM A;  4B3S C;  1FJG C;  2VQF C;  4DCU A;  4LF5 C;  4DR2 C;  2KZF A;  3H2T A;  4DR6 C;  4DR4 C;  2QVY X;  4GXQ A;  4DV4 C;  4WV3 A; 
#chains in the Genus database with same CATH homology
 2D1T A;  2P20 A;  4B3M C;  1J5E C;  3B7W A;  4DCT A;  4KTT A;  4G1I A;  3E7W A;  2E7G A;  3E7X A;  4OX9 C;  4LE5 A;  4I9F A;  2JMP A;  1HH2 P;  2PN2 A;  2DYJ A;  3CJE A;  3IPL A;  4FTF A;  1BA3 A;  4JI2 C;  2Y4N A;  3NYR A;  4K0K C;  2PT7 G;  3R44 A;  5KEI A;  5BR8 C;  4TPS B;  3LNV A;  5AE1 A;  5KYV A;  2PRO A;  4LFA C;  4MTN A;  3J7A D;  1LCI A;  4G36 A;  2UXD C;  5A1I A;  2UXC C;  4DV0 C;  2BJO A;  4OXI A;  4JM1 A;  3FCE A;  5H9U A;  3RV2 A;  3J81 D;  2HJG A;  1GPM A;  1IBM C;  1T5D X;  2D1R A;  4JV5 C;  1K0R A;  1P7L A;  1MDB A;  2E5L C;  4RM3 A;  4D4G A;  2OBV A;  4PHT A;  2DPL A;  3EER A;  3KXW A;  3IEV A;  4BCA A;  4RLF A;  2D28 C;  2Y27 A;  5FLX D;  1N32 C;  2Y4O A;  5CZV A;  3I08 A;  5BSR A;  1MKY A;  4B3R C;  5BSW A;  4JI7 C;  3GR0 A;  4GKJ C;  2UUB C;  3N54 B;  5IWA C;  3DAY A;  3ETC A;  4DR3 C;  4JI3 C;  2F4V C;  4DCS A;  4LFB C;  3FCC A;  2ONF A;  4L4Q A;  4X66 C;  1I94 C;  4JYA C;  2XR1 A;  1WF3 A;  4FUT A;  1O90 A;  4DV2 C;  2WP0 C;  1O9T A;  1UKK A;  2EGT A;  3GR1 A;  1FUG A;  2AYA A;  1WH9 A;  3LGX A;  4AQY C;  1XNQ C;  4DUY C;  1L2F A;  5A2Q D;  4DV6 C;  4R1M A;  4IZ6 A;  4X62 C;  4RVN A;  1MD9 A;  4IR7 A;  3J80 D;  4D56 A;  1RY2 A;  2D7V A;  1HR0 C;  4LF6 C;  1MXB A;  3NYQ A;  4X65 C;  4KHP C;  2ASB A;  1AMU A;  4I9G A;  5A19 A;  1O93 A;  4RM2 A;  4X64 C;  2QL8 A;  3JAM D;  1O92 A;  5LMU C;  4DV5 C;  4OYC A;  3T1Y C;  4D4I A;  1NYE A;  4DR1 C;  4DV7 C;  2E8C A;  3G7S A;  4ISB A;  1N36 C;  4LF4 C;  5LMN C;  3CW8 X;  4JI5 C;  2ZM6 C;  1XMQ C;  4JI1 C;  1PA4 A;  4DG8 A;  5AE3 A;  1HNX C;  3DLP X;  1IBL C;  4PZP A;  5BUR A;  3IML A;  1RG9 A;  4R1L A;  5CZX A;  1V25 A;  3NPD A;  1PG4 A;  4LF8 C;  5IT9 D;  4DV1 C;  4JI4 C;  4D57 A;  1ZB9 A;  1USP A;  4RVO A;  3EQ6 A;  2VQE C;  2OPL A;  4FUQ A;  3I07 A;  3C5E A;  1ML8 A;  5BUS A;  3NI2 A;  1N2F A;  3SO4 A;  1MXA A;  1T5H X;  1VLA A;  3LAX A;  4NXM C;  4G37 A;  1IBK C;  2P2J A;  3L95 X;  3ETO A;  4GKK C;  3VNQ A;  3IEU A;  2CY1 A;  2D1Q A;  4BC9 A;  5ADZ A;  1JOS A;  4DR5 C;  4JI8 C;  2ATW A;  4BBY A;  5KYT A;  5JRH A;  4HPV A;  2P2Q A;  4DCV A;  4RMN A;  5GTD A;  5DV9 A;  3TQI A;  1XRA A;  5BSM A;  4XX2 A;  1HNZ C;  2WD9 A;  2QW0 X;  4DUZ C;  2UUC C;  5T8S A;  1KKG A;  4R0M A;  1LQL A;  1MXC A;  3AF6 A;  2VSQ A;  4DG9 A;  2YWC A;  3R9X A;  5BSU A;  1XMO C;  3RG2 A;  2E0G A;  1XNR C;  3LUS A;  4JI0 C;  4ZJZ A;  4B3T C;  3PES A;  2QVZ X;  3TUF A;  3PRO C;  3UOW A;  2V7B A;  2D1S A;  1ULT A;  3R9W A;  4KTV A;  4L7I A;  2OO4 A;  1XRB A;  1N34 C;  1MDF A;  3DHV A;  5AE2 A;  3PBK A;  3S82 A;  4RLQ A;  4NOZ A;  1EGA A;  3A4I A;  4EAT A;  4NDN A;  3AF5 A;  3T1H C;  4LF9 C;  1N33 C;  2P02 A;  4GS5 A;  2YWB A;  2UU9 C;  3A9V A;  4U5Y D;  1XRC A;  4ZLP A;  4DR7 C;  3UZ0 A;  3A9U A;  5K85 A;  3TDE A;  2UUA C;  5K8F A;  1USP B;  1QWI A;  2OPL B;  3VNS A;  4L2Z A;  5BUQ A;  4K0B A;  2QVX X;  2P2M A;  4JI6 C;  4WS9 A;  4YY3 C;  4YHH C;  3GKU A;  2HHH C;  5IFI A;  1V26 A;  4GXR A;  1PG3 A;  3L8C A;  3VNR A;  2UXB C;  2P2F A;  1HNW C;  2CXC A;  5BSV A;  1ZB8 A;  3GPC A;  2BH1 X;  1YJ7 A;  4ODJ A;  2P2B A;  3CW9 A;  5BST A;  2E8F A;  4NXN C;  4MH4 A;  4BC7 A;  4LFC C;  2VZE A;  4BSZ A;  5E7Q A;  3OTO C;  5A1G A;  2E8E A;  2D27 A;  4PRO C;  1QM4 A;  3N2Q A;  4DV3 C;  2YCB A;  5T8T A;  4LF7 C;  4B3S C;  1FJG C;  2VQF C;  4DCU A;  4LF5 C;  4DR2 C;  2KZF A;  3H2T A;  4DR6 C;  4DR4 C;  2QVY X;  4GXQ A;  4DV4 C;  4WV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...