3OTOC

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 41
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3otoC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3otoC02
4MTNA 4DUZC 2EGTA 1N36C 4JI0C 1IBKC 1I94C 5LMUC 1HNXC 1USPA 4OX9C 2PT7G 2XR1A 3LUSA 2JMPA 5IWAC 2HJGA 4JI6C 4DV4C 4DR5C 1XMQC 1IBLC 4LF7C 4JI3C 4X62C 1MKYA 3AF5A 1NYEA 4AQYC 4DCUA 4K0KC 4DV3C 1QWIA 3IEVA 2E5LC 4JI5C 1PA4A 2YCBA 4NOZA 1ZB8A 4KHPC 2VQFC 2UUCC 4DR3C 2ATWA 2E7GA 2E8CA 5FLXD 2QL8A 4LFAC 1ZB9A 4LF5C 4DV5C 2KZFA 1XMOC 2UXBC 4DV7C 1JOSA 4LF9C 2OPLB 2CXCA 1HNZC 1HR0C 4NXNC 1LQLA 4LF8C 1N33C 2PN2A 4DR4C 3T1YC 4JYAC 3CJEA 4DCSA 4X64C 2E8FA 4YY3C 4GKJC 1XNQC 3OTOC 1HNWC 3J81D 2CY1A 4GKKC 4DCTA 5A2QD 2UUAC 4B3MC 2UUBC 4JV5C 4JI4C 1ML8A 4DR2C 2DYJA 3EERA 4XX2A 3IEUA 4B3RC 4LF6C 4DUYC 4DV6C 1L2FA 2D7VA 1K0RA 4LFCC 4DV0C 2E8EA 3AF6A 2UU9C 3J7AD 4DR6C 1N32C 4JI8C 3R9XA 1J5EC 4LF4C 3GKUA 4BSZA 1HH2P 4DR7C 1WH9A 4JI7C 4JI1C 2BJOA 4DCVA 1WF3A 4X65C 3JAMD 2ZM6C 1XNRC 2ASBA 1EGAA 4NXMC 2OPLA 4MH4A 1N34C 1KKGA 1FJGC 4B3SC 1VLAA 2HHHC 4DV1C 2ONFA 5IT9D 1IBMC 5BR8C 5LMNC 3T1HC 1N2FA 1UKKA 2UXDC 3I07A 2UXCC 2VQEC 4LFBC 4JI2C 1USPB 4X66C 2F4VC 4DR1C 4B3TC 3R9WA 4YHHC 3J80D 4DV2C
chains in the Genus database with same CATH superfamily
3AY0A 2D1RA 3GPCA 2Z51A 4RLQA 1HNXC 2M5HA 2MCQA 3IMLA 1USPA 1O93A 3E7XA 4JI6C 4LF7C 3VNSA 4X62C 4GXRA 1MKYA 1NYEA 3AF5A 4PUGA 1V25A 2E5LC 2YCBA 1PG4A 4DR3C 2P2FA 1O90A 5BUQA 4R0MA 4PZPA 3GR1A 4DV7C 1JOSA 1V60A 3PROC 2OPLB 2CXCA 1N33C 2PN2A 4DCSA 2E8FA 4KTTA 4YY3C 4LE5A 3A9UA 2PROA 1XNQC 4GKKC 4JV5C 4BC7A 3NYRA 4XX2A 2P2QA 4B3RC 4DUYC 2P20A 1L2FA 4LFCC 3J7AD 1NY8A 3O2EA 4D4IA 2ZTBA 3L8CA 4LF4C 3LNVA 3UX3A 1RY2A 4BSZA 4DR7C 4ZJZA 1XRBA 4BC9A 2ZM6C 5CZXA 3E7WA 4MH4A 1FJGC 4HPVA 2KZ0A 5BR8C 3S82A 2VQEC 4KTVA 1USPB 5AE2A 2DHMA 2BH1X 2MMAB 3VNRA 4X66C 5K8FA 2F4VC 4DR1C 3TDEA 3J80D 3T1HC 1GPMA 3FCCA 4MTNA 5K85A 4GS5A 2WD9A 2EGTA 1XRAA 4R1LA 1IBKC 1I94C 1PU1A 5E7QA 5LMUC 3ETOA 4OX9C 2PT7G 2XR1A 4G1IA 2JMPA 3DAYA 3DHVA 3N54B 3UOWA 4DR5C 1IBLC 4GXQA 4JI3C 3A25A 1V26A 3NPDA 2Y27A 4AQYC 4K0KC 4PROC 3IEVA 1PA4A 2UUCC 4L4QA 2QVZX 2ATWA 4RMNA 5H9UA 2QL8A 4PUIA 4DV5C 3A9VA 1XMOC 1M6XC 2UXBC 4WV3A 3K6RA 2AYAA 5T8SA 3PESA 1HNZC 4NXNC 4BCAA 1M6XA 3FM7A 3B7WA 4I9GA 2Y4NA 2CY1A 5A2QD 5BUSA 2UUAC 2UUBC 2D1TA 1ML8A 5AE3A 4DR2C 3EERA 3CW9A 2D7VA 1MD9A 3AF6A 2UU9C 4DR6C 1P4EC 4TPSB 4JI8C 1N32C 4RM3A 3LNOA 3GKUA 1HH2P 3A26A 4X65C 1XNRC 2QVYX 2YX1A 2OPLA 5BSUA 1KKGA 2D27A 1RG9A 5CZVA 3UEBA 1O9TA 3R44A 2KDNA 3FCEA 4JI2C 3UX2A 1QM4A 1LCIA 3RG2A 4DG8A 4JM1A 4YHHC 4L7IA 4PUHA 3G7SA 4OYCA 4ODJA 1FUGA 3H2TA 5BSRA 1MXCA 1N36C 4RVNA 2D1SA 3TQIA 4R1MA 4FUTA 3LUSA 5IWAC 5IFIA 1WCJA 2NCLA 2HJGA 1VEHA 1MXAA 1XMQC 1XHJA 5KYTA 3TR3A 4G36A 4DV3C 1O92A 4JI5C 4KHPC 5BSTA 3PBKA 4BBYA 3EQ6A 2E7GA 2E8CA 4RLFA 4LFAC 4LF5C 2KZFA 4ZLPA 1MXBA 3CQ1A 4LF9C 5KYVA 2MM9A 1HR0C 2V7BA 2JNVA 1LQLA 4LF8C 3T1YC 3C5EA 4RVOA 4D57A 1P7LA 4GKJC 3OTOC 3KXWA 5BSWA 1ULTA 3NI2A 4JI4C 3A4IA 1MDBA 3IEUA 1YGTA 4LF6C 4DV6C 4WS9A 1K0RA 2DPLA 2E8EA 4DV0C 1J5EC 3SO4A 4ISBA 5KEIA 2D1QA 2P2MA 5T8TA 4JI7C 2BJOA 5A19A 4DCVA 1WF3A 3JAMD 2ASBA 2YWCA 1P4EA 2HHHC 5IT9D 2E0GA 2YWBA 1IBMC 1YJ7A 4RM2A 5DV9A 1UKKA 4K0BA 3I07A 4FTFA 2P2JA 3UZ0A 4IZ6A 3RV2A 1XRCA 5A1GA 5BSMA 2M5OA 4DV2C 4OXIA 4DUZC 1IB8A 3GR0A 4L2ZA 1BA3A 4JI0C 2OO4A 3DLPX 2VZEA 2Y4OA 2ZZNA 4DV4C 3N2QA 5ADZA 2D28C 5BURA 2P02A 4DCUA 5GTDA 1QWIA 5AE1A 4NOZA 1ZB8A 4G37A 2VQFC 3TUFA 5FLXD 2QW0X 1ZB9A 1PG3A 2OBVA 4IR7A 4FUQA 4D4GA 3I08A 3IPLA 3NYQA 1MDFA 4DR4C 4JYAC 3CJEA 4X64C 1AMUA 4U5YD 1HNWC 3J81D 4D56A 4DCTA 4B3MC 2WP0C 3CQ2A 3L95X 3LGXA 4DG9A 1TH5A 2DYJA 2PG1E 2ZZMA 3ETCA 5A1IA 3R9XA 3CQ3A 1WH9A 4JI1C 2P2BA 1T5HX 3VNQA 1UWDA 1T5DX 1EGAA 4NXMC 2CU6A 4I9FA 5LCIA 5JRHA 1N34C 4B3SC 1VLAA 1XDXA 4DV1C 2ONFA 4PHTA 1FLOA 1XS3A 5BSVA 5LMNC 1N2FA 2UXDC 2UXCC 4LFBC 4EATA 3CW8X 2QVXX 4B3TC 3R9WA 4NDNA 3LAXA 2VSQA
chains in the Genus database with same CATH topology
2D1RA 3GPCA 4RLQA 1HNXC 3IMLA 1USPA 1O93A 3E7XA 4JI6C 4LF7C 3VNSA 4X62C 4GXRA 1MKYA 1NYEA 3AF5A 1V25A 2E5LC 2YCBA 1PG4A 4DR3C 2P2FA 1O90A 5BUQA 4R0MA 4PZPA 3GR1A 4DV7C 1JOSA 3PROC 2OPLB 2CXCA 1N33C 2PN2A 4DCSA 2E8FA 4KTTA 4YY3C 4LE5A 3A9UA 2PROA 1XNQC 4GKKC 4JV5C 4BC7A 3NYRA 4XX2A 2P2QA 4B3RC 4DUYC 2P20A 1L2FA 4LFCC 3J7AD 4D4IA 3L8CA 4LF4C 3LNVA 1RY2A 4BSZA 4DR7C 4ZJZA 1XRBA 4BC9A 2ZM6C 5CZXA 3E7WA 4MH4A 1FJGC 4HPVA 3S82A 5BR8C 2VQEC 4KTVA 1USPB 5AE2A 2BH1X 4X66C 3VNRA 5K8FA 2F4VC 4DR1C 3TDEA 3J80D 3T1HC 1GPMA 3FCCA 4MTNA 5K85A 4GS5A 2WD9A 2EGTA 1XRAA 4R1LA 1IBKC 1I94C 5E7QA 5LMUC 3ETOA 4OX9C 2PT7G 2XR1A 4G1IA 2JMPA 3DAYA 3DHVA 3N54B 3UOWA 4DR5C 1IBLC 4GXQA 4JI3C 3NPDA 1V26A 2Y27A 4AQYC 4K0KC 4PROC 3IEVA 1PA4A 2UUCC 4L4QA 2QVZX 2ATWA 4RMNA 5H9UA 2QL8A 4DV5C 3A9VA 1XMOC 2UXBC 4WV3A 2AYAA 5T8SA 3PESA 1HNZC 4NXNC 4BCAA 3B7WA 4I9GA 2Y4NA 2CY1A 5A2QD 5BUSA 2UUAC 2UUBC 2D1TA 1ML8A 5AE3A 4DR2C 3EERA 3CW9A 2D7VA 1MD9A 3AF6A 2UU9C 4DR6C 1N32C 4TPSB 4JI8C 4RM3A 3GKUA 1HH2P 4X65C 1XNRC 2QVYX 2OPLA 5BSUA 1KKGA 2D27A 1RG9A 5CZVA 1O9TA 3R44A 3FCEA 4JI2C 1QM4A 1LCIA 3RG2A 4DG8A 4JM1A 4YHHC 4L7IA 3G7SA 4OYCA 4ODJA 1FUGA 3H2TA 5BSRA 1MXCA 1N36C 4RVNA 2D1SA 3TQIA 4R1MA 4FUTA 3LUSA 5IWAC 5IFIA 2HJGA 1MXAA 1XMQC 5KYTA 4G36A 4DV3C 1O92A 4JI5C 4KHPC 5BSTA 3PBKA 4BBYA 3EQ6A 2E7GA 2E8CA 4RLFA 4LFAC 4LF5C 2KZFA 4ZLPA 1MXBA 4LF9C 5KYVA 1HR0C 2V7BA 1LQLA 4LF8C 3T1YC 3C5EA 4RVOA 4D57A 1P7LA 4GKJC 3OTOC 3KXWA 5BSWA 1ULTA 3NI2A 4JI4C 3A4IA 1MDBA 3IEUA 4LF6C 4DV6C 4WS9A 1K0RA 2DPLA 2E8EA 4DV0C 1J5EC 3SO4A 4ISBA 5KEIA 2D1QA 2P2MA 5T8TA 4JI7C 2BJOA 5A19A 4DCVA 1WF3A 3JAMD 2ASBA 2YWCA 2HHHC 5IT9D 2E0GA 2YWBA 1IBMC 1YJ7A 4RM2A 5DV9A 1UKKA 4K0BA 3I07A 4FTFA 2P2JA 3UZ0A 4IZ6A 3RV2A 1XRCA 5A1GA 5BSMA 4DV2C 4OXIA 4DUZC 3GR0A 4L2ZA 1BA3A 4JI0C 2OO4A 3DLPX 2VZEA 2Y4OA 4DV4C 3N2QA 5ADZA 2D28C 5BURA 2P02A 4DCUA 5GTDA 1QWIA 5AE1A 4NOZA 1ZB8A 4G37A 2VQFC 3TUFA 5FLXD 2QW0X 1ZB9A 1PG3A 2OBVA 4IR7A 4FUQA 4D4GA 3I08A 3IPLA 3NYQA 1MDFA 4DR4C 4JYAC 3CJEA 4X64C 1AMUA 4U5YD 1HNWC 3J81D 4D56A 4DCTA 4B3MC 2WP0C 3L95X 3LGXA 4DG9A 2DYJA 3ETCA 5A1IA 3R9XA 1WH9A 4JI1C 2P2BA 1T5HX 3VNQA 1T5DX 1EGAA 4NXMC 4I9FA 5JRHA 1N34C 4B3SC 1VLAA 4DV1C 2ONFA 4PHTA 5BSVA 5LMNC 1N2FA 2UXDC 2UXCC 4LFBC 4EATA 3CW8X 2QVXX 4B3TC 3R9WA 4NDNA 3LAXA 2VSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MTN A;  4DUZ C;  2EGT A;  1N36 C;  4JI0 C;  1IBK C;  1I94 C;  5LMU C;  1HNX C;  1USP A;  4OX9 C;  2PT7 G;  2XR1 A;  3LUS A;  2JMP A;  5IWA C;  2HJG A;  4JI6 C;  4DV4 C;  4DR5 C;  1XMQ C;  1IBL C;  4LF7 C;  4JI3 C;  4X62 C;  1MKY A;  3AF5 A;  1NYE A;  4AQY C;  4DCU A;  4K0K C;  4DV3 C;  1QWI A;  3IEV A;  2E5L C;  4JI5 C;  1PA4 A;  2YCB A;  4NOZ A;  1ZB8 A;  4KHP C;  2VQF C;  2UUC C;  4DR3 C;  2ATW A;  2E7G A;  2E8C A;  5FLX D;  2QL8 A;  4LFA C;  1ZB9 A;  4LF5 C;  4DV5 C;  2KZF A;  1XMO C;  2UXB C;  4DV7 C;  1JOS A;  4LF9 C;  2OPL B;  2CXC A;  1HNZ C;  1HR0 C;  4NXN C;  1LQL A;  4LF8 C;  1N33 C;  2PN2 A;  4DR4 C;  3T1Y C;  4JYA C;  3CJE A;  4DCS A;  4X64 C;  2E8F A;  4YY3 C;  4GKJ C;  1XNQ C;  3OTO C;  1HNW C;  3J81 D;  2CY1 A;  4GKK C;  4DCT A;  5A2Q D;  2UUA C;  4B3M C;  2UUB C;  4JV5 C;  4JI4 C;  1ML8 A;  4DR2 C;  2DYJ A;  3EER A;  4XX2 A;  3IEU A;  4B3R C;  4LF6 C;  4DUY C;  4DV6 C;  1L2F A;  2D7V A;  1K0R A;  4LFC C;  4DV0 C;  2E8E A;  3AF6 A;  2UU9 C;  3J7A D;  4DR6 C;  1N32 C;  4JI8 C;  3R9X A;  1J5E C;  4LF4 C;  3GKU A;  4BSZ A;  1HH2 P;  4DR7 C;  1WH9 A;  4JI7 C;  4JI1 C;  2BJO A;  4DCV A;  1WF3 A;  4X65 C;  3JAM D;  2ZM6 C;  1XNR C;  2ASB A;  1EGA A;  4NXM C;  2OPL A;  4MH4 A;  1N34 C;  1KKG A;  1FJG C;  4B3S C;  1VLA A;  2HHH C;  4DV1 C;  2ONF A;  5IT9 D;  1IBM C;  5BR8 C;  5LMN C;  3T1H C;  1N2F A;  1UKK A;  2UXD C;  3I07 A;  2UXC C;  2VQE C;  4LFB C;  4JI2 C;  1USP B;  4X66 C;  2F4V C;  4DR1 C;  4B3T C;  3R9W A;  4YHH C;  3J80 D;  4DV2 C; 
#chains in the Genus database with same CATH topology
 3AY0 A;  2D1R A;  3GPC A;  2Z51 A;  4RLQ A;  1HNX C;  2M5H A;  2MCQ A;  3IML A;  1USP A;  1O93 A;  3E7X A;  4JI6 C;  4LF7 C;  3VNS A;  4X62 C;  4GXR A;  1MKY A;  1NYE A;  3AF5 A;  4PUG A;  1V25 A;  2E5L C;  2YCB A;  1PG4 A;  4DR3 C;  2P2F A;  1O90 A;  5BUQ A;  4R0M A;  4PZP A;  3GR1 A;  4DV7 C;  1JOS A;  1V60 A;  3PRO C;  2OPL B;  2CXC A;  1N33 C;  2PN2 A;  4DCS A;  2E8F A;  4KTT A;  4YY3 C;  4LE5 A;  3A9U A;  2PRO A;  1XNQ C;  4GKK C;  4JV5 C;  4BC7 A;  3NYR A;  4XX2 A;  2P2Q A;  4B3R C;  4DUY C;  2P20 A;  1L2F A;  4LFC C;  3J7A D;  1NY8 A;  3O2E A;  4D4I A;  2ZTB A;  3L8C A;  4LF4 C;  3LNV A;  3UX3 A;  1RY2 A;  4BSZ A;  4DR7 C;  4ZJZ A;  1XRB A;  4BC9 A;  2ZM6 C;  5CZX A;  3E7W A;  4MH4 A;  1FJG C;  4HPV A;  2KZ0 A;  5BR8 C;  3S82 A;  2VQE C;  4KTV A;  1USP B;  5AE2 A;  2DHM A;  2BH1 X;  2MMA B;  3VNR A;  4X66 C;  5K8F A;  2F4V C;  4DR1 C;  3TDE A;  3J80 D;  3T1H C;  1GPM A;  3FCC A;  4MTN A;  5K85 A;  4GS5 A;  2WD9 A;  2EGT A;  1XRA A;  4R1L A;  1IBK C;  1I94 C;  1PU1 A;  5E7Q A;  5LMU C;  3ETO A;  4OX9 C;  2PT7 G;  2XR1 A;  4G1I A;  2JMP A;  3DAY A;  3DHV A;  3N54 B;  3UOW A;  4DR5 C;  1IBL C;  4GXQ A;  4JI3 C;  3A25 A;  1V26 A;  3NPD A;  2Y27 A;  4AQY C;  4K0K C;  4PRO C;  3IEV A;  1PA4 A;  2UUC C;  4L4Q A;  2QVZ X;  2ATW A;  4RMN A;  5H9U A;  2QL8 A;  4PUI A;  4DV5 C;  3A9V A;  1XMO C;  1M6X C;  2UXB C;  4WV3 A;  3K6R A;  2AYA A;  5T8S A;  3PES A;  1HNZ C;  4NXN C;  4BCA A;  1M6X A;  3FM7 A;  3B7W A;  4I9G A;  2Y4N A;  2CY1 A;  5A2Q D;  5BUS A;  2UUA C;  2UUB C;  2D1T A;  1ML8 A;  5AE3 A;  4DR2 C;  3EER A;  3CW9 A;  2D7V A;  1MD9 A;  3AF6 A;  2UU9 C;  4DR6 C;  1P4E C;  4TPS B;  4JI8 C;  1N32 C;  4RM3 A;  3LNO A;  3GKU A;  1HH2 P;  3A26 A;  4X65 C;  1XNR C;  2QVY X;  2YX1 A;  2OPL A;  5BSU A;  1KKG A;  2D27 A;  1RG9 A;  5CZV A;  3UEB A;  1O9T A;  3R44 A;  2KDN A;  3FCE A;  4JI2 C;  3UX2 A;  1QM4 A;  1LCI A;  3RG2 A;  4DG8 A;  4JM1 A;  4YHH C;  4L7I A;  4PUH A;  3G7S A;  4OYC A;  4ODJ A;  1FUG A;  3H2T A;  5BSR A;  1MXC A;  1N36 C;  4RVN A;  2D1S A;  3TQI A;  4R1M A;  4FUT A;  3LUS A;  5IWA C;  5IFI A;  1WCJ A;  2NCL A;  2HJG A;  1VEH A;  1MXA A;  1XMQ C;  1XHJ A;  5KYT A;  3TR3 A;  4G36 A;  4DV3 C;  1O92 A;  4JI5 C;  4KHP C;  5BST A;  3PBK A;  4BBY A;  3EQ6 A;  2E7G A;  2E8C A;  4RLF A;  4LFA C;  4LF5 C;  2KZF A;  4ZLP A;  1MXB A;  3CQ1 A;  4LF9 C;  5KYV A;  2MM9 A;  1HR0 C;  2V7B A;  2JNV A;  1LQL A;  4LF8 C;  3T1Y C;  3C5E A;  4RVO A;  4D57 A;  1P7L A;  4GKJ C;  3OTO C;  3KXW A;  5BSW A;  1ULT A;  3NI2 A;  4JI4 C;  3A4I A;  1MDB A;  3IEU A;  1YGT A;  4LF6 C;  4DV6 C;  4WS9 A;  1K0R A;  2DPL A;  2E8E A;  4DV0 C;  1J5E C;  3SO4 A;  4ISB A;  5KEI A;  2D1Q A;  2P2M A;  5T8T A;  4JI7 C;  2BJO A;  5A19 A;  4DCV A;  1WF3 A;  3JAM D;  2ASB A;  2YWC A;  1P4E A;  2HHH C;  5IT9 D;  2E0G A;  2YWB A;  1IBM C;  1YJ7 A;  4RM2 A;  5DV9 A;  1UKK A;  4K0B A;  3I07 A;  4FTF A;  2P2J A;  3UZ0 A;  4IZ6 A;  3RV2 A;  1XRC A;  5A1G A;  5BSM A;  2M5O A;  4DV2 C;  4OXI A;  4DUZ C;  1IB8 A;  3GR0 A;  4L2Z A;  1BA3 A;  4JI0 C;  2OO4 A;  3DLP X;  2VZE A;  2Y4O A;  2ZZN A;  4DV4 C;  3N2Q A;  5ADZ A;  2D28 C;  5BUR A;  2P02 A;  4DCU A;  5GTD A;  1QWI A;  5AE1 A;  4NOZ A;  1ZB8 A;  4G37 A;  2VQF C;  3TUF A;  5FLX D;  2QW0 X;  1ZB9 A;  1PG3 A;  2OBV A;  4IR7 A;  4FUQ A;  4D4G A;  3I08 A;  3IPL A;  3NYQ A;  1MDF A;  4DR4 C;  4JYA C;  3CJE A;  4X64 C;  1AMU A;  4U5Y D;  1HNW C;  3J81 D;  4D56 A;  4DCT A;  4B3M C;  2WP0 C;  3CQ2 A;  3L95 X;  3LGX A;  4DG9 A;  1TH5 A;  2DYJ A;  2PG1 E;  2ZZM A;  3ETC A;  5A1I A;  3R9X A;  3CQ3 A;  1WH9 A;  4JI1 C;  2P2B A;  1T5H X;  3VNQ A;  1UWD A;  1T5D X;  1EGA A;  4NXM C;  2CU6 A;  4I9F A;  5LCI A;  5JRH A;  1N34 C;  4B3S C;  1VLA A;  1XDX A;  4DV1 C;  2ONF A;  4PHT A;  1FLO A;  1XS3 A;  5BSV A;  5LMN C;  1N2F A;  2UXD C;  2UXC C;  4LFB C;  4EAT A;  3CW8 X;  2QVX X;  4B3T C;  3R9W A;  4NDN A;  3LAX A;  2VSQ A; 
#chains in the Genus database with same CATH homology
 2D1R A;  3GPC A;  4RLQ A;  1HNX C;  3IML A;  1USP A;  1O93 A;  3E7X A;  4JI6 C;  4LF7 C;  3VNS A;  4X62 C;  4GXR A;  1MKY A;  1NYE A;  3AF5 A;  1V25 A;  2E5L C;  2YCB A;  1PG4 A;  4DR3 C;  2P2F A;  1O90 A;  5BUQ A;  4R0M A;  4PZP A;  3GR1 A;  4DV7 C;  1JOS A;  3PRO C;  2OPL B;  2CXC A;  1N33 C;  2PN2 A;  4DCS A;  2E8F A;  4KTT A;  4YY3 C;  4LE5 A;  3A9U A;  2PRO A;  1XNQ C;  4GKK C;  4JV5 C;  4BC7 A;  3NYR A;  4XX2 A;  2P2Q A;  4B3R C;  4DUY C;  2P20 A;  1L2F A;  4LFC C;  3J7A D;  4D4I A;  3L8C A;  4LF4 C;  3LNV A;  1RY2 A;  4BSZ A;  4DR7 C;  4ZJZ A;  1XRB A;  4BC9 A;  2ZM6 C;  5CZX A;  3E7W A;  4MH4 A;  1FJG C;  4HPV A;  3S82 A;  5BR8 C;  2VQE C;  4KTV A;  1USP B;  5AE2 A;  2BH1 X;  4X66 C;  3VNR A;  5K8F A;  2F4V C;  4DR1 C;  3TDE A;  3J80 D;  3T1H C;  1GPM A;  3FCC A;  4MTN A;  5K85 A;  4GS5 A;  2WD9 A;  2EGT A;  1XRA A;  4R1L A;  1IBK C;  1I94 C;  5E7Q A;  5LMU C;  3ETO A;  4OX9 C;  2PT7 G;  2XR1 A;  4G1I A;  2JMP A;  3DAY A;  3DHV A;  3N54 B;  3UOW A;  4DR5 C;  1IBL C;  4GXQ A;  4JI3 C;  3NPD A;  1V26 A;  2Y27 A;  4AQY C;  4K0K C;  4PRO C;  3IEV A;  1PA4 A;  2UUC C;  4L4Q A;  2QVZ X;  2ATW A;  4RMN A;  5H9U A;  2QL8 A;  4DV5 C;  3A9V A;  1XMO C;  2UXB C;  4WV3 A;  2AYA A;  5T8S A;  3PES A;  1HNZ C;  4NXN C;  4BCA A;  3B7W A;  4I9G A;  2Y4N A;  2CY1 A;  5A2Q D;  5BUS A;  2UUA C;  2UUB C;  2D1T A;  1ML8 A;  5AE3 A;  4DR2 C;  3EER A;  3CW9 A;  2D7V A;  1MD9 A;  3AF6 A;  2UU9 C;  4DR6 C;  1N32 C;  4TPS B;  4JI8 C;  4RM3 A;  3GKU A;  1HH2 P;  4X65 C;  1XNR C;  2QVY X;  2OPL A;  5BSU A;  1KKG A;  2D27 A;  1RG9 A;  5CZV A;  1O9T A;  3R44 A;  3FCE A;  4JI2 C;  1QM4 A;  1LCI A;  3RG2 A;  4DG8 A;  4JM1 A;  4YHH C;  4L7I A;  3G7S A;  4OYC A;  4ODJ A;  1FUG A;  3H2T A;  5BSR A;  1MXC A;  1N36 C;  4RVN A;  2D1S A;  3TQI A;  4R1M A;  4FUT A;  3LUS A;  5IWA C;  5IFI A;  2HJG A;  1MXA A;  1XMQ C;  5KYT A;  4G36 A;  4DV3 C;  1O92 A;  4JI5 C;  4KHP C;  5BST A;  3PBK A;  4BBY A;  3EQ6 A;  2E7G A;  2E8C A;  4RLF A;  4LFA C;  4LF5 C;  2KZF A;  4ZLP A;  1MXB A;  4LF9 C;  5KYV A;  1HR0 C;  2V7B A;  1LQL A;  4LF8 C;  3T1Y C;  3C5E A;  4RVO A;  4D57 A;  1P7L A;  4GKJ C;  3OTO C;  3KXW A;  5BSW A;  1ULT A;  3NI2 A;  4JI4 C;  3A4I A;  1MDB A;  3IEU A;  4LF6 C;  4DV6 C;  4WS9 A;  1K0R A;  2DPL A;  2E8E A;  4DV0 C;  1J5E C;  3SO4 A;  4ISB A;  5KEI A;  2D1Q A;  2P2M A;  5T8T A;  4JI7 C;  2BJO A;  5A19 A;  4DCV A;  1WF3 A;  3JAM D;  2ASB A;  2YWC A;  2HHH C;  5IT9 D;  2E0G A;  2YWB A;  1IBM C;  1YJ7 A;  4RM2 A;  5DV9 A;  1UKK A;  4K0B A;  3I07 A;  4FTF A;  2P2J A;  3UZ0 A;  4IZ6 A;  3RV2 A;  1XRC A;  5A1G A;  5BSM A;  4DV2 C;  4OXI A;  4DUZ C;  3GR0 A;  4L2Z A;  1BA3 A;  4JI0 C;  2OO4 A;  3DLP X;  2VZE A;  2Y4O A;  4DV4 C;  3N2Q A;  5ADZ A;  2D28 C;  5BUR A;  2P02 A;  4DCU A;  5GTD A;  1QWI A;  5AE1 A;  4NOZ A;  1ZB8 A;  4G37 A;  2VQF C;  3TUF A;  5FLX D;  2QW0 X;  1ZB9 A;  1PG3 A;  2OBV A;  4IR7 A;  4FUQ A;  4D4G A;  3I08 A;  3IPL A;  3NYQ A;  1MDF A;  4DR4 C;  4JYA C;  3CJE A;  4X64 C;  1AMU A;  4U5Y D;  1HNW C;  3J81 D;  4D56 A;  4DCT A;  4B3M C;  2WP0 C;  3L95 X;  3LGX A;  4DG9 A;  2DYJ A;  3ETC A;  5A1I A;  3R9X A;  1WH9 A;  4JI1 C;  2P2B A;  1T5H X;  3VNQ A;  1T5D X;  1EGA A;  4NXM C;  4I9F A;  5JRH A;  1N34 C;  4B3S C;  1VLA A;  4DV1 C;  2ONF A;  4PHT A;  5BSV A;  5LMN C;  1N2F A;  2UXD C;  2UXC C;  4LFB C;  4EAT A;  3CW8 X;  2QVX X;  4B3T C;  3R9W A;  4NDN A;  3LAX A;  2VSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...