4JI6C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 57
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji6C02
1XMQC 1ML8A 4DV5C 3CJEA 3AF6A 1HNZC 4B3MC 4LFAC 2VQEC 4B3RC 4LFBC 4KHPC 1JOSA 2JMPA 1L2FA 2UUAC 1KKGA 4LFCC 5A2QD 2EGTA 1IBLC 4X66C 5LMNC 4DCUA 3T1YC 4MH4A 2E8FA 4DR2C 4X64C 2D7VA 3IEVA 2F4VC 1MKYA 4NXMC 5IT9D 4K0KC 1USPB 4JI8C 1XMOC 3J7AD 4JYAC 1HNWC 4GKJC 3IEUA 4JI0C 4DR3C 1FJGC 2PT7G 4GKKC 4JI6C 4DR1C 1IBKC 5LMUC 4MTNA 2OPLA 4LF9C 3R9WA 1N36C 1WF3A 2UU9C 2E5LC 1QWIA 2CY1A 1PA4A 1USPA 4DR5C 4NOZA 2E7GA 4NXNC 2XR1A 2HJGA 2UUCC 2UXBC 4B3SC 1N33C 1NYEA 1ZB8A 3T1HC 5BR8C 3R9XA 3JAMD 4DCSA 1J5EC 4JI7C 4DR6C 4JI3C 4DV3C 2YCBA 5FLXD 3J81D 4LF5C 2BJOA 2DYJA 4OX9C 1LQLA 2ONFA 1UKKA 4JV5C 4DCVA 4LF6C 4DUYC 4AQYC 4LF4C 4DR4C 2E8CA 1N34C 4JI2C 5IWAC 1ZB9A 1WH9A 4XX2A 2QL8A 4YHHC 4JI5C 4LF7C 1HH2P 2HHHC 4LF8C 4DUZC 4DV4C 1XNQC 2ZM6C 2E8EA 2PN2A 4JI4C 4YY3C 1HNXC 3OTOC 2CXCA 1IBMC 4DV6C 1K0RA 2UXCC 4X65C 4DR7C 2OPLB 3J80D 4DV2C 4B3TC 2UUBC 4DV1C 3LUSA 2KZFA 3EERA 4DV0C 3GKUA 1XNRC 2ASBA 4JI1C 3AF5A 2ATWA 1N2FA 4BSZA 4DCTA 4X62C 4DV7C 1HR0C 1EGAA 1I94C 2UXDC 2VQFC 1N32C 3I07A 1VLAA
chains in the Genus database with same CATH superfamily
4BC9A 1ML8A 4DV5C 3CJEA 2VSQA 3AF6A 5AE2A 2VQEC 4KHPC 1L2FA 3H2TA 1KKGA 4LFCC 4X66C 1IB8A 5KYVA 3IEVA 4R1MA 4NXMC 4K0KC 4IZ6A 4GKJC 3IEUA 3E7XA 2PT7G 4RLFA 4GXQA 1WF3A 2E5LC 2BH1X 4L4QA 5AE1A 2MMAB 2QVZX 1O90A 1USPA 1PG4A 1T5DX 4DR5C 3GR0A 1AMUA 1NYEA 4RLQA 3N2QA 3C5EA 1BA3A 4FUQA 3PBKA 2ONFA 1UKKA 3RV2A 3ETCA 4JV5C 4GS5A 1M6XA 2AYAA 3A26A 5BSVA 2E8CA 2P20A 1WH9A 1P4EC 1ULTA 3CQ2A 4DG8A 3A4IA 4DV4C 4D57A 4NDNA 4FTFA 1IBMC 4BBYA 5GTDA 2UXCC 4RVNA 4X65C 4DR7C 4WS9A 3RG2A 2KZFA 3VNQA 4DV0C 2Y4OA 1MXBA 2DPLA 1N2FA 1T5HX 5ADZA 4DV7C 5KEIA 3TDEA 1I94C 2UXDC 1V60A 5BSRA 1XS3A 1MDFA 4I9GA 4LFAC 3IMLA 2WD9A 4D56A 3FM7A 3FCEA 3UEBA 4JM1A 2EGTA 2P2JA 5T8TA 3T1YC 4MH4A 4PROC 2V7BA 2D1TA 4X64C 4GXRA 5IT9D 1O93A 1XMOC 5BUSA 4DR3C 5K8FA 2M5HA 2OPLA 4LF9C 1MD9A 4ODJA 1MXCA 4G1IA 4BC7A 2CY1A 2XR1A 1P4EA 2UUCC 1ZB8A 2MM9A 3R9XA 2QVYX 4DCSA 1MXAA 2NCLA 2P02A 1VEHA 4JI3C 4DV3C 3I08A 4D4IA 2DHMA 2OO4A 3A9VA 5BURA 4DCVA 3E7WA 5BUQA 4LF6C 3L8CA 4DUYC 2OBVA 4G36A 4TPSB 4JI2C 3UOWA 4K0BA 5A1GA 1V26A 1YJ7A 1FUGA 3CW9A 2QVXX 2Y4NA 3UZ0A 1UWDA 3J80D 4DV2C 4B3TC 3DAYA 2UUBC 3LUSA 3SO4A 4PUHA 3TQIA 5K85A 3GKUA 1XNRC 4IR7A 3AF5A 2ATWA 4BSZA 4X62C 2D27A 3DHVA 2VZEA 3KXWA 1XDXA 2VQFC 3LNVA 1N32C 4G37A 1XMQC 3A9UA 4B3MC 3LNOA 3K6RA 4LFBC 4B3RC 4R0MA 4RVOA 4L2ZA 2PG1E 2UUAC 1XRBA 5A2QD 1IBLC 4DCUA 5LMNC 4PUGA 3GPCA 2Z51A 3PESA 1TH5A 5CZVA 2D7VA 3UX3A 4RMNA 2D1RA 2PROA 3J7AD 3IPLA 3L95X 1FJGC 4GKKC 5E7QA 1M6XC 4JI6C 4DR1C 1IBKC 2ZTBA 5BSWA 4MTNA 1FLOA 3R9WA 4RM2A 5H9UA 2UU9C 1XHJA 2YX1A 2D1QA 3R44A 2E7GA 4I9FA 4B3SC 3T1HC 5BR8C 1J5EC 4JI7C 2MCQA 2YCBA 3O2EA 5FLXD 3GR1A 3LAXA 4OYCA 4BCAA 2BJOA 1XRCA 4OX9C 4ZJZA 1P7LA 4FUTA 3S82A 5A19A 2P2BA 4AQYC 4LE5A 5IWAC 3TR3A 4YHHC 1NY8A 3VNSA 1HH2P 2KDNA 3DLPX 3LGXA 4LF8C 1XNQC 4ISBA 2P2MA 2ZZNA 2YWBA 2E8EA 1O9TA 2PN2A 1K0RA 4DV1C 5A1IA 4R1LA 3EERA 3PROC 2D28C 3B7WA 4DG9A 4DCTA 3CW8X 2CU6A 5BSMA 2UXBC 1VLAA 3G7SA 1GPMA 4L7IA 1HNZC 1JOSA 2JMPA 4D4GA 3FCCA 1YGTA 3TUFA 2E8FA 4DR2C 5AE3A 2ZZMA 5IFIA 2F4VC 1MKYA 4WV3A 2D1SA 3AY0A 4PHTA 4OXIA 5DV9A 1USPB 4JI8C 4JYAC 1HNWC 4JI0C 5LMUC 4ZLPA 3VNRA 2QW0X 1N36C 3NPDA 1QWIA 4HPVA 1PA4A 1V25A 4NOZA 4NXNC 2HJGA 1N33C 3JAMD 1WCJA 1LCIA 2Y27A 4DR6C 2P2FA 1MDBA 1XRAA 5CZXA 3J81D 4LF5C 4KTVA 1QM4A 5LCIA 2DYJA 1PU1A 1LQLA 5BSTA 4U5YD 5JRHA 1O92A 3NYQA 4LF4C 4DR4C 1N34C 1ZB9A 3CQ3A 4EATA 4XX2A 2QL8A 2E0GA 4JI5C 4LF7C 3CQ1A 3A25A 3ETOA 3UX2A 2HHHC 3N54B 4DUZC 4RM3A 2ZM6C 4JI4C 4YY3C 1HNXC 3OTOC 3EQ6A 2CXCA 2KZ0A 3NYRA 4PZPA 5KYTA 4DV6C 3NI2A 5T8SA 2JNVA 1RY2A 1PG3A 1RG9A 2OPLB 2YWCA 2ASBA 4JI1C 2WP0C 5BSUA 2P2QA 2M5OA 1HR0C 4PUIA 1EGAA 4KTTA 3I07A
chains in the Genus database with same CATH topology
4BC9A 1ML8A 4DV5C 3CJEA 2VSQA 3AF6A 5AE2A 2VQEC 4KHPC 1L2FA 3H2TA 1KKGA 4LFCC 4X66C 5KYVA 3IEVA 4R1MA 4NXMC 4K0KC 4IZ6A 4GKJC 3IEUA 3E7XA 2PT7G 4RLFA 4GXQA 1WF3A 2E5LC 2BH1X 4L4QA 5AE1A 2QVZX 1O90A 1USPA 1PG4A 1T5DX 4DR5C 3GR0A 1AMUA 1NYEA 4RLQA 3N2QA 3C5EA 1BA3A 4FUQA 3PBKA 2ONFA 1UKKA 3RV2A 3ETCA 4JV5C 4GS5A 2AYAA 5BSVA 2E8CA 2P20A 1WH9A 1ULTA 4DG8A 3A4IA 4DV4C 4D57A 4NDNA 4FTFA 1IBMC 4BBYA 5GTDA 2UXCC 4RVNA 4X65C 4DR7C 4WS9A 3RG2A 2KZFA 3VNQA 4DV0C 2Y4OA 1MXBA 2DPLA 1N2FA 1T5HX 5ADZA 4DV7C 5KEIA 3TDEA 1I94C 2UXDC 5BSRA 1MDFA 4I9GA 4LFAC 3IMLA 2WD9A 4D56A 3FCEA 4JM1A 2EGTA 2P2JA 5T8TA 3T1YC 4MH4A 4PROC 2V7BA 2D1TA 4X64C 4GXRA 5IT9D 1O93A 1XMOC 5BUSA 4DR3C 5K8FA 2OPLA 4LF9C 1MD9A 4ODJA 1MXCA 4G1IA 4BC7A 2CY1A 2XR1A 2UUCC 1ZB8A 3R9XA 2QVYX 4DCSA 1MXAA 2P02A 4JI3C 4DV3C 3I08A 4D4IA 2OO4A 3A9VA 5BURA 4DCVA 3E7WA 5BUQA 4LF6C 3L8CA 4DUYC 2OBVA 4G36A 4TPSB 4JI2C 3UOWA 4K0BA 5A1GA 1V26A 3I07A 1YJ7A 1FUGA 3CW9A 2QVXX 2Y4NA 3UZ0A 3J80D 4DV2C 4B3TC 3DAYA 2UUBC 3LUSA 3SO4A 3TQIA 5K85A 3GKUA 1XNRC 4IR7A 3AF5A 2ATWA 4BSZA 4X62C 2D27A 3DHVA 2VZEA 3KXWA 2VQFC 3LNVA 1N32C 4G37A 1XMQC 3A9UA 4B3MC 4LFBC 4B3RC 4R0MA 4RVOA 4L2ZA 2UUAC 1XRBA 5A2QD 1IBLC 4DCUA 5LMNC 3GPCA 3PESA 5CZVA 2D7VA 4RMNA 2D1RA 2PROA 3J7AD 3IPLA 3L95X 1FJGC 4GKKC 5E7QA 4JI6C 4DR1C 1IBKC 5BSWA 4MTNA 3R9WA 4RM2A 5H9UA 2UU9C 2D1QA 3R44A 2E7GA 4I9FA 4B3SC 3T1HC 5BR8C 1J5EC 4JI7C 2YCBA 5FLXD 3GR1A 3LAXA 4OYCA 4BCAA 2BJOA 1XRCA 4OX9C 4ZJZA 1P7LA 4FUTA 3S82A 5A19A 2P2BA 4AQYC 4LE5A 5IWAC 4YHHC 3VNSA 1HH2P 3DLPX 3LGXA 4LF8C 1XNQC 4ISBA 2P2MA 2YWBA 2E8EA 1O9TA 2PN2A 1K0RA 4DV1C 5A1IA 4R1LA 3EERA 3PROC 2D28C 3B7WA 4DG9A 4DCTA 3CW8X 5BSMA 2UXBC 1VLAA 3G7SA 1GPMA 4L7IA 1HNZC 1JOSA 2JMPA 4D4GA 3FCCA 3TUFA 2E8FA 4DR2C 5AE3A 5IFIA 2F4VC 1MKYA 4WV3A 2D1SA 4PHTA 4OXIA 5DV9A 1USPB 4JI8C 4JYAC 1HNWC 4JI0C 5LMUC 4ZLPA 3VNRA 2QW0X 1N36C 3NPDA 1QWIA 4HPVA 1PA4A 1V25A 4NOZA 4NXNC 2HJGA 1N33C 3JAMD 1LCIA 2Y27A 4DR6C 2P2FA 1MDBA 1XRAA 5CZXA 3J81D 4LF5C 4KTVA 1QM4A 2DYJA 1LQLA 5BSTA 4U5YD 5JRHA 1O92A 3NYQA 4LF4C 4DR4C 1N34C 1ZB9A 4EATA 4XX2A 2QL8A 2E0GA 4JI5C 4LF7C 3ETOA 2HHHC 3N54B 4DUZC 4RM3A 2ZM6C 4JI4C 4YY3C 1HNXC 3EQ6A 2CXCA 4PZPA 3NYRA 5KYTA 3OTOC 4DV6C 3NI2A 5T8SA 1RY2A 1PG3A 1RG9A 2OPLB 2YWCA 2ASBA 4JI1C 2WP0C 5BSUA 2P2QA 1EGAA 4KTTA 1HR0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ C;  1ML8 A;  4DV5 C;  3CJE A;  3AF6 A;  1HNZ C;  4B3M C;  4LFA C;  2VQE C;  4B3R C;  4LFB C;  4KHP C;  1JOS A;  2JMP A;  1L2F A;  2UUA C;  1KKG A;  4LFC C;  5A2Q D;  2EGT A;  1IBL C;  4X66 C;  5LMN C;  4DCU A;  3T1Y C;  4MH4 A;  2E8F A;  4DR2 C;  4X64 C;  2D7V A;  3IEV A;  2F4V C;  1MKY A;  4NXM C;  5IT9 D;  4K0K C;  1USP B;  4JI8 C;  1XMO C;  3J7A D;  4JYA C;  1HNW C;  4GKJ C;  3IEU A;  4JI0 C;  4DR3 C;  1FJG C;  2PT7 G;  4GKK C;  4JI6 C;  4DR1 C;  1IBK C;  5LMU C;  4MTN A;  2OPL A;  4LF9 C;  3R9W A;  1N36 C;  1WF3 A;  2UU9 C;  2E5L C;  1QWI A;  2CY1 A;  1PA4 A;  1USP A;  4DR5 C;  4NOZ A;  2E7G A;  4NXN C;  2XR1 A;  2HJG A;  2UUC C;  2UXB C;  4B3S C;  1N33 C;  1NYE A;  1ZB8 A;  3T1H C;  5BR8 C;  3R9X A;  3JAM D;  4DCS A;  1J5E C;  4JI7 C;  4DR6 C;  4JI3 C;  4DV3 C;  2YCB A;  5FLX D;  3J81 D;  4LF5 C;  2BJO A;  2DYJ A;  4OX9 C;  1LQL A;  2ONF A;  1UKK A;  4JV5 C;  4DCV A;  4LF6 C;  4DUY C;  4AQY C;  4LF4 C;  4DR4 C;  2E8C A;  1N34 C;  4JI2 C;  5IWA C;  1ZB9 A;  1WH9 A;  4XX2 A;  2QL8 A;  4YHH C;  4JI5 C;  4LF7 C;  1HH2 P;  2HHH C;  4LF8 C;  4DUZ C;  4DV4 C;  1XNQ C;  2ZM6 C;  2E8E A;  2PN2 A;  4JI4 C;  4YY3 C;  1HNX C;  3OTO C;  2CXC A;  1IBM C;  4DV6 C;  1K0R A;  2UXC C;  4X65 C;  4DR7 C;  2OPL B;  3J80 D;  4DV2 C;  4B3T C;  2UUB C;  4DV1 C;  3LUS A;  2KZF A;  3EER A;  4DV0 C;  3GKU A;  1XNR C;  2ASB A;  4JI1 C;  3AF5 A;  2ATW A;  1N2F A;  4BSZ A;  4DCT A;  4X62 C;  4DV7 C;  1HR0 C;  1EGA A;  1I94 C;  2UXD C;  2VQF C;  1N32 C;  3I07 A;  1VLA A; 
#chains in the Genus database with same CATH topology
 4BC9 A;  1ML8 A;  4DV5 C;  3CJE A;  2VSQ A;  3AF6 A;  5AE2 A;  2VQE C;  4KHP C;  1L2F A;  3H2T A;  1KKG A;  4LFC C;  4X66 C;  1IB8 A;  5KYV A;  3IEV A;  4R1M A;  4NXM C;  4K0K C;  4IZ6 A;  4GKJ C;  3IEU A;  3E7X A;  2PT7 G;  4RLF A;  4GXQ A;  1WF3 A;  2E5L C;  2BH1 X;  4L4Q A;  5AE1 A;  2MMA B;  2QVZ X;  1O90 A;  1USP A;  1PG4 A;  1T5D X;  4DR5 C;  3GR0 A;  1AMU A;  1NYE A;  4RLQ A;  3N2Q A;  3C5E A;  1BA3 A;  4FUQ A;  3PBK A;  2ONF A;  1UKK A;  3RV2 A;  3ETC A;  4JV5 C;  4GS5 A;  1M6X A;  2AYA A;  3A26 A;  5BSV A;  2E8C A;  2P20 A;  1WH9 A;  1P4E C;  1ULT A;  3CQ2 A;  4DG8 A;  3A4I A;  4DV4 C;  4D57 A;  4NDN A;  4FTF A;  1IBM C;  4BBY A;  5GTD A;  2UXC C;  4RVN A;  4X65 C;  4DR7 C;  4WS9 A;  3RG2 A;  2KZF A;  3VNQ A;  4DV0 C;  2Y4O A;  1MXB A;  2DPL A;  1N2F A;  1T5H X;  5ADZ A;  4DV7 C;  5KEI A;  3TDE A;  1I94 C;  2UXD C;  1V60 A;  5BSR A;  1XS3 A;  1MDF A;  4I9G A;  4LFA C;  3IML A;  2WD9 A;  4D56 A;  3FM7 A;  3FCE A;  3UEB A;  4JM1 A;  2EGT A;  2P2J A;  5T8T A;  3T1Y C;  4MH4 A;  4PRO C;  2V7B A;  2D1T A;  4X64 C;  4GXR A;  5IT9 D;  1O93 A;  1XMO C;  5BUS A;  4DR3 C;  5K8F A;  2M5H A;  2OPL A;  4LF9 C;  1MD9 A;  4ODJ A;  1MXC A;  4G1I A;  4BC7 A;  2CY1 A;  2XR1 A;  1P4E A;  2UUC C;  1ZB8 A;  2MM9 A;  3R9X A;  2QVY X;  4DCS A;  1MXA A;  2NCL A;  2P02 A;  1VEH A;  4JI3 C;  4DV3 C;  3I08 A;  4D4I A;  2DHM A;  2OO4 A;  3A9V A;  5BUR A;  4DCV A;  3E7W A;  5BUQ A;  4LF6 C;  3L8C A;  4DUY C;  2OBV A;  4G36 A;  4TPS B;  4JI2 C;  3UOW A;  4K0B A;  5A1G A;  1V26 A;  1YJ7 A;  1FUG A;  3CW9 A;  2QVX X;  2Y4N A;  3UZ0 A;  1UWD A;  3J80 D;  4DV2 C;  4B3T C;  3DAY A;  2UUB C;  3LUS A;  3SO4 A;  4PUH A;  3TQI A;  5K85 A;  3GKU A;  1XNR C;  4IR7 A;  3AF5 A;  2ATW A;  4BSZ A;  4X62 C;  2D27 A;  3DHV A;  2VZE A;  3KXW A;  1XDX A;  2VQF C;  3LNV A;  1N32 C;  4G37 A;  1XMQ C;  3A9U A;  4B3M C;  3LNO A;  3K6R A;  4LFB C;  4B3R C;  4R0M A;  4RVO A;  4L2Z A;  2PG1 E;  2UUA C;  1XRB A;  5A2Q D;  1IBL C;  4DCU A;  5LMN C;  4PUG A;  3GPC A;  2Z51 A;  3PES A;  1TH5 A;  5CZV A;  2D7V A;  3UX3 A;  4RMN A;  2D1R A;  2PRO A;  3J7A D;  3IPL A;  3L95 X;  1FJG C;  4GKK C;  5E7Q A;  1M6X C;  4JI6 C;  4DR1 C;  1IBK C;  2ZTB A;  5BSW A;  4MTN A;  1FLO A;  3R9W A;  4RM2 A;  5H9U A;  2UU9 C;  1XHJ A;  2YX1 A;  2D1Q A;  3R44 A;  2E7G A;  4I9F A;  4B3S C;  3T1H C;  5BR8 C;  1J5E C;  4JI7 C;  2MCQ A;  2YCB A;  3O2E A;  5FLX D;  3GR1 A;  3LAX A;  4OYC A;  4BCA A;  2BJO A;  1XRC A;  4OX9 C;  4ZJZ A;  1P7L A;  4FUT A;  3S82 A;  5A19 A;  2P2B A;  4AQY C;  4LE5 A;  5IWA C;  3TR3 A;  4YHH C;  1NY8 A;  3VNS A;  1HH2 P;  2KDN A;  3DLP X;  3LGX A;  4LF8 C;  1XNQ C;  4ISB A;  2P2M A;  2ZZN A;  2YWB A;  2E8E A;  1O9T A;  2PN2 A;  1K0R A;  4DV1 C;  5A1I A;  4R1L A;  3EER A;  3PRO C;  2D28 C;  3B7W A;  4DG9 A;  4DCT A;  3CW8 X;  2CU6 A;  5BSM A;  2UXB C;  1VLA A;  3G7S A;  1GPM A;  4L7I A;  1HNZ C;  1JOS A;  2JMP A;  4D4G A;  3FCC A;  1YGT A;  3TUF A;  2E8F A;  4DR2 C;  5AE3 A;  2ZZM A;  5IFI A;  2F4V C;  1MKY A;  4WV3 A;  2D1S A;  3AY0 A;  4PHT A;  4OXI A;  5DV9 A;  1USP B;  4JI8 C;  4JYA C;  1HNW C;  4JI0 C;  5LMU C;  4ZLP A;  3VNR A;  2QW0 X;  1N36 C;  3NPD A;  1QWI A;  4HPV A;  1PA4 A;  1V25 A;  4NOZ A;  4NXN C;  2HJG A;  1N33 C;  3JAM D;  1WCJ A;  1LCI A;  2Y27 A;  4DR6 C;  2P2F A;  1MDB A;  1XRA A;  5CZX A;  3J81 D;  4LF5 C;  4KTV A;  1QM4 A;  5LCI A;  2DYJ A;  1PU1 A;  1LQL A;  5BST A;  4U5Y D;  5JRH A;  1O92 A;  3NYQ A;  4LF4 C;  4DR4 C;  1N34 C;  1ZB9 A;  3CQ3 A;  4EAT A;  4XX2 A;  2QL8 A;  2E0G A;  4JI5 C;  4LF7 C;  3CQ1 A;  3A25 A;  3ETO A;  3UX2 A;  2HHH C;  3N54 B;  4DUZ C;  4RM3 A;  2ZM6 C;  4JI4 C;  4YY3 C;  1HNX C;  3OTO C;  3EQ6 A;  2CXC A;  2KZ0 A;  3NYR A;  4PZP A;  5KYT A;  4DV6 C;  3NI2 A;  5T8S A;  2JNV A;  1RY2 A;  1PG3 A;  1RG9 A;  2OPL B;  2YWC A;  2ASB A;  4JI1 C;  2WP0 C;  5BSU A;  2P2Q A;  2M5O A;  1HR0 C;  4PUI A;  1EGA A;  4KTT A;  3I07 A; 
#chains in the Genus database with same CATH homology
 4BC9 A;  1ML8 A;  4DV5 C;  3CJE A;  2VSQ A;  3AF6 A;  5AE2 A;  2VQE C;  4KHP C;  1L2F A;  3H2T A;  1KKG A;  4LFC C;  4X66 C;  5KYV A;  3IEV A;  4R1M A;  4NXM C;  4K0K C;  4IZ6 A;  4GKJ C;  3IEU A;  3E7X A;  2PT7 G;  4RLF A;  4GXQ A;  1WF3 A;  2E5L C;  2BH1 X;  4L4Q A;  5AE1 A;  2QVZ X;  1O90 A;  1USP A;  1PG4 A;  1T5D X;  4DR5 C;  3GR0 A;  1AMU A;  1NYE A;  4RLQ A;  3N2Q A;  3C5E A;  1BA3 A;  4FUQ A;  3PBK A;  2ONF A;  1UKK A;  3RV2 A;  3ETC A;  4JV5 C;  4GS5 A;  2AYA A;  5BSV A;  2E8C A;  2P20 A;  1WH9 A;  1ULT A;  4DG8 A;  3A4I A;  4DV4 C;  4D57 A;  4NDN A;  4FTF A;  1IBM C;  4BBY A;  5GTD A;  2UXC C;  4RVN A;  4X65 C;  4DR7 C;  4WS9 A;  3RG2 A;  2KZF A;  3VNQ A;  4DV0 C;  2Y4O A;  1MXB A;  2DPL A;  1N2F A;  1T5H X;  5ADZ A;  4DV7 C;  5KEI A;  3TDE A;  1I94 C;  2UXD C;  5BSR A;  1MDF A;  4I9G A;  4LFA C;  3IML A;  2WD9 A;  4D56 A;  3FCE A;  4JM1 A;  2EGT A;  2P2J A;  5T8T A;  3T1Y C;  4MH4 A;  4PRO C;  2V7B A;  2D1T A;  4X64 C;  4GXR A;  5IT9 D;  1O93 A;  1XMO C;  5BUS A;  4DR3 C;  5K8F A;  2OPL A;  4LF9 C;  1MD9 A;  4ODJ A;  1MXC A;  4G1I A;  4BC7 A;  2CY1 A;  2XR1 A;  2UUC C;  1ZB8 A;  3R9X A;  2QVY X;  4DCS A;  1MXA A;  2P02 A;  4JI3 C;  4DV3 C;  3I08 A;  4D4I A;  2OO4 A;  3A9V A;  5BUR A;  4DCV A;  3E7W A;  5BUQ A;  4LF6 C;  3L8C A;  4DUY C;  2OBV A;  4G36 A;  4TPS B;  4JI2 C;  3UOW A;  4K0B A;  5A1G A;  1V26 A;  3I07 A;  1YJ7 A;  1FUG A;  3CW9 A;  2QVX X;  2Y4N A;  3UZ0 A;  3J80 D;  4DV2 C;  4B3T C;  3DAY A;  2UUB C;  3LUS A;  3SO4 A;  3TQI A;  5K85 A;  3GKU A;  1XNR C;  4IR7 A;  3AF5 A;  2ATW A;  4BSZ A;  4X62 C;  2D27 A;  3DHV A;  2VZE A;  3KXW A;  2VQF C;  3LNV A;  1N32 C;  4G37 A;  1XMQ C;  3A9U A;  4B3M C;  4LFB C;  4B3R C;  4R0M A;  4RVO A;  4L2Z A;  2UUA C;  1XRB A;  5A2Q D;  1IBL C;  4DCU A;  5LMN C;  3GPC A;  3PES A;  5CZV A;  2D7V A;  4RMN A;  2D1R A;  2PRO A;  3J7A D;  3IPL A;  3L95 X;  1FJG C;  4GKK C;  5E7Q A;  4JI6 C;  4DR1 C;  1IBK C;  5BSW A;  4MTN A;  3R9W A;  4RM2 A;  5H9U A;  2UU9 C;  2D1Q A;  3R44 A;  2E7G A;  4I9F A;  4B3S C;  3T1H C;  5BR8 C;  1J5E C;  4JI7 C;  2YCB A;  5FLX D;  3GR1 A;  3LAX A;  4OYC A;  4BCA A;  2BJO A;  1XRC A;  4OX9 C;  4ZJZ A;  1P7L A;  4FUT A;  3S82 A;  5A19 A;  2P2B A;  4AQY C;  4LE5 A;  5IWA C;  4YHH C;  3VNS A;  1HH2 P;  3DLP X;  3LGX A;  4LF8 C;  1XNQ C;  4ISB A;  2P2M A;  2YWB A;  2E8E A;  1O9T A;  2PN2 A;  1K0R A;  4DV1 C;  5A1I A;  4R1L A;  3EER A;  3PRO C;  2D28 C;  3B7W A;  4DG9 A;  4DCT A;  3CW8 X;  5BSM A;  2UXB C;  1VLA A;  3G7S A;  1GPM A;  4L7I A;  1HNZ C;  1JOS A;  2JMP A;  4D4G A;  3FCC A;  3TUF A;  2E8F A;  4DR2 C;  5AE3 A;  5IFI A;  2F4V C;  1MKY A;  4WV3 A;  2D1S A;  4PHT A;  4OXI A;  5DV9 A;  1USP B;  4JI8 C;  4JYA C;  1HNW C;  4JI0 C;  5LMU C;  4ZLP A;  3VNR A;  2QW0 X;  1N36 C;  3NPD A;  1QWI A;  4HPV A;  1PA4 A;  1V25 A;  4NOZ A;  4NXN C;  2HJG A;  1N33 C;  3JAM D;  1LCI A;  2Y27 A;  4DR6 C;  2P2F A;  1MDB A;  1XRA A;  5CZX A;  3J81 D;  4LF5 C;  4KTV A;  1QM4 A;  2DYJ A;  1LQL A;  5BST A;  4U5Y D;  5JRH A;  1O92 A;  3NYQ A;  4LF4 C;  4DR4 C;  1N34 C;  1ZB9 A;  4EAT A;  4XX2 A;  2QL8 A;  2E0G A;  4JI5 C;  4LF7 C;  3ETO A;  2HHH C;  3N54 B;  4DUZ C;  4RM3 A;  2ZM6 C;  4JI4 C;  4YY3 C;  1HNX C;  3EQ6 A;  2CXC A;  4PZP A;  3NYR A;  5KYT A;  3OTO C;  4DV6 C;  3NI2 A;  5T8S A;  1RY2 A;  1PG3 A;  1RG9 A;  2OPL B;  2YWC A;  2ASB A;  4JI1 C;  2WP0 C;  5BSU A;  2P2Q A;  1EGA A;  4KTT A;  1HR0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...