4JI6C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 57
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji6C02
2UXCC 4JV5C 2OPLA 1N2FA 4DR2C 1XNQC 4GKJC 3AF6A 1USPA 4JI7C 4DCSA 1LQLA 4DUZC 1IBLC 4X66C 2VQEC 1IBKC 1HNWC 4DV3C 5IT9D 2XR1A 1HNXC 1PA4A 1HH2P 4YY3C 4KHPC 1UKKA 3JAMD 2ONFA 2UUBC 2F4VC 4BSZA 4DV5C 2HHHC 4JI5C 4JI2C 3T1YC 4DR4C 3R9WA 4JI8C 2JMPA 1N34C 1N36C 2QL8A 4DV6C 5A2QD 1ZB8A 2PT7G 5LMNC 4DV4C 3AF5A 2KZFA 4NXMC 4LFBC 4LF6C 4K0KC 1WH9A 4B3SC 4JYAC 2BJOA 3IEVA 2UUCC 3GKUA 4DUYC 4X64C 3J80D 2ATWA 1XMQC 2E5LC 4X62C 4YHHC 1N33C 1HR0C 4LF5C 4OX9C 2HJGA 2DYJA 4JI6C 2E8EA 4B3RC 2OPLB 5FLXD 4LF8C 3CJEA 4DV2C 2VQFC 1NYEA 3J81D 4DR3C 1USPB 2ASBA 4JI4C 1QWIA 1N32C 5IWAC 2D7VA 2UXDC 2YCBA 5LMUC 4MTNA 4DV7C 4NXNC 2CXCA 2UXBC 1MKYA 4B3TC 1ZB9A 4LF9C 4DCTA 4X65C 3R9XA 4LF7C 4JI1C 4DR5C 1JOSA 1IBMC 4JI3C 2UUAC 4DR6C 3OTOC 2E8FA 4JI0C 1EGAA 1K0RA 4LFCC 1WF3A 3IEUA 4NOZA 1L2FA 4DV0C 4AQYC 3I07A 1FJGC 4DV1C 4LF4C 2ZM6C 4DCVA 3J7AD 3T1HC 2PN2A 2E7GA 4DR1C 4GKKC 2CY1A 4B3MC 2EGTA 4MH4A 1KKGA 4DCUA 3EERA 1VLAA 1XNRC 4DR7C 1ML8A 1J5EC 1XMOC 3LUSA 4LFAC 1HNZC 5BR8C 2E8CA 4XX2A 2UU9C 1I94C
chains in the Genus database with same CATH superfamily
2Y4NA 2OPLA 3UX3A 4KTTA 1XNQC 3AF6A 1P7LA 5LCIA 4X66C 2YWCA 1P4EA 1XRBA 1TH5A 2ZZMA 2YWBA 4YY3C 5AE1A 1O90A 2ONFA 3NPDA 1O9TA 1WCJA 2M5HA 1RY2A 2AYAA 4BCAA 4JI2C 3T1YC 4BC9A 3R9WA 1N34C 2QL8A 1M6XA 3TUFA 5A2QD 4RVOA 1ZB8A 1VEHA 3AF5A 4NXMC 3G7SA 2ZZNA 4B3SC 1QM4A 4BC7A 2E0GA 3EQ6A 3IMLA 2HJGA 3CQ1A 5T8SA 3AY0A 2OPLB 1O92A 3CJEA 2PG1E 1NYEA 2BH1X 3CQ3A 2P2JA 5IWAC 2P2MA 2D7VA 2WD9A 4DG9A 5BSMA 2VZEA 2KDNA 4NXNC 1V25A 3I08A 4IR7A 4RM2A 3E7XA 4LF9C 2MCQA 3K6RA 4DCTA 3R9XA 2DHMA 2D27A 3NYQA 4DR5C 2P2BA 5BUSA 5A19A 2D1SA 1EGAA 3L8CA 4JI0C 4LFCC 3E7WA 4FUTA 3GPCA 1L2FA 2QVYX 4LF4C 1P4EC 3T1HC 2PN2A 2KZ0A 2E7GA 4GKKC 4B3MC 1T5DX 4R1LA 1VLAA 4L4QA 1J5EC 5BR8C 2D1TA 1MDFA 2UU9C 1M6XC 4DR2C 4RVNA 3VNSA 4D56A 1NY8A 4U5YD 4DCSA 1LQLA 3FCEA 3RV2A 4OYCA 1HNWC 5BSUA 4KTVA 3SO4A 1HNXC 1PA4A 1PG3A 4KHPC 1XRCA 5BSVA 4JM1A 1MXCA 2JMPA 1N36C 3A26A 2PT7G 5LMNC 2OO4A 4G36A 2KZFA 2V7BA 4TPSB 2D28C 1MXBA 5JRHA 4K0KC 3LNVA 2UUCC 3GKUA 4PROC 4X64C 5KYTA 2ATWA 2Z51A 2E5LC 4RMNA 4PUGA 3A9UA 4X62C 3LAXA 3PBKA 4JI6C 4K0BA 5FLXD 4LF8C 3CQ2A 5AE3A 4DV2C 3LGXA 1QWIA 3IPLA 2UXDC 4MTNA 4PHTA 1MDBA 1MKYA 4L7IA 5T8TA 2JNVA 1IB8A 4ZJZA 2D1RA 4JI1C 1JOSA 1IBMC 4JI3C 3C5EA 3OTOC 4RLFA 1K0RA 3IEUA 4NOZA 4D4GA 4DV1C 1BA3A 1YJ7A 4DCVA 3J7AD 5KEIA 4EATA 2MM9A 2CY1A 2EGTA 4LE5A 3A25A 3LUSA 3TR3A 4LFAC 1HNZC 2D1QA 4IZ6A 3TDEA 2UXCC 4JV5C 5A1GA 5GTDA 3NYRA 2QVZX 3FCCA 4HPVA 4DUZC 1IBLC 4DV3C 5ADZA 2XR1A 3UEBA 4R0MA 4PZPA 2F4VC 4GXRA 4DV5C 2HHHC 4DR4C 5DV9A 3DLPX 4WS9A 3UZ0A 4DV4C 1PG4A 5K85A 1MD9A 4LF6C 4GS5A 4JYAC 2CU6A 3J80D 3N2QA 1XDXA 1XMQC 1ULTA 1RG9A 4YHHC 1HR0C 5AE2A 2P02A 2DYJA 3NI2A 1YGTA 4R1MA 3KXWA 3PROC 2E8EA 4B3RC 5KYVA 2DPLA 2ZTBA 1FLOA 2VQFC 2ASBA 4ODJA 1N32C 3DAYA 1GPMA 2YCBA 2MMAB 2PROA 1AMUA 3R44A 3UOWA 2YX1A 4RM3A 1LCIA 4L2ZA 5IFIA 3N54B 4X65C 4GXQA 4LF7C 1XS3A 4BBYA 2UUAC 4DR6C 5BSWA 2E8FA 1WF3A 2M5OA 4WV3A 3I07A 1FJGC 2ZM6C 3GR0A 3L95X 4DR1C 3TQIA 3A9VA 3UX2A 3RG2A 4I9FA 4PUHA 1XNRC 3CW9A 4PUIA 2E8CA 4NDNA 4XX2A 2P20A 3S82A 1XHJA 4FTFA 4I9GA 4G1IA 5BSRA 5BURA 1N2FA 3LNOA 4GKJC 4G37A 1USPA 2NCLA 4JI7C 1V60A 3B7WA 2VQEC 1IBKC 3CW8X 5IT9D 1UWDA 4RLQA 1HH2P 4ISBA 1UKKA 2QVXX 3JAMD 2UUBC 4BSZA 4JI5C 1PU1A 4DG8A 5BUQA 4JI8C 3A4IA 4DV6C 2QW0X 1FUGA 5CZVA 1O93A 1XRAA 4LFBC 4ZLPA 1T5HX 1WH9A 4FUQA 3VNRA 2BJOA 3IEVA 4DUYC 5K8FA 3ETCA 3DHVA 3PESA 1N33C 4LF5C 4OX9C 1V26A 5CZXA 2Y27A 3J81D 4DR3C 1USPB 4JI4C 3FM7A 3O2EA 5LMUC 4OXIA 3GR1A 4DV7C 5A1IA 2CXCA 2UXBC 4B3TC 2WP0C 1ZB9A 2P2FA 3H2TA 5H9UA 2VSQA 3ETOA 4D4IA 5E7QA 1MXAA 4AQYC 4DV0C 4D57A 2Y4OA 2OBVA 4MH4A 1KKGA 4DCUA 3EERA 4DR7C 1ML8A 3VNQA 1XMOC 2P2QA 1I94C 5BSTA
chains in the Genus database with same CATH topology
2Y4NA 2OPLA 4KTTA 1XNQC 3AF6A 1P7LA 4X66C 2YWCA 1XRBA 2YWBA 4YY3C 5AE1A 1O90A 2ONFA 3NPDA 1O9TA 1RY2A 2AYAA 4BCAA 4JI2C 3T1YC 4BC9A 3R9WA 1N34C 2QL8A 3TUFA 5A2QD 4RVOA 1ZB8A 3AF5A 4NXMC 3G7SA 4B3SC 1QM4A 4BC7A 2E0GA 3EQ6A 3IMLA 2HJGA 5T8SA 2OPLB 1O92A 3CJEA 1NYEA 2BH1X 2P2JA 5IWAC 2P2MA 2D7VA 2WD9A 4DG9A 5BSMA 2VZEA 4NXNC 1V25A 3I08A 4IR7A 4RM2A 3E7XA 4LF9C 4DCTA 3R9XA 3NYQA 2D27A 4DR5C 2P2BA 5BUSA 5A19A 2D1SA 1EGAA 3L8CA 4JI0C 4LFCC 3E7WA 4FUTA 3GPCA 1L2FA 2QVYX 4LF4C 3T1HC 2PN2A 2E7GA 4GKKC 4B3MC 1T5DX 4R1LA 1VLAA 4L4QA 1J5EC 5BR8C 2D1TA 1MDFA 2UU9C 4DR2C 4RVNA 3VNSA 4D56A 4U5YD 4DCSA 1LQLA 3FCEA 3RV2A 4OYCA 1HNWC 5BSUA 4KTVA 3SO4A 1HNXC 1PA4A 1PG3A 4KHPC 1XRCA 5BSVA 4JM1A 1MXCA 2JMPA 1N36C 2PT7G 5LMNC 2OO4A 4G36A 2KZFA 2V7BA 4TPSB 2D28C 1MXBA 5JRHA 4K0KC 3LNVA 2UUCC 3GKUA 4PROC 4X64C 5KYTA 2ATWA 2E5LC 4RMNA 3A9UA 4X62C 3LAXA 3PBKA 4JI6C 4K0BA 5FLXD 4LF8C 5AE3A 4DV2C 3LGXA 1QWIA 3IPLA 2UXDC 4MTNA 4PHTA 1MDBA 1MKYA 4L7IA 5T8TA 4ZJZA 2D1RA 4JI1C 1JOSA 1IBMC 4JI3C 3C5EA 3OTOC 4RLFA 1K0RA 3IEUA 4NOZA 4D4GA 4DV1C 1BA3A 1YJ7A 4DCVA 3J7AD 5KEIA 4EATA 2CY1A 2EGTA 4LE5A 3LUSA 4LFAC 1HNZC 2D1QA 4IZ6A 3TDEA 2UXCC 4JV5C 5A1GA 5GTDA 3NYRA 2QVZX 3FCCA 4HPVA 4DUZC 1IBLC 4DV3C 5ADZA 2XR1A 4R0MA 4PZPA 2F4VC 4GXRA 4DV5C 2HHHC 4DR4C 5DV9A 3DLPX 4WS9A 3UZ0A 4DV4C 1PG4A 5K85A 1MD9A 4LF6C 4GS5A 4JYAC 3J80D 3N2QA 1XMQC 1ULTA 1RG9A 4YHHC 1HR0C 5AE2A 2P02A 2DYJA 3NI2A 4R1MA 3KXWA 3PROC 2E8EA 4B3RC 5KYVA 2DPLA 2VQFC 2ASBA 4ODJA 1N32C 3DAYA 1GPMA 2YCBA 2PROA 1AMUA 3R44A 3UOWA 4RM3A 1LCIA 4L2ZA 5IFIA 3N54B 4X65C 4GXQA 4LF7C 4BBYA 2UUAC 4DR6C 5BSWA 2E8FA 1WF3A 4WV3A 3I07A 1FJGC 2ZM6C 3GR0A 3L95X 4DR1C 3TQIA 3A9VA 3RG2A 4I9FA 1XNRC 3CW9A 2E8CA 4NDNA 4XX2A 2P20A 3S82A 4FTFA 4I9GA 4G1IA 5BSRA 5BURA 1N2FA 4GKJC 4G37A 1USPA 4JI7C 3B7WA 2VQEC 1IBKC 3CW8X 5IT9D 4RLQA 1HH2P 4ISBA 1UKKA 2QVXX 3JAMD 2UUBC 4BSZA 4JI5C 4DG8A 5BUQA 4JI8C 3A4IA 4DV6C 2QW0X 1FUGA 5CZVA 1O93A 1XRAA 4LFBC 4ZLPA 1T5HX 1WH9A 4FUQA 3VNRA 2BJOA 3IEVA 4DUYC 5K8FA 3ETCA 3DHVA 3PESA 1N33C 4LF5C 4OX9C 1V26A 5CZXA 2Y27A 3J81D 4DR3C 1USPB 4JI4C 5LMUC 4OXIA 3GR1A 4DV7C 5A1IA 2CXCA 2UXBC 4B3TC 2WP0C 1ZB9A 2P2FA 3H2TA 5H9UA 2VSQA 3ETOA 4D4IA 5E7QA 1MXAA 4AQYC 4DV0C 4D57A 2Y4OA 2OBVA 4MH4A 1KKGA 4DCUA 3EERA 4DR7C 1ML8A 3VNQA 1XMOC 2P2QA 1I94C 5BSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC C;  4JV5 C;  2OPL A;  1N2F A;  4DR2 C;  1XNQ C;  4GKJ C;  3AF6 A;  1USP A;  4JI7 C;  4DCS A;  1LQL A;  4DUZ C;  1IBL C;  4X66 C;  2VQE C;  1IBK C;  1HNW C;  4DV3 C;  5IT9 D;  2XR1 A;  1HNX C;  1PA4 A;  1HH2 P;  4YY3 C;  4KHP C;  1UKK A;  3JAM D;  2ONF A;  2UUB C;  2F4V C;  4BSZ A;  4DV5 C;  2HHH C;  4JI5 C;  4JI2 C;  3T1Y C;  4DR4 C;  3R9W A;  4JI8 C;  2JMP A;  1N34 C;  1N36 C;  2QL8 A;  4DV6 C;  5A2Q D;  1ZB8 A;  2PT7 G;  5LMN C;  4DV4 C;  3AF5 A;  2KZF A;  4NXM C;  4LFB C;  4LF6 C;  4K0K C;  1WH9 A;  4B3S C;  4JYA C;  2BJO A;  3IEV A;  2UUC C;  3GKU A;  4DUY C;  4X64 C;  3J80 D;  2ATW A;  1XMQ C;  2E5L C;  4X62 C;  4YHH C;  1N33 C;  1HR0 C;  4LF5 C;  4OX9 C;  2HJG A;  2DYJ A;  4JI6 C;  2E8E A;  4B3R C;  2OPL B;  5FLX D;  4LF8 C;  3CJE A;  4DV2 C;  2VQF C;  1NYE A;  3J81 D;  4DR3 C;  1USP B;  2ASB A;  4JI4 C;  1QWI A;  1N32 C;  5IWA C;  2D7V A;  2UXD C;  2YCB A;  5LMU C;  4MTN A;  4DV7 C;  4NXN C;  2CXC A;  2UXB C;  1MKY A;  4B3T C;  1ZB9 A;  4LF9 C;  4DCT A;  4X65 C;  3R9X A;  4LF7 C;  4JI1 C;  4DR5 C;  1JOS A;  1IBM C;  4JI3 C;  2UUA C;  4DR6 C;  3OTO C;  2E8F A;  4JI0 C;  1EGA A;  1K0R A;  4LFC C;  1WF3 A;  3IEU A;  4NOZ A;  1L2F A;  4DV0 C;  4AQY C;  3I07 A;  1FJG C;  4DV1 C;  4LF4 C;  2ZM6 C;  4DCV A;  3J7A D;  3T1H C;  2PN2 A;  2E7G A;  4DR1 C;  4GKK C;  2CY1 A;  4B3M C;  2EGT A;  4MH4 A;  1KKG A;  4DCU A;  3EER A;  1VLA A;  1XNR C;  4DR7 C;  1ML8 A;  1J5E C;  1XMO C;  3LUS A;  4LFA C;  1HNZ C;  5BR8 C;  2E8C A;  4XX2 A;  2UU9 C;  1I94 C; 
#chains in the Genus database with same CATH topology
 2Y4N A;  2OPL A;  3UX3 A;  4KTT A;  1XNQ C;  3AF6 A;  1P7L A;  5LCI A;  4X66 C;  2YWC A;  1P4E A;  1XRB A;  1TH5 A;  2ZZM A;  2YWB A;  4YY3 C;  5AE1 A;  1O90 A;  2ONF A;  3NPD A;  1O9T A;  1WCJ A;  2M5H A;  1RY2 A;  2AYA A;  4BCA A;  4JI2 C;  3T1Y C;  4BC9 A;  3R9W A;  1N34 C;  2QL8 A;  1M6X A;  3TUF A;  5A2Q D;  4RVO A;  1ZB8 A;  1VEH A;  3AF5 A;  4NXM C;  3G7S A;  2ZZN A;  4B3S C;  1QM4 A;  4BC7 A;  2E0G A;  3EQ6 A;  3IML A;  2HJG A;  3CQ1 A;  5T8S A;  3AY0 A;  2OPL B;  1O92 A;  3CJE A;  2PG1 E;  1NYE A;  2BH1 X;  3CQ3 A;  2P2J A;  5IWA C;  2P2M A;  2D7V A;  2WD9 A;  4DG9 A;  5BSM A;  2VZE A;  2KDN A;  4NXN C;  1V25 A;  3I08 A;  4IR7 A;  4RM2 A;  3E7X A;  4LF9 C;  2MCQ A;  3K6R A;  4DCT A;  3R9X A;  2DHM A;  2D27 A;  3NYQ A;  4DR5 C;  2P2B A;  5BUS A;  5A19 A;  2D1S A;  1EGA A;  3L8C A;  4JI0 C;  4LFC C;  3E7W A;  4FUT A;  3GPC A;  1L2F A;  2QVY X;  4LF4 C;  1P4E C;  3T1H C;  2PN2 A;  2KZ0 A;  2E7G A;  4GKK C;  4B3M C;  1T5D X;  4R1L A;  1VLA A;  4L4Q A;  1J5E C;  5BR8 C;  2D1T A;  1MDF A;  2UU9 C;  1M6X C;  4DR2 C;  4RVN A;  3VNS A;  4D56 A;  1NY8 A;  4U5Y D;  4DCS A;  1LQL A;  3FCE A;  3RV2 A;  4OYC A;  1HNW C;  5BSU A;  4KTV A;  3SO4 A;  1HNX C;  1PA4 A;  1PG3 A;  4KHP C;  1XRC A;  5BSV A;  4JM1 A;  1MXC A;  2JMP A;  1N36 C;  3A26 A;  2PT7 G;  5LMN C;  2OO4 A;  4G36 A;  2KZF A;  2V7B A;  4TPS B;  2D28 C;  1MXB A;  5JRH A;  4K0K C;  3LNV A;  2UUC C;  3GKU A;  4PRO C;  4X64 C;  5KYT A;  2ATW A;  2Z51 A;  2E5L C;  4RMN A;  4PUG A;  3A9U A;  4X62 C;  3LAX A;  3PBK A;  4JI6 C;  4K0B A;  5FLX D;  4LF8 C;  3CQ2 A;  5AE3 A;  4DV2 C;  3LGX A;  1QWI A;  3IPL A;  2UXD C;  4MTN A;  4PHT A;  1MDB A;  1MKY A;  4L7I A;  5T8T A;  2JNV A;  1IB8 A;  4ZJZ A;  2D1R A;  4JI1 C;  1JOS A;  1IBM C;  4JI3 C;  3C5E A;  3OTO C;  4RLF A;  1K0R A;  3IEU A;  4NOZ A;  4D4G A;  4DV1 C;  1BA3 A;  1YJ7 A;  4DCV A;  3J7A D;  5KEI A;  4EAT A;  2MM9 A;  2CY1 A;  2EGT A;  4LE5 A;  3A25 A;  3LUS A;  3TR3 A;  4LFA C;  1HNZ C;  2D1Q A;  4IZ6 A;  3TDE A;  2UXC C;  4JV5 C;  5A1G A;  5GTD A;  3NYR A;  2QVZ X;  3FCC A;  4HPV A;  4DUZ C;  1IBL C;  4DV3 C;  5ADZ A;  2XR1 A;  3UEB A;  4R0M A;  4PZP A;  2F4V C;  4GXR A;  4DV5 C;  2HHH C;  4DR4 C;  5DV9 A;  3DLP X;  4WS9 A;  3UZ0 A;  4DV4 C;  1PG4 A;  5K85 A;  1MD9 A;  4LF6 C;  4GS5 A;  4JYA C;  2CU6 A;  3J80 D;  3N2Q A;  1XDX A;  1XMQ C;  1ULT A;  1RG9 A;  4YHH C;  1HR0 C;  5AE2 A;  2P02 A;  2DYJ A;  3NI2 A;  1YGT A;  4R1M A;  3KXW A;  3PRO C;  2E8E A;  4B3R C;  5KYV A;  2DPL A;  2ZTB A;  1FLO A;  2VQF C;  2ASB A;  4ODJ A;  1N32 C;  3DAY A;  1GPM A;  2YCB A;  2MMA B;  2PRO A;  1AMU A;  3R44 A;  3UOW A;  2YX1 A;  4RM3 A;  1LCI A;  4L2Z A;  5IFI A;  3N54 B;  4X65 C;  4GXQ A;  4LF7 C;  1XS3 A;  4BBY A;  2UUA C;  4DR6 C;  5BSW A;  2E8F A;  1WF3 A;  2M5O A;  4WV3 A;  3I07 A;  1FJG C;  2ZM6 C;  3GR0 A;  3L95 X;  4DR1 C;  3TQI A;  3A9V A;  3UX2 A;  3RG2 A;  4I9F A;  4PUH A;  1XNR C;  3CW9 A;  4PUI A;  2E8C A;  4NDN A;  4XX2 A;  2P20 A;  3S82 A;  1XHJ A;  4FTF A;  4I9G A;  4G1I A;  5BSR A;  5BUR A;  1N2F A;  3LNO A;  4GKJ C;  4G37 A;  1USP A;  2NCL A;  4JI7 C;  1V60 A;  3B7W A;  2VQE C;  1IBK C;  3CW8 X;  5IT9 D;  1UWD A;  4RLQ A;  1HH2 P;  4ISB A;  1UKK A;  2QVX X;  3JAM D;  2UUB C;  4BSZ A;  4JI5 C;  1PU1 A;  4DG8 A;  5BUQ A;  4JI8 C;  3A4I A;  4DV6 C;  2QW0 X;  1FUG A;  5CZV A;  1O93 A;  1XRA A;  4LFB C;  4ZLP A;  1T5H X;  1WH9 A;  4FUQ A;  3VNR A;  2BJO A;  3IEV A;  4DUY C;  5K8F A;  3ETC A;  3DHV A;  3PES A;  1N33 C;  4LF5 C;  4OX9 C;  1V26 A;  5CZX A;  2Y27 A;  3J81 D;  4DR3 C;  1USP B;  4JI4 C;  3FM7 A;  3O2E A;  5LMU C;  4OXI A;  3GR1 A;  4DV7 C;  5A1I A;  2CXC A;  2UXB C;  4B3T C;  2WP0 C;  1ZB9 A;  2P2F A;  3H2T A;  5H9U A;  2VSQ A;  3ETO A;  4D4I A;  5E7Q A;  1MXA A;  4AQY C;  4DV0 C;  4D57 A;  2Y4O A;  2OBV A;  4MH4 A;  1KKG A;  4DCU A;  3EER A;  4DR7 C;  1ML8 A;  3VNQ A;  1XMO C;  2P2Q A;  1I94 C;  5BST A; 
#chains in the Genus database with same CATH homology
 2Y4N A;  2OPL A;  4KTT A;  1XNQ C;  3AF6 A;  1P7L A;  4X66 C;  2YWC A;  1XRB A;  2YWB A;  4YY3 C;  5AE1 A;  1O90 A;  2ONF A;  3NPD A;  1O9T A;  1RY2 A;  2AYA A;  4BCA A;  4JI2 C;  3T1Y C;  4BC9 A;  3R9W A;  1N34 C;  2QL8 A;  3TUF A;  5A2Q D;  4RVO A;  1ZB8 A;  3AF5 A;  4NXM C;  3G7S A;  4B3S C;  1QM4 A;  4BC7 A;  2E0G A;  3EQ6 A;  3IML A;  2HJG A;  5T8S A;  2OPL B;  1O92 A;  3CJE A;  1NYE A;  2BH1 X;  2P2J A;  5IWA C;  2P2M A;  2D7V A;  2WD9 A;  4DG9 A;  5BSM A;  2VZE A;  4NXN C;  1V25 A;  3I08 A;  4IR7 A;  4RM2 A;  3E7X A;  4LF9 C;  4DCT A;  3R9X A;  3NYQ A;  2D27 A;  4DR5 C;  2P2B A;  5BUS A;  5A19 A;  2D1S A;  1EGA A;  3L8C A;  4JI0 C;  4LFC C;  3E7W A;  4FUT A;  3GPC A;  1L2F A;  2QVY X;  4LF4 C;  3T1H C;  2PN2 A;  2E7G A;  4GKK C;  4B3M C;  1T5D X;  4R1L A;  1VLA A;  4L4Q A;  1J5E C;  5BR8 C;  2D1T A;  1MDF A;  2UU9 C;  4DR2 C;  4RVN A;  3VNS A;  4D56 A;  4U5Y D;  4DCS A;  1LQL A;  3FCE A;  3RV2 A;  4OYC A;  1HNW C;  5BSU A;  4KTV A;  3SO4 A;  1HNX C;  1PA4 A;  1PG3 A;  4KHP C;  1XRC A;  5BSV A;  4JM1 A;  1MXC A;  2JMP A;  1N36 C;  2PT7 G;  5LMN C;  2OO4 A;  4G36 A;  2KZF A;  2V7B A;  4TPS B;  2D28 C;  1MXB A;  5JRH A;  4K0K C;  3LNV A;  2UUC C;  3GKU A;  4PRO C;  4X64 C;  5KYT A;  2ATW A;  2E5L C;  4RMN A;  3A9U A;  4X62 C;  3LAX A;  3PBK A;  4JI6 C;  4K0B A;  5FLX D;  4LF8 C;  5AE3 A;  4DV2 C;  3LGX A;  1QWI A;  3IPL A;  2UXD C;  4MTN A;  4PHT A;  1MDB A;  1MKY A;  4L7I A;  5T8T A;  4ZJZ A;  2D1R A;  4JI1 C;  1JOS A;  1IBM C;  4JI3 C;  3C5E A;  3OTO C;  4RLF A;  1K0R A;  3IEU A;  4NOZ A;  4D4G A;  4DV1 C;  1BA3 A;  1YJ7 A;  4DCV A;  3J7A D;  5KEI A;  4EAT A;  2CY1 A;  2EGT A;  4LE5 A;  3LUS A;  4LFA C;  1HNZ C;  2D1Q A;  4IZ6 A;  3TDE A;  2UXC C;  4JV5 C;  5A1G A;  5GTD A;  3NYR A;  2QVZ X;  3FCC A;  4HPV A;  4DUZ C;  1IBL C;  4DV3 C;  5ADZ A;  2XR1 A;  4R0M A;  4PZP A;  2F4V C;  4GXR A;  4DV5 C;  2HHH C;  4DR4 C;  5DV9 A;  3DLP X;  4WS9 A;  3UZ0 A;  4DV4 C;  1PG4 A;  5K85 A;  1MD9 A;  4LF6 C;  4GS5 A;  4JYA C;  3J80 D;  3N2Q A;  1XMQ C;  1ULT A;  1RG9 A;  4YHH C;  1HR0 C;  5AE2 A;  2P02 A;  2DYJ A;  3NI2 A;  4R1M A;  3KXW A;  3PRO C;  2E8E A;  4B3R C;  5KYV A;  2DPL A;  2VQF C;  2ASB A;  4ODJ A;  1N32 C;  3DAY A;  1GPM A;  2YCB A;  2PRO A;  1AMU A;  3R44 A;  3UOW A;  4RM3 A;  1LCI A;  4L2Z A;  5IFI A;  3N54 B;  4X65 C;  4GXQ A;  4LF7 C;  4BBY A;  2UUA C;  4DR6 C;  5BSW A;  2E8F A;  1WF3 A;  4WV3 A;  3I07 A;  1FJG C;  2ZM6 C;  3GR0 A;  3L95 X;  4DR1 C;  3TQI A;  3A9V A;  3RG2 A;  4I9F A;  1XNR C;  3CW9 A;  2E8C A;  4NDN A;  4XX2 A;  2P20 A;  3S82 A;  4FTF A;  4I9G A;  4G1I A;  5BSR A;  5BUR A;  1N2F A;  4GKJ C;  4G37 A;  1USP A;  4JI7 C;  3B7W A;  2VQE C;  1IBK C;  3CW8 X;  5IT9 D;  4RLQ A;  1HH2 P;  4ISB A;  1UKK A;  2QVX X;  3JAM D;  2UUB C;  4BSZ A;  4JI5 C;  4DG8 A;  5BUQ A;  4JI8 C;  3A4I A;  4DV6 C;  2QW0 X;  1FUG A;  5CZV A;  1O93 A;  1XRA A;  4LFB C;  4ZLP A;  1T5H X;  1WH9 A;  4FUQ A;  3VNR A;  2BJO A;  3IEV A;  4DUY C;  5K8F A;  3ETC A;  3DHV A;  3PES A;  1N33 C;  4LF5 C;  4OX9 C;  1V26 A;  5CZX A;  2Y27 A;  3J81 D;  4DR3 C;  1USP B;  4JI4 C;  5LMU C;  4OXI A;  3GR1 A;  4DV7 C;  5A1I A;  2CXC A;  2UXB C;  4B3T C;  2WP0 C;  1ZB9 A;  2P2F A;  3H2T A;  5H9U A;  2VSQ A;  3ETO A;  4D4I A;  5E7Q A;  1MXA A;  4AQY C;  4DV0 C;  4D57 A;  2Y4O A;  2OBV A;  4MH4 A;  1KKG A;  4DCU A;  3EER A;  4DR7 C;  1ML8 A;  3VNQ A;  1XMO C;  2P2Q A;  1I94 C;  5BST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...