3OTOC

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
total genus 41
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3otoC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3otoC02
4DUZC 4LFBC 2XR1A 2HHHC 4DV6C 1N33C 4DV3C 1EGAA 4DCVA 1MKYA 4LF9C 2UUCC 1K0RA 2VQEC 3AF6A 1FJGC 4LF5C 4DV7C 1XMQC 1L2FA 1WH9A 3AF5A 5BR8C 5LMUC 1QWIA 4X62C 2UXBC 4XX2A 2UXDC 4JYAC 4DR5C 4LF7C 1ZB9A 4GKKC 2HJGA 4AQYC 4DV4C 4B3SC 3J81D 4X65C 3IEVA 4JI1C 2CXCA 4LF6C 4DCTA 4DV2C 3OTOC 2ASBA 1USPB 2E5LC 1HNZC 5LMNC 1VLAA 1IBLC 4B3MC 4BSZA 3R9WA 4DR3C 1IBKC 2DYJA 4NOZA 3EERA 2OPLA 5IWAC 1PA4A 2JMPA 4JI0C 4X66C 4MH4A 4LF4C 4JV5C 4NXNC 4YHHC 4DCUA 3J7AD 1HH2P 1JOSA 3I07A 4DR6C 5FLXD 2UUAC 2CY1A 4DR1C 1XMOC 1N34C 1I94C 4DR7C 2ZM6C 4MTNA 1N2FA 2ONFA 4OX9C 2F4VC 4DV5C 2OPLB 2UU9C 1HNWC 4B3TC 4JI5C 4DCSA 4NXMC 2E8FA 1HR0C 4JI6C 4DV1C 2E8EA 2PN2A 1N36C 2EGTA 2KZFA 3IEUA 4DV0C 1LQLA 4B3RC 4JI3C 2D7VA 3CJEA 4JI4C 1N32C 1ML8A 2YCBA 4JI7C 3R9XA 3J80D 4DUYC 2BJOA 2UUBC 1J5EC 4JI2C 4X64C 5IT9D 1XNRC 2PT7G 3T1YC 1HNXC 4K0KC 2QL8A 3JAMD 4DR2C 4JI8C 2E8CA 5A2QD 1ZB8A 2VQFC 2E7GA 1WF3A 4GKJC 4KHPC 2UXCC 2ATWA 1USPA 1KKGA 3LUSA 4LF8C 1XNQC 1NYEA 1UKKA 3GKUA 4YY3C 3T1HC 4LFCC 4LFAC 4DR4C 1IBMC
chains in the Genus database with same CATH superfamily
2XR1A 4RLQA 4U5YD 1N33C 5BSTA 4PZPA 2D1RA 2QVYX 3H2TA 3O2EA 1K0RA 2UUCC 5T8SA 4GS5A 3AF6A 1FJGC 1MD9A 5T8TA 1WH9A 3AF5A 5LMUC 1QWIA 4D57A 1ZB9A 3I08A 2MCQA 4DV4C 3E7WA 3J81D 4BCAA 1M6XC 4IZ6A 3DHVA 4GXRA 2KZ0A 1IBLC 1IBKC 3EERA 2OPLA 5IWAC 1PA4A 4RMNA 4JI0C 1QM4A 2BH1X 5K85A 4YHHC 2D1QA 1HH2P 3PESA 2P2QA 1TH5A 2QVXX 4MTNA 2F4VC 3ETOA 2ZZMA 4B3TC 4JI5C 4NXMC 4JI6C 4PUIA 4DV0C 1LQLA 5BSUA 3CJEA 2BJOA 3UEBA 3A9UA 2KDNA 3T1YC 4RM2A 1HNXC 4PHTA 3UX3A 4FUTA 3PBKA 4PROC 1WCJA 3KXWA 1ZB8A 2E7GA 4RLFA 2UXCC 2ATWA 1USPA 2QVZX 1UKKA 5ADZA 4G1IA 4LFAC 3SO4A 3LNVA 4DUZC 2ZTBA 2PROA 1EGAA 2VQEC 1PU1A 4TPSB 2WD9A 1L2FA 3G7SA 5BSMA 4KTVA 4L2ZA 4X62C 4XX2A 2UXDC 4DR5C 2P2FA 4LF7C 1BA3A 4X65C 4PUGA 2CXCA 5CZXA 1UWDA 1FLOA 3LGXA 5BURA 5DV9A 5BSRA 3ETCA 2D28C 5AE1A 3NYQA 2YWCA 2D27A 5A19A 3FCEA 2V7BA 3R9WA 3R44A 1FUGA 4HPVA 5AE3A 1AMUA 3E7XA 3TQIA 2CU6A 1XS3A 4LF4C 4JV5C 1V60A 4NXNC 2M5OA 4DCUA 3I07A 1JOSA 1XRBA 5FLXD 3TUFA 2CY1A 1XMOC 4DR7C 2ZM6C 2D1TA 2OPLB 4EATA 2JNVA 4DCSA 2E8EA 4B3RC 1PG3A 5K8FA 4JI7C 3TR3A 3J80D 4OXIA 4RVNA 2QW0X 5JRHA 4NDNA 4PUHA 2Y4NA 2PT7G 3L95X 5E7QA 4K0KC 1MDFA 1LCIA 1MDBA 4DG8A 3C5EA 4JI8C 2E8CA 4ODJA 5A2QD 2VQFC 4ZLPA 4WV3A 2NCLA 1P7LA 4LF8C 1PG4A 5CZVA 1NYEA 4GXQA 4DR4C 1IBMC 4LFBC 2HHHC 3UOWA 4D4IA 3RG2A 4DV3C 1XRAA 1XHJA 4R0MA 4OYCA 1MKYA 3DLPX 1P4EA 2Z51A 4LE5A 4R1LA 4G37A 4D56A 3A4IA 1GPMA 2UXBC 4JYAC 4GKKC 5A1IA 3IEVA 1NY8A 1RY2A 5AE2A 1ULTA 3A26A 4L7IA 3LAXA 5A1GA 2P2JA 2WP0C 4BC9A 1HNZC 1VLAA 4BSZA 2DYJA 4NOZA 4R1MA 2E0GA 2VZEA 3J7AD 2UUAC 3AY0A 2Y4OA 1N2FA 4OX9C 4DV5C 4DG9A 1HNWC 2Y27A 2DHMA 1MXBA 2PN2A 1N36C 2EGTA 3IPLA 2YX1A 4RVOA 3IEUA 3CQ1A 5BUQA 3A9VA 4JI3C 1ML8A 3R9XA 4DUYC 2UUBC 2DPLA 3PROC 4I9GA 4FTFA 3NYRA 5IT9D 1IB8A 1YGTA 5IFIA 3GR1A 2QL8A 3JAMD 5KYVA 4DR2C 1XDXA 3LNOA 2OBVA 1VEHA 4K0BA 4KHPC 1O93A 1M6XA 3GPCA 4YY3C 4LFCC 3FCCA 2P2MA 2P02A 2VSQA 5KEIA 4DV6C 4ZJZA 4D4GA 4BC7A 4DCVA 3N54B 1T5HX 5H9UA 5BSVA 4LF9C 5GTDA 3VNRA 4G36A 4LF5C 4DV7C 1XMQC 5BR8C 5BUSA 3NPDA 3CW8X 2AYAA 2HJGA 1V26A 4AQYC 2OO4A 4B3SC 4I9FA 4JI1C 4LF6C 1RG9A 3IMLA 1XRCA 4DCTA 4DV2C 3OTOC 2PG1E 1YJ7A 2ASBA 1USPB 2E5LC 1O9TA 5LMNC 4B3MC 3DAYA 4DR3C 5KYTA 2ZZNA 2P20A 2JMPA 4X66C 4MH4A 3A25A 3CQ2A 1MXAA 1P4EC 3NI2A 5LCIA 4DR6C 4FUQA 4DR1C 2MMAB 1N34C 1I94C 1O92A 1MXCA 2ONFA 3B7WA 2UU9C 4RM3A 3CQ3A 2E8FA 1HR0C 4DV1C 4ISBA 4L4QA 2KZFA 3UZ0A 4IR7A 2D7VA 5BSWA 4JI4C 1N32C 2YCBA 4BBYA 4KTTA 3CW9A 3FM7A 3GR0A 1J5EC 2MM9A 2D1SA 4JI2C 4JM1A 4X64C 1XNRC 3VNQA 3VNSA 1O90A 3TDEA 3L8CA 2M5HA 3N2QA 3RV2A 1WF3A 4GKJC 3S82A 1T5DX 1V25A 4WS9A 1KKGA 3LUSA 1XNQC 2P2BA 3K6RA 3T1HC 2YWBA 3GKUA 3UX2A 3EQ6A
chains in the Genus database with same CATH topology
2XR1A 4RLQA 4U5YD 1N33C 5BSTA 4PZPA 2D1RA 2QVYX 3H2TA 2UUCC 1K0RA 5T8SA 4GS5A 3AF6A 1FJGC 1MD9A 5T8TA 1WH9A 3AF5A 5LMUC 1QWIA 4D57A 1ZB9A 3I08A 4DV4C 3E7WA 3J81D 4BCAA 4IZ6A 3DHVA 4GXRA 1IBLC 1IBKC 3EERA 2OPLA 5IWAC 1PA4A 4RMNA 4JI0C 1QM4A 2BH1X 5K85A 4YHHC 2D1QA 1HH2P 3PESA 2P2QA 2QVXX 4MTNA 2F4VC 3ETOA 4B3TC 4JI5C 4NXMC 4JI6C 4DV0C 1LQLA 5BSUA 3CJEA 2BJOA 3A9UA 3T1YC 4RM2A 1HNXC 4PHTA 4FUTA 3PBKA 4PROC 3KXWA 1ZB8A 2E7GA 4RLFA 2UXCC 2ATWA 1USPA 2QVZX 1UKKA 5ADZA 4G1IA 4LFAC 3SO4A 3LNVA 4DUZC 2PROA 1EGAA 2VQEC 4TPSB 2WD9A 1L2FA 3G7SA 5BSMA 4KTVA 4L2ZA 4X62C 4XX2A 2UXDC 4DR5C 2P2FA 4LF7C 1BA3A 4X65C 2CXCA 5CZXA 3LGXA 5BURA 5DV9A 5BSRA 3ETCA 2D28C 5AE1A 3NYQA 2YWCA 2D27A 5A19A 3FCEA 2V7BA 3R9WA 3R44A 1FUGA 4HPVA 5AE3A 1AMUA 3E7XA 3TQIA 4LF4C 4JV5C 4NXNC 4DCUA 3I07A 1JOSA 1XRBA 5FLXD 3TUFA 2CY1A 1XMOC 4DR7C 2ZM6C 2D1TA 2OPLB 4EATA 4DCSA 2E8EA 4B3RC 1PG3A 5K8FA 4JI7C 3J80D 4OXIA 4RVNA 2QW0X 5JRHA 4NDNA 2Y4NA 2PT7G 3L95X 5E7QA 4K0KC 1MDFA 1LCIA 1MDBA 4DG8A 3C5EA 4JI8C 2E8CA 4ODJA 5A2QD 2VQFC 4ZLPA 4WV3A 1P7LA 4LF8C 1PG4A 5CZVA 1NYEA 4GXQA 4DR4C 1IBMC 4LFBC 2HHHC 3UOWA 4D4IA 3RG2A 4DV3C 1XRAA 4R0MA 4OYCA 1MKYA 3DLPX 4LE5A 4R1LA 4G37A 4D56A 3A4IA 1GPMA 2UXBC 4JYAC 4GKKC 5A1IA 3IEVA 1RY2A 5AE2A 1ULTA 4L7IA 3LAXA 5A1GA 2P2JA 2WP0C 4BC9A 1HNZC 1VLAA 4BSZA 2DYJA 4NOZA 4R1MA 2E0GA 2VZEA 3J7AD 2UUAC 2Y4OA 1N2FA 4OX9C 4DV5C 4DG9A 1HNWC 2Y27A 1MXBA 2PN2A 1N36C 2EGTA 3IPLA 4RVOA 3IEUA 5BUQA 3A9VA 4JI3C 1ML8A 3R9XA 4DUYC 2UUBC 2DPLA 3PROC 4I9GA 4FTFA 3NYRA 5IT9D 5IFIA 3GR1A 2QL8A 3JAMD 5KYVA 4DR2C 2OBVA 4K0BA 4KHPC 1O93A 3GPCA 4YY3C 4LFCC 3FCCA 2P2MA 2P02A 2VSQA 5KEIA 4DV6C 4ZJZA 4D4GA 4BC7A 4DCVA 3N54B 1T5HX 5H9UA 5BSVA 4LF9C 5GTDA 3VNRA 4G36A 4LF5C 4DV7C 1XMQC 5BR8C 5BUSA 3NPDA 3CW8X 2AYAA 2HJGA 1V26A 4AQYC 2OO4A 4B3SC 4I9FA 4JI1C 4LF6C 1RG9A 3IMLA 1XRCA 4DCTA 4DV2C 3OTOC 1YJ7A 2ASBA 1USPB 2E5LC 1O9TA 5LMNC 4B3MC 3DAYA 4DR3C 5KYTA 2P20A 2JMPA 4X66C 4MH4A 1MXAA 3NI2A 4DR6C 4FUQA 4DR1C 1N34C 1I94C 1O92A 1MXCA 2ONFA 3B7WA 2UU9C 4RM3A 2E8FA 1HR0C 4DV1C 4ISBA 4L4QA 2KZFA 3UZ0A 4IR7A 2D7VA 5BSWA 4JI4C 1N32C 2YCBA 4BBYA 4KTTA 3CW9A 3GR0A 1J5EC 2D1SA 4JI2C 4JM1A 4X64C 1XNRC 3VNQA 3VNSA 1O90A 3TDEA 3L8CA 3N2QA 3RV2A 1WF3A 4GKJC 3S82A 1T5DX 1V25A 4WS9A 1KKGA 3LUSA 1XNQC 2P2BA 3T1HC 2YWBA 3GKUA 3EQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ C;  4LFB C;  2XR1 A;  2HHH C;  4DV6 C;  1N33 C;  4DV3 C;  1EGA A;  4DCV A;  1MKY A;  4LF9 C;  2UUC C;  1K0R A;  2VQE C;  3AF6 A;  1FJG C;  4LF5 C;  4DV7 C;  1XMQ C;  1L2F A;  1WH9 A;  3AF5 A;  5BR8 C;  5LMU C;  1QWI A;  4X62 C;  2UXB C;  4XX2 A;  2UXD C;  4JYA C;  4DR5 C;  4LF7 C;  1ZB9 A;  4GKK C;  2HJG A;  4AQY C;  4DV4 C;  4B3S C;  3J81 D;  4X65 C;  3IEV A;  4JI1 C;  2CXC A;  4LF6 C;  4DCT A;  4DV2 C;  3OTO C;  2ASB A;  1USP B;  2E5L C;  1HNZ C;  5LMN C;  1VLA A;  1IBL C;  4B3M C;  4BSZ A;  3R9W A;  4DR3 C;  1IBK C;  2DYJ A;  4NOZ A;  3EER A;  2OPL A;  5IWA C;  1PA4 A;  2JMP A;  4JI0 C;  4X66 C;  4MH4 A;  4LF4 C;  4JV5 C;  4NXN C;  4YHH C;  4DCU A;  3J7A D;  1HH2 P;  1JOS A;  3I07 A;  4DR6 C;  5FLX D;  2UUA C;  2CY1 A;  4DR1 C;  1XMO C;  1N34 C;  1I94 C;  4DR7 C;  2ZM6 C;  4MTN A;  1N2F A;  2ONF A;  4OX9 C;  2F4V C;  4DV5 C;  2OPL B;  2UU9 C;  1HNW C;  4B3T C;  4JI5 C;  4DCS A;  4NXM C;  2E8F A;  1HR0 C;  4JI6 C;  4DV1 C;  2E8E A;  2PN2 A;  1N36 C;  2EGT A;  2KZF A;  3IEU A;  4DV0 C;  1LQL A;  4B3R C;  4JI3 C;  2D7V A;  3CJE A;  4JI4 C;  1N32 C;  1ML8 A;  2YCB A;  4JI7 C;  3R9X A;  3J80 D;  4DUY C;  2BJO A;  2UUB C;  1J5E C;  4JI2 C;  4X64 C;  5IT9 D;  1XNR C;  2PT7 G;  3T1Y C;  1HNX C;  4K0K C;  2QL8 A;  3JAM D;  4DR2 C;  4JI8 C;  2E8C A;  5A2Q D;  1ZB8 A;  2VQF C;  2E7G A;  1WF3 A;  4GKJ C;  4KHP C;  2UXC C;  2ATW A;  1USP A;  1KKG A;  3LUS A;  4LF8 C;  1XNQ C;  1NYE A;  1UKK A;  3GKU A;  4YY3 C;  3T1H C;  4LFC C;  4LFA C;  4DR4 C;  1IBM C; 
#chains in the Genus database with same CATH topology
 2XR1 A;  4RLQ A;  4U5Y D;  1N33 C;  5BST A;  4PZP A;  2D1R A;  2QVY X;  3H2T A;  3O2E A;  1K0R A;  2UUC C;  5T8S A;  4GS5 A;  3AF6 A;  1FJG C;  1MD9 A;  5T8T A;  1WH9 A;  3AF5 A;  5LMU C;  1QWI A;  4D57 A;  1ZB9 A;  3I08 A;  2MCQ A;  4DV4 C;  3E7W A;  3J81 D;  4BCA A;  1M6X C;  4IZ6 A;  3DHV A;  4GXR A;  2KZ0 A;  1IBL C;  1IBK C;  3EER A;  2OPL A;  5IWA C;  1PA4 A;  4RMN A;  4JI0 C;  1QM4 A;  2BH1 X;  5K85 A;  4YHH C;  2D1Q A;  1HH2 P;  3PES A;  2P2Q A;  1TH5 A;  2QVX X;  4MTN A;  2F4V C;  3ETO A;  2ZZM A;  4B3T C;  4JI5 C;  4NXM C;  4JI6 C;  4PUI A;  4DV0 C;  1LQL A;  5BSU A;  3CJE A;  2BJO A;  3UEB A;  3A9U A;  2KDN A;  3T1Y C;  4RM2 A;  1HNX C;  4PHT A;  3UX3 A;  4FUT A;  3PBK A;  4PRO C;  1WCJ A;  3KXW A;  1ZB8 A;  2E7G A;  4RLF A;  2UXC C;  2ATW A;  1USP A;  2QVZ X;  1UKK A;  5ADZ A;  4G1I A;  4LFA C;  3SO4 A;  3LNV A;  4DUZ C;  2ZTB A;  2PRO A;  1EGA A;  2VQE C;  1PU1 A;  4TPS B;  2WD9 A;  1L2F A;  3G7S A;  5BSM A;  4KTV A;  4L2Z A;  4X62 C;  4XX2 A;  2UXD C;  4DR5 C;  2P2F A;  4LF7 C;  1BA3 A;  4X65 C;  4PUG A;  2CXC A;  5CZX A;  1UWD A;  1FLO A;  3LGX A;  5BUR A;  5DV9 A;  5BSR A;  3ETC A;  2D28 C;  5AE1 A;  3NYQ A;  2YWC A;  2D27 A;  5A19 A;  3FCE A;  2V7B A;  3R9W A;  3R44 A;  1FUG A;  4HPV A;  5AE3 A;  1AMU A;  3E7X A;  3TQI A;  2CU6 A;  1XS3 A;  4LF4 C;  4JV5 C;  1V60 A;  4NXN C;  2M5O A;  4DCU A;  3I07 A;  1JOS A;  1XRB A;  5FLX D;  3TUF A;  2CY1 A;  1XMO C;  4DR7 C;  2ZM6 C;  2D1T A;  2OPL B;  4EAT A;  2JNV A;  4DCS A;  2E8E A;  4B3R C;  1PG3 A;  5K8F A;  4JI7 C;  3TR3 A;  3J80 D;  4OXI A;  4RVN A;  2QW0 X;  5JRH A;  4NDN A;  4PUH A;  2Y4N A;  2PT7 G;  3L95 X;  5E7Q A;  4K0K C;  1MDF A;  1LCI A;  1MDB A;  4DG8 A;  3C5E A;  4JI8 C;  2E8C A;  4ODJ A;  5A2Q D;  2VQF C;  4ZLP A;  4WV3 A;  2NCL A;  1P7L A;  4LF8 C;  1PG4 A;  5CZV A;  1NYE A;  4GXQ A;  4DR4 C;  1IBM C;  4LFB C;  2HHH C;  3UOW A;  4D4I A;  3RG2 A;  4DV3 C;  1XRA A;  1XHJ A;  4R0M A;  4OYC A;  1MKY A;  3DLP X;  1P4E A;  2Z51 A;  4LE5 A;  4R1L A;  4G37 A;  4D56 A;  3A4I A;  1GPM A;  2UXB C;  4JYA C;  4GKK C;  5A1I A;  3IEV A;  1NY8 A;  1RY2 A;  5AE2 A;  1ULT A;  3A26 A;  4L7I A;  3LAX A;  5A1G A;  2P2J A;  2WP0 C;  4BC9 A;  1HNZ C;  1VLA A;  4BSZ A;  2DYJ A;  4NOZ A;  4R1M A;  2E0G A;  2VZE A;  3J7A D;  2UUA C;  3AY0 A;  2Y4O A;  1N2F A;  4OX9 C;  4DV5 C;  4DG9 A;  1HNW C;  2Y27 A;  2DHM A;  1MXB A;  2PN2 A;  1N36 C;  2EGT A;  3IPL A;  2YX1 A;  4RVO A;  3IEU A;  3CQ1 A;  5BUQ A;  3A9V A;  4JI3 C;  1ML8 A;  3R9X A;  4DUY C;  2UUB C;  2DPL A;  3PRO C;  4I9G A;  4FTF A;  3NYR A;  5IT9 D;  1IB8 A;  1YGT A;  5IFI A;  3GR1 A;  2QL8 A;  3JAM D;  5KYV A;  4DR2 C;  1XDX A;  3LNO A;  2OBV A;  1VEH A;  4K0B A;  4KHP C;  1O93 A;  1M6X A;  3GPC A;  4YY3 C;  4LFC C;  3FCC A;  2P2M A;  2P02 A;  2VSQ A;  5KEI A;  4DV6 C;  4ZJZ A;  4D4G A;  4BC7 A;  4DCV A;  3N54 B;  1T5H X;  5H9U A;  5BSV A;  4LF9 C;  5GTD A;  3VNR A;  4G36 A;  4LF5 C;  4DV7 C;  1XMQ C;  5BR8 C;  5BUS A;  3NPD A;  3CW8 X;  2AYA A;  2HJG A;  1V26 A;  4AQY C;  2OO4 A;  4B3S C;  4I9F A;  4JI1 C;  4LF6 C;  1RG9 A;  3IML A;  1XRC A;  4DCT A;  4DV2 C;  3OTO C;  2PG1 E;  1YJ7 A;  2ASB A;  1USP B;  2E5L C;  1O9T A;  5LMN C;  4B3M C;  3DAY A;  4DR3 C;  5KYT A;  2ZZN A;  2P20 A;  2JMP A;  4X66 C;  4MH4 A;  3A25 A;  3CQ2 A;  1MXA A;  1P4E C;  3NI2 A;  5LCI A;  4DR6 C;  4FUQ A;  4DR1 C;  2MMA B;  1N34 C;  1I94 C;  1O92 A;  1MXC A;  2ONF A;  3B7W A;  2UU9 C;  4RM3 A;  3CQ3 A;  2E8F A;  1HR0 C;  4DV1 C;  4ISB A;  4L4Q A;  2KZF A;  3UZ0 A;  4IR7 A;  2D7V A;  5BSW A;  4JI4 C;  1N32 C;  2YCB A;  4BBY A;  4KTT A;  3CW9 A;  3FM7 A;  3GR0 A;  1J5E C;  2MM9 A;  2D1S A;  4JI2 C;  4JM1 A;  4X64 C;  1XNR C;  3VNQ A;  3VNS A;  1O90 A;  3TDE A;  3L8C A;  2M5H A;  3N2Q A;  3RV2 A;  1WF3 A;  4GKJ C;  3S82 A;  1T5D X;  1V25 A;  4WS9 A;  1KKG A;  3LUS A;  1XNQ C;  2P2B A;  3K6R A;  3T1H C;  2YWB A;  3GKU A;  3UX2 A;  3EQ6 A; 
#chains in the Genus database with same CATH homology
 2XR1 A;  4RLQ A;  4U5Y D;  1N33 C;  5BST A;  4PZP A;  2D1R A;  2QVY X;  3H2T A;  2UUC C;  1K0R A;  5T8S A;  4GS5 A;  3AF6 A;  1FJG C;  1MD9 A;  5T8T A;  1WH9 A;  3AF5 A;  5LMU C;  1QWI A;  4D57 A;  1ZB9 A;  3I08 A;  4DV4 C;  3E7W A;  3J81 D;  4BCA A;  4IZ6 A;  3DHV A;  4GXR A;  1IBL C;  1IBK C;  3EER A;  2OPL A;  5IWA C;  1PA4 A;  4RMN A;  4JI0 C;  1QM4 A;  2BH1 X;  5K85 A;  4YHH C;  2D1Q A;  1HH2 P;  3PES A;  2P2Q A;  2QVX X;  4MTN A;  2F4V C;  3ETO A;  4B3T C;  4JI5 C;  4NXM C;  4JI6 C;  4DV0 C;  1LQL A;  5BSU A;  3CJE A;  2BJO A;  3A9U A;  3T1Y C;  4RM2 A;  1HNX C;  4PHT A;  4FUT A;  3PBK A;  4PRO C;  3KXW A;  1ZB8 A;  2E7G A;  4RLF A;  2UXC C;  2ATW A;  1USP A;  2QVZ X;  1UKK A;  5ADZ A;  4G1I A;  4LFA C;  3SO4 A;  3LNV A;  4DUZ C;  2PRO A;  1EGA A;  2VQE C;  4TPS B;  2WD9 A;  1L2F A;  3G7S A;  5BSM A;  4KTV A;  4L2Z A;  4X62 C;  4XX2 A;  2UXD C;  4DR5 C;  2P2F A;  4LF7 C;  1BA3 A;  4X65 C;  2CXC A;  5CZX A;  3LGX A;  5BUR A;  5DV9 A;  5BSR A;  3ETC A;  2D28 C;  5AE1 A;  3NYQ A;  2YWC A;  2D27 A;  5A19 A;  3FCE A;  2V7B A;  3R9W A;  3R44 A;  1FUG A;  4HPV A;  5AE3 A;  1AMU A;  3E7X A;  3TQI A;  4LF4 C;  4JV5 C;  4NXN C;  4DCU A;  3I07 A;  1JOS A;  1XRB A;  5FLX D;  3TUF A;  2CY1 A;  1XMO C;  4DR7 C;  2ZM6 C;  2D1T A;  2OPL B;  4EAT A;  4DCS A;  2E8E A;  4B3R C;  1PG3 A;  5K8F A;  4JI7 C;  3J80 D;  4OXI A;  4RVN A;  2QW0 X;  5JRH A;  4NDN A;  2Y4N A;  2PT7 G;  3L95 X;  5E7Q A;  4K0K C;  1MDF A;  1LCI A;  1MDB A;  4DG8 A;  3C5E A;  4JI8 C;  2E8C A;  4ODJ A;  5A2Q D;  2VQF C;  4ZLP A;  4WV3 A;  1P7L A;  4LF8 C;  1PG4 A;  5CZV A;  1NYE A;  4GXQ A;  4DR4 C;  1IBM C;  4LFB C;  2HHH C;  3UOW A;  4D4I A;  3RG2 A;  4DV3 C;  1XRA A;  4R0M A;  4OYC A;  1MKY A;  3DLP X;  4LE5 A;  4R1L A;  4G37 A;  4D56 A;  3A4I A;  1GPM A;  2UXB C;  4JYA C;  4GKK C;  5A1I A;  3IEV A;  1RY2 A;  5AE2 A;  1ULT A;  4L7I A;  3LAX A;  5A1G A;  2P2J A;  2WP0 C;  4BC9 A;  1HNZ C;  1VLA A;  4BSZ A;  2DYJ A;  4NOZ A;  4R1M A;  2E0G A;  2VZE A;  3J7A D;  2UUA C;  2Y4O A;  1N2F A;  4OX9 C;  4DV5 C;  4DG9 A;  1HNW C;  2Y27 A;  1MXB A;  2PN2 A;  1N36 C;  2EGT A;  3IPL A;  4RVO A;  3IEU A;  5BUQ A;  3A9V A;  4JI3 C;  1ML8 A;  3R9X A;  4DUY C;  2UUB C;  2DPL A;  3PRO C;  4I9G A;  4FTF A;  3NYR A;  5IT9 D;  5IFI A;  3GR1 A;  2QL8 A;  3JAM D;  5KYV A;  4DR2 C;  2OBV A;  4K0B A;  4KHP C;  1O93 A;  3GPC A;  4YY3 C;  4LFC C;  3FCC A;  2P2M A;  2P02 A;  2VSQ A;  5KEI A;  4DV6 C;  4ZJZ A;  4D4G A;  4BC7 A;  4DCV A;  3N54 B;  1T5H X;  5H9U A;  5BSV A;  4LF9 C;  5GTD A;  3VNR A;  4G36 A;  4LF5 C;  4DV7 C;  1XMQ C;  5BR8 C;  5BUS A;  3NPD A;  3CW8 X;  2AYA A;  2HJG A;  1V26 A;  4AQY C;  2OO4 A;  4B3S C;  4I9F A;  4JI1 C;  4LF6 C;  1RG9 A;  3IML A;  1XRC A;  4DCT A;  4DV2 C;  3OTO C;  1YJ7 A;  2ASB A;  1USP B;  2E5L C;  1O9T A;  5LMN C;  4B3M C;  3DAY A;  4DR3 C;  5KYT A;  2P20 A;  2JMP A;  4X66 C;  4MH4 A;  1MXA A;  3NI2 A;  4DR6 C;  4FUQ A;  4DR1 C;  1N34 C;  1I94 C;  1O92 A;  1MXC A;  2ONF A;  3B7W A;  2UU9 C;  4RM3 A;  2E8F A;  1HR0 C;  4DV1 C;  4ISB A;  4L4Q A;  2KZF A;  3UZ0 A;  4IR7 A;  2D7V A;  5BSW A;  4JI4 C;  1N32 C;  2YCB A;  4BBY A;  4KTT A;  3CW9 A;  3GR0 A;  1J5E C;  2D1S A;  4JI2 C;  4JM1 A;  4X64 C;  1XNR C;  3VNQ A;  3VNS A;  1O90 A;  3TDE A;  3L8C A;  3N2Q A;  3RV2 A;  1WF3 A;  4GKJ C;  3S82 A;  1T5D X;  1V25 A;  4WS9 A;  1KKG A;  3LUS A;  1XNQ C;  2P2B A;  3T1H C;  2YWB A;  3GKU A;  3EQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...