1N36C

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 32
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1n36C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1n36C02
2UUAC 4X62C 1ZB8A 4B3TC 1JOSA 2VQEC 1ML8A 4DR6C 4DUZC 2KZFA 4JI2C 3CJEA 2PN2A 4DCVA 2ZM6C 1HH2P 2UXCC 2UUCC 3AF5A 4JI8C 3R9XA 5LMNC 5BR8C 2EGTA 2E8CA 2BJOA 2HHHC 4DCTA 4GKKC 4X66C 2OPLA 4JI6C 2UU9C 4AQYC 4JV5C 4KHPC 4YY3C 2HJGA 1WF3A 3EERA 4JI5C 2E7GA 3T1YC 4DCUA 1USPA 4B3SC 3IEUA 4DV6C 1XNQC 2CXCA 1XMQC 4LFAC 3IEVA 1N2FA 3J80D 4DR5C 4JI3C 4JI4C 1IBKC 4X64C 1NYEA 4NXNC 1FJGC 4LF9C 1IBLC 5LMUC 1K0RA 2E8FA 2YCBA 3R9WA 1VLAA 4BSZA 5A2QD 4DV4C 5FLXD 4JI7C 4DV3C 4LF5C 4DUYC 4MH4A 3J81D 1J5EC 2ASBA 4X65C 4LF8C 1L2FA 4LFCC 4NXMC 2UUBC 1HNXC 3LUSA 2E8EA 1XMOC 4B3MC 4DCSA 4OX9C 4DR4C 3GKUA 4DR3C 1HR0C 4JYAC 3JAMD 4MTNA 1I94C 1HNZC 3OTOC 1MKYA 2F4VC 1N34C 2JMPA 4XX2A 4JI0C 4LF6C 1EGAA 5IT9D 4B3RC 4K0KC 2D7VA 2E5LC 1IBMC 2QL8A 1LQLA 3I07A 4NOZA 1UKKA 1WH9A 2CY1A 4DR2C 2UXBC 5IWAC 1XNRC 2XR1A 4DV5C 4DR7C 1ZB9A 2DYJA 2ATWA 1KKGA 2UXDC 1N36C 4LFBC 2OPLB 3J7AD 1N32C 1PA4A 2VQFC 4DV2C 3T1HC 4DV7C 4LF7C 4GKJC 4DV1C 1N33C 4DV0C 4JI1C 4LF4C 1HNWC 1USPB 4YHHC 3AF6A 2ONFA 4DR1C 1QWIA 2PT7G
chains in the Genus database with same CATH superfamily
5ADZA 4X62C 1P4EA 4KTTA 2YWCA 2P2JA 3VNSA 4DUZC 2KZFA 3CJEA 4DCVA 1V25A 1O90A 3GR0A 3R9XA 5LMNC 5BR8C 3C5EA 2EGTA 2BJOA 4RLFA 4DCTA 4JI6C 4OXIA 4AQYC 2WP0C 5KYTA 2HJGA 2Y4NA 2M5HA 4B3SC 4NDNA 4G37A 5BSWA 3UX3A 4LFAC 4FUTA 1N2FA 2VZEA 2JNVA 4DR5C 3UOWA 4JI3C 4JI4C 4BBYA 1NYEA 1FJGC 4GXRA 1IBLC 1BA3A 5LMUC 2E8FA 2ZZMA 2YCBA 4D57A 5DV9A 3RV2A 3L95X 5A2QD 4IZ6A 4ISBA 4LF5C 2MCQA 5K8FA 3J81D 4FUQA 5IFIA 4LF8C 4LFCC 4NXMC 3VNQA 3LUSA 1XMOC 4B3MC 4OX9C 1TH5A 3CQ3A 2Y4OA 2D27A 2OBVA 1IB8A 3LNVA 2F4VC 1P4EC 4RM2A 1MXCA 1O9TA 3I07A 2QVZX 3DLPX 1UKKA 3DHVA 2UXBC 5IWAC 1XNRC 2XR1A 1UWDA 1ULTA 2NCLA 4DR7C 1ZB9A 1PG3A 5LCIA 1N36C 4WV3A 1PG4A 3GR1A 1MXBA 2D28C 2ZZNA 5AE3A 4GKJC 1N33C 4BC7A 3E7XA 3R44A 4JI1C 4LF4C 3AF6A 2ONFA 4BC9A 2UUAC 4FTFA 1ZB8A 1VEHA 1YJ7A 1O92A 1O93A 4DR6C 2D1QA 2PN2A 2ZM6C 1HH2P 5BSMA 2UUCC 3N54B 5CZVA 3A9VA 5A19A 2HHHC 2OPLA 1GPMA 4PUGA 4D4GA 3A26A 3RG2A 2P2BA 2Z51A 4GS5A 1USPA 3IEUA 4R1MA 4EATA 3PESA 3NI2A 4ODJA 5JRHA 3KXWA 3LGXA 3J80D 1XDXA 4X64C 1XRCA 2D1RA 3IMLA 3B7WA 2MMAB 2P2FA 4ZLPA 3NPDA 4HPVA 3S82A 3L8CA 4D56A 4DG9A 3O2EA 2ASBA 1T5HX 5KYVA 3PROC 3FCCA 4DR4C 4PROC 1MXAA 3JAMD 4MTNA 1I94C 2E0GA 4LE5A 4RM3A 1N34C 4XX2A 4LF6C 1EGAA 4L2ZA 3TQIA 2E5LC 1IBMC 1LQLA 4NOZA 3N2QA 2CY1A 4DR2C 2V7BA 2YWBA 2ATWA 4PHTA 3CW8X 2PG1E 4KTVA 2KZ0A 1XHJA 1T5DX 4OYCA 2QVYX 3H2TA 4GXQA 1PA4A 1WCJA 1YGTA 4DV2C 1XRBA 3CW9A 1FUGA 4DV7C 4LF7C 4TPSB 1LCIA 2ZTBA 1MD9A 4DR1C 1QWIA 2PT7G 3DAYA 3UZ0A 1ML8A 1MDBA 5T8TA 4JI2C 5KEIA 2KDNA 2P02A 1P7LA 2P2QA 2QVXX 3AF5A 4JI8C 4PUIA 2OO4A 5GTDA 1PU1A 3ETOA 2P20A 5H9UA 5BSRA 4JV5C 2DPLA 4KHPC 4JI5C 3T1YC 1M6XC 3NYRA 2M5OA 4RVOA 3E7WA 2CXCA 1RY2A 1XMQC 3IEVA 5CZXA 4PZPA 3CQ2A 4R0MA 5A1IA 1K0RA 2PROA 3R9WA 3GPCA 1RG9A 4DV4C 4JI7C 5FLXD 4DV3C 4DUYC 4MH4A 1AMUA 1J5EC 4X65C 2WD9A 1L2FA 1HNXC 5BSUA 2BH1X 4DCSA 5K85A 3GKUA 1HR0C 4L7IA 3FM7A 3SO4A 3UX2A 1HNZC 3OTOC 1MKYA 5BSVA 2JMPA 3LAXA 4JI0C 4K0BA 5BURA 4DV5C 1NY8A 3FCEA 2DYJA 1KKGA 2UXDC 1V60A 4LFBC 1N32C 2QW0X 4BCAA 2VQFC 3K6RA 3T1HC 3TUFA 4DV1C 3LNOA 3PBKA 4ZJZA 4DV0C 1HNWC 1USPB 4YHHC 4RLQA 3CQ1A 5E7QA 3AY0A 4I9FA 4B3TC 4JM1A 2CU6A 1JOSA 4D4IA 2VQEC 1V26A 2VSQA 2UXCC 2Y27A 2E8CA 2P2MA 5BUSA 3EQ6A 3A4IA 4GKKC 4X66C 3A9UA 3NYQA 3A25A 4G36A 2UU9C 4R1LA 3VNRA 1XRAA 4YY3C 4L4QA 1WF3A 4U5YD 3EERA 2E7GA 4DCUA 5BSTA 4IR7A 4DV6C 1XNQC 2D1SA 1IBKC 2MM9A 4NXNC 4LF9C 4RVNA 4PUHA 3UEBA 1VLAA 4DG8A 4BSZA 1QM4A 1XS3A 2UUBC 2D1TA 2E8EA 4DR3C 4JYAC 4WS9A 2YX1A 4B3RC 5IT9D 4K0KC 1MDFA 5T8SA 2D7VA 2AYAA 3TDEA 2QL8A 1WH9A 5AE2A 3TR3A 2DHMA 3G7SA 4RMNA 1FLOA 4I9GA 3I08A 2OPLB 3J7AD 1M6XA 4G1IA 5AE1A 5A1GA 5BUQA 3ETCA 3IPLA
chains in the Genus database with same CATH topology
5ADZA 4X62C 4KTTA 2YWCA 2P2JA 3VNSA 4DUZC 2KZFA 3CJEA 4DCVA 1V25A 1O90A 3GR0A 3R9XA 5LMNC 5BR8C 3C5EA 2EGTA 2BJOA 4RLFA 4DCTA 4JI6C 4OXIA 4AQYC 2WP0C 5KYTA 2HJGA 2Y4NA 4B3SC 4NDNA 4G37A 5BSWA 4LFAC 4FUTA 1N2FA 2VZEA 4DR5C 3UOWA 4JI3C 4JI4C 4BBYA 1NYEA 1FJGC 4GXRA 1IBLC 1BA3A 5LMUC 2E8FA 2YCBA 4D57A 5DV9A 3RV2A 3L95X 5A2QD 4IZ6A 4ISBA 4LF5C 5K8FA 3J81D 4FUQA 5IFIA 4LF8C 4LFCC 4NXMC 3VNQA 3LUSA 1XMOC 4B3MC 4OX9C 2Y4OA 2D27A 2OBVA 3LNVA 2F4VC 4RM2A 1MXCA 1O9TA 3I07A 2QVZX 3DLPX 1UKKA 3DHVA 2UXBC 5IWAC 1XNRC 2XR1A 1ULTA 4DR7C 1ZB9A 1PG3A 1N36C 4WV3A 1PG4A 3GR1A 1MXBA 2D28C 5AE3A 4GKJC 1N33C 4BC7A 3E7XA 3R44A 4JI1C 4LF4C 3AF6A 2ONFA 4BC9A 2UUAC 4FTFA 1ZB8A 1YJ7A 1O92A 1O93A 4DR6C 2D1QA 2PN2A 2ZM6C 1HH2P 5BSMA 2UUCC 3N54B 5CZVA 3A9VA 5A19A 2HHHC 2OPLA 1GPMA 4D4GA 3RG2A 2P2BA 4GS5A 1USPA 3IEUA 4R1MA 4EATA 3PESA 3NI2A 4ODJA 5JRHA 3KXWA 3LGXA 3J80D 4X64C 1XRCA 2D1RA 3IMLA 3B7WA 2P2FA 4ZLPA 3NPDA 4HPVA 3S82A 3L8CA 4D56A 4DG9A 2ASBA 1T5HX 5KYVA 3PROC 3FCCA 4DR4C 4PROC 1MXAA 3JAMD 4MTNA 1I94C 2E0GA 4LE5A 4RM3A 1N34C 4XX2A 4LF6C 1EGAA 4L2ZA 3TQIA 2E5LC 1IBMC 1LQLA 4NOZA 3N2QA 2CY1A 4DR2C 2V7BA 2YWBA 2ATWA 4PHTA 3CW8X 4KTVA 1T5DX 4OYCA 2QVYX 3H2TA 4GXQA 1PA4A 4DV2C 4LF7C 1XRBA 3CW9A 1FUGA 4DV7C 4TPSB 1LCIA 1MD9A 4DR1C 1QWIA 2PT7G 3DAYA 3UZ0A 1ML8A 1MDBA 5T8TA 4JI2C 5KEIA 2P02A 1P7LA 2P2QA 2QVXX 3AF5A 4JI8C 2OO4A 5GTDA 3ETOA 2P20A 5H9UA 5BSRA 4JV5C 2DPLA 4KHPC 4JI5C 3T1YC 3NYRA 4RVOA 3E7WA 2CXCA 1RY2A 1XMQC 3IEVA 5CZXA 4PZPA 4R0MA 5A1IA 1K0RA 2PROA 3R9WA 3GPCA 1RG9A 4DV4C 4JI7C 5FLXD 4DV3C 4DUYC 4MH4A 1AMUA 1J5EC 4X65C 2WD9A 1L2FA 1HNXC 5BSUA 2BH1X 4DCSA 5K85A 3GKUA 1HR0C 4L7IA 3SO4A 1HNZC 3OTOC 1MKYA 5BSVA 2JMPA 3LAXA 4JI0C 4K0BA 5BURA 4DV5C 3FCEA 2DYJA 1KKGA 2UXDC 4LFBC 1N32C 2QW0X 4BCAA 2VQFC 3T1HC 3TUFA 4DV1C 3PBKA 4ZJZA 4DV0C 1HNWC 1USPB 4YHHC 4RLQA 5E7QA 4I9FA 4B3TC 4JM1A 1JOSA 4D4IA 2VQEC 1V26A 2VSQA 2UXCC 2Y27A 2E8CA 2P2MA 5BUSA 3EQ6A 3A4IA 4GKKC 4X66C 3A9UA 3NYQA 4G36A 2UU9C 4R1LA 3VNRA 1XRAA 4YY3C 4L4QA 1WF3A 4U5YD 3EERA 2E7GA 4DCUA 5BSTA 4IR7A 4DV6C 1XNQC 2D1SA 1IBKC 4NXNC 4LF9C 4RVNA 1VLAA 4DG8A 4BSZA 1QM4A 2UUBC 2D1TA 2E8EA 4DR3C 4JYAC 4WS9A 4B3RC 5IT9D 4K0KC 1MDFA 5T8SA 2D7VA 2AYAA 3TDEA 2QL8A 1WH9A 5AE2A 3G7SA 4RMNA 4I9GA 3I08A 2OPLB 3J7AD 4G1IA 5AE1A 5A1GA 5BUQA 3ETCA 3IPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA C;  4X62 C;  1ZB8 A;  4B3T C;  1JOS A;  2VQE C;  1ML8 A;  4DR6 C;  4DUZ C;  2KZF A;  4JI2 C;  3CJE A;  2PN2 A;  4DCV A;  2ZM6 C;  1HH2 P;  2UXC C;  2UUC C;  3AF5 A;  4JI8 C;  3R9X A;  5LMN C;  5BR8 C;  2EGT A;  2E8C A;  2BJO A;  2HHH C;  4DCT A;  4GKK C;  4X66 C;  2OPL A;  4JI6 C;  2UU9 C;  4AQY C;  4JV5 C;  4KHP C;  4YY3 C;  2HJG A;  1WF3 A;  3EER A;  4JI5 C;  2E7G A;  3T1Y C;  4DCU A;  1USP A;  4B3S C;  3IEU A;  4DV6 C;  1XNQ C;  2CXC A;  1XMQ C;  4LFA C;  3IEV A;  1N2F A;  3J80 D;  4DR5 C;  4JI3 C;  4JI4 C;  1IBK C;  4X64 C;  1NYE A;  4NXN C;  1FJG C;  4LF9 C;  1IBL C;  5LMU C;  1K0R A;  2E8F A;  2YCB A;  3R9W A;  1VLA A;  4BSZ A;  5A2Q D;  4DV4 C;  5FLX D;  4JI7 C;  4DV3 C;  4LF5 C;  4DUY C;  4MH4 A;  3J81 D;  1J5E C;  2ASB A;  4X65 C;  4LF8 C;  1L2F A;  4LFC C;  4NXM C;  2UUB C;  1HNX C;  3LUS A;  2E8E A;  1XMO C;  4B3M C;  4DCS A;  4OX9 C;  4DR4 C;  3GKU A;  4DR3 C;  1HR0 C;  4JYA C;  3JAM D;  4MTN A;  1I94 C;  1HNZ C;  3OTO C;  1MKY A;  2F4V C;  1N34 C;  2JMP A;  4XX2 A;  4JI0 C;  4LF6 C;  1EGA A;  5IT9 D;  4B3R C;  4K0K C;  2D7V A;  2E5L C;  1IBM C;  2QL8 A;  1LQL A;  3I07 A;  4NOZ A;  1UKK A;  1WH9 A;  2CY1 A;  4DR2 C;  2UXB C;  5IWA C;  1XNR C;  2XR1 A;  4DV5 C;  4DR7 C;  1ZB9 A;  2DYJ A;  2ATW A;  1KKG A;  2UXD C;  1N36 C;  4LFB C;  2OPL B;  3J7A D;  1N32 C;  1PA4 A;  2VQF C;  4DV2 C;  3T1H C;  4DV7 C;  4LF7 C;  4GKJ C;  4DV1 C;  1N33 C;  4DV0 C;  4JI1 C;  4LF4 C;  1HNW C;  1USP B;  4YHH C;  3AF6 A;  2ONF A;  4DR1 C;  1QWI A;  2PT7 G; 
#chains in the Genus database with same CATH topology
 5ADZ A;  4X62 C;  1P4E A;  4KTT A;  2YWC A;  2P2J A;  3VNS A;  4DUZ C;  2KZF A;  3CJE A;  4DCV A;  1V25 A;  1O90 A;  3GR0 A;  3R9X A;  5LMN C;  5BR8 C;  3C5E A;  2EGT A;  2BJO A;  4RLF A;  4DCT A;  4JI6 C;  4OXI A;  4AQY C;  2WP0 C;  5KYT A;  2HJG A;  2Y4N A;  2M5H A;  4B3S C;  4NDN A;  4G37 A;  5BSW A;  3UX3 A;  4LFA C;  4FUT A;  1N2F A;  2VZE A;  2JNV A;  4DR5 C;  3UOW A;  4JI3 C;  4JI4 C;  4BBY A;  1NYE A;  1FJG C;  4GXR A;  1IBL C;  1BA3 A;  5LMU C;  2E8F A;  2ZZM A;  2YCB A;  4D57 A;  5DV9 A;  3RV2 A;  3L95 X;  5A2Q D;  4IZ6 A;  4ISB A;  4LF5 C;  2MCQ A;  5K8F A;  3J81 D;  4FUQ A;  5IFI A;  4LF8 C;  4LFC C;  4NXM C;  3VNQ A;  3LUS A;  1XMO C;  4B3M C;  4OX9 C;  1TH5 A;  3CQ3 A;  2Y4O A;  2D27 A;  2OBV A;  1IB8 A;  3LNV A;  2F4V C;  1P4E C;  4RM2 A;  1MXC A;  1O9T A;  3I07 A;  2QVZ X;  3DLP X;  1UKK A;  3DHV A;  2UXB C;  5IWA C;  1XNR C;  2XR1 A;  1UWD A;  1ULT A;  2NCL A;  4DR7 C;  1ZB9 A;  1PG3 A;  5LCI A;  1N36 C;  4WV3 A;  1PG4 A;  3GR1 A;  1MXB A;  2D28 C;  2ZZN A;  5AE3 A;  4GKJ C;  1N33 C;  4BC7 A;  3E7X A;  3R44 A;  4JI1 C;  4LF4 C;  3AF6 A;  2ONF A;  4BC9 A;  2UUA C;  4FTF A;  1ZB8 A;  1VEH A;  1YJ7 A;  1O92 A;  1O93 A;  4DR6 C;  2D1Q A;  2PN2 A;  2ZM6 C;  1HH2 P;  5BSM A;  2UUC C;  3N54 B;  5CZV A;  3A9V A;  5A19 A;  2HHH C;  2OPL A;  1GPM A;  4PUG A;  4D4G A;  3A26 A;  3RG2 A;  2P2B A;  2Z51 A;  4GS5 A;  1USP A;  3IEU A;  4R1M A;  4EAT A;  3PES A;  3NI2 A;  4ODJ A;  5JRH A;  3KXW A;  3LGX A;  3J80 D;  1XDX A;  4X64 C;  1XRC A;  2D1R A;  3IML A;  3B7W A;  2MMA B;  2P2F A;  4ZLP A;  3NPD A;  4HPV A;  3S82 A;  3L8C A;  4D56 A;  4DG9 A;  3O2E A;  2ASB A;  1T5H X;  5KYV A;  3PRO C;  3FCC A;  4DR4 C;  4PRO C;  1MXA A;  3JAM D;  4MTN A;  1I94 C;  2E0G A;  4LE5 A;  4RM3 A;  1N34 C;  4XX2 A;  4LF6 C;  1EGA A;  4L2Z A;  3TQI A;  2E5L C;  1IBM C;  1LQL A;  4NOZ A;  3N2Q A;  2CY1 A;  4DR2 C;  2V7B A;  2YWB A;  2ATW A;  4PHT A;  3CW8 X;  2PG1 E;  4KTV A;  2KZ0 A;  1XHJ A;  1T5D X;  4OYC A;  2QVY X;  3H2T A;  4GXQ A;  1PA4 A;  1WCJ A;  1YGT A;  4DV2 C;  1XRB A;  3CW9 A;  1FUG A;  4DV7 C;  4LF7 C;  4TPS B;  1LCI A;  2ZTB A;  1MD9 A;  4DR1 C;  1QWI A;  2PT7 G;  3DAY A;  3UZ0 A;  1ML8 A;  1MDB A;  5T8T A;  4JI2 C;  5KEI A;  2KDN A;  2P02 A;  1P7L A;  2P2Q A;  2QVX X;  3AF5 A;  4JI8 C;  4PUI A;  2OO4 A;  5GTD A;  1PU1 A;  3ETO A;  2P20 A;  5H9U A;  5BSR A;  4JV5 C;  2DPL A;  4KHP C;  4JI5 C;  3T1Y C;  1M6X C;  3NYR A;  2M5O A;  4RVO A;  3E7W A;  2CXC A;  1RY2 A;  1XMQ C;  3IEV A;  5CZX A;  4PZP A;  3CQ2 A;  4R0M A;  5A1I A;  1K0R A;  2PRO A;  3R9W A;  3GPC A;  1RG9 A;  4DV4 C;  4JI7 C;  5FLX D;  4DV3 C;  4DUY C;  4MH4 A;  1AMU A;  1J5E C;  4X65 C;  2WD9 A;  1L2F A;  1HNX C;  5BSU A;  2BH1 X;  4DCS A;  5K85 A;  3GKU A;  1HR0 C;  4L7I A;  3FM7 A;  3SO4 A;  3UX2 A;  1HNZ C;  3OTO C;  1MKY A;  5BSV A;  2JMP A;  3LAX A;  4JI0 C;  4K0B A;  5BUR A;  4DV5 C;  1NY8 A;  3FCE A;  2DYJ A;  1KKG A;  2UXD C;  1V60 A;  4LFB C;  1N32 C;  2QW0 X;  4BCA A;  2VQF C;  3K6R A;  3T1H C;  3TUF A;  4DV1 C;  3LNO A;  3PBK A;  4ZJZ A;  4DV0 C;  1HNW C;  1USP B;  4YHH C;  4RLQ A;  3CQ1 A;  5E7Q A;  3AY0 A;  4I9F A;  4B3T C;  4JM1 A;  2CU6 A;  1JOS A;  4D4I A;  2VQE C;  1V26 A;  2VSQ A;  2UXC C;  2Y27 A;  2E8C A;  2P2M A;  5BUS A;  3EQ6 A;  3A4I A;  4GKK C;  4X66 C;  3A9U A;  3NYQ A;  3A25 A;  4G36 A;  2UU9 C;  4R1L A;  3VNR A;  1XRA A;  4YY3 C;  4L4Q A;  1WF3 A;  4U5Y D;  3EER A;  2E7G A;  4DCU A;  5BST A;  4IR7 A;  4DV6 C;  1XNQ C;  2D1S A;  1IBK C;  2MM9 A;  4NXN C;  4LF9 C;  4RVN A;  4PUH A;  3UEB A;  1VLA A;  4DG8 A;  4BSZ A;  1QM4 A;  1XS3 A;  2UUB C;  2D1T A;  2E8E A;  4DR3 C;  4JYA C;  4WS9 A;  2YX1 A;  4B3R C;  5IT9 D;  4K0K C;  1MDF A;  5T8S A;  2D7V A;  2AYA A;  3TDE A;  2QL8 A;  1WH9 A;  5AE2 A;  3TR3 A;  2DHM A;  3G7S A;  4RMN A;  1FLO A;  4I9G A;  3I08 A;  2OPL B;  3J7A D;  1M6X A;  4G1I A;  5AE1 A;  5A1G A;  5BUQ A;  3ETC A;  3IPL A; 
#chains in the Genus database with same CATH homology
 5ADZ A;  4X62 C;  4KTT A;  2YWC A;  2P2J A;  3VNS A;  4DUZ C;  2KZF A;  3CJE A;  4DCV A;  1V25 A;  1O90 A;  3GR0 A;  3R9X A;  5LMN C;  5BR8 C;  3C5E A;  2EGT A;  2BJO A;  4RLF A;  4DCT A;  4JI6 C;  4OXI A;  4AQY C;  2WP0 C;  5KYT A;  2HJG A;  2Y4N A;  4B3S C;  4NDN A;  4G37 A;  5BSW A;  4LFA C;  4FUT A;  1N2F A;  2VZE A;  4DR5 C;  3UOW A;  4JI3 C;  4JI4 C;  4BBY A;  1NYE A;  1FJG C;  4GXR A;  1IBL C;  1BA3 A;  5LMU C;  2E8F A;  2YCB A;  4D57 A;  5DV9 A;  3RV2 A;  3L95 X;  5A2Q D;  4IZ6 A;  4ISB A;  4LF5 C;  5K8F A;  3J81 D;  4FUQ A;  5IFI A;  4LF8 C;  4LFC C;  4NXM C;  3VNQ A;  3LUS A;  1XMO C;  4B3M C;  4OX9 C;  2Y4O A;  2D27 A;  2OBV A;  3LNV A;  2F4V C;  4RM2 A;  1MXC A;  1O9T A;  3I07 A;  2QVZ X;  3DLP X;  1UKK A;  3DHV A;  2UXB C;  5IWA C;  1XNR C;  2XR1 A;  1ULT A;  4DR7 C;  1ZB9 A;  1PG3 A;  1N36 C;  4WV3 A;  1PG4 A;  3GR1 A;  1MXB A;  2D28 C;  5AE3 A;  4GKJ C;  1N33 C;  4BC7 A;  3E7X A;  3R44 A;  4JI1 C;  4LF4 C;  3AF6 A;  2ONF A;  4BC9 A;  2UUA C;  4FTF A;  1ZB8 A;  1YJ7 A;  1O92 A;  1O93 A;  4DR6 C;  2D1Q A;  2PN2 A;  2ZM6 C;  1HH2 P;  5BSM A;  2UUC C;  3N54 B;  5CZV A;  3A9V A;  5A19 A;  2HHH C;  2OPL A;  1GPM A;  4D4G A;  3RG2 A;  2P2B A;  4GS5 A;  1USP A;  3IEU A;  4R1M A;  4EAT A;  3PES A;  3NI2 A;  4ODJ A;  5JRH A;  3KXW A;  3LGX A;  3J80 D;  4X64 C;  1XRC A;  2D1R A;  3IML A;  3B7W A;  2P2F A;  4ZLP A;  3NPD A;  4HPV A;  3S82 A;  3L8C A;  4D56 A;  4DG9 A;  2ASB A;  1T5H X;  5KYV A;  3PRO C;  3FCC A;  4DR4 C;  4PRO C;  1MXA A;  3JAM D;  4MTN A;  1I94 C;  2E0G A;  4LE5 A;  4RM3 A;  1N34 C;  4XX2 A;  4LF6 C;  1EGA A;  4L2Z A;  3TQI A;  2E5L C;  1IBM C;  1LQL A;  4NOZ A;  3N2Q A;  2CY1 A;  4DR2 C;  2V7B A;  2YWB A;  2ATW A;  4PHT A;  3CW8 X;  4KTV A;  1T5D X;  4OYC A;  2QVY X;  3H2T A;  4GXQ A;  1PA4 A;  4DV2 C;  4LF7 C;  1XRB A;  3CW9 A;  1FUG A;  4DV7 C;  4TPS B;  1LCI A;  1MD9 A;  4DR1 C;  1QWI A;  2PT7 G;  3DAY A;  3UZ0 A;  1ML8 A;  1MDB A;  5T8T A;  4JI2 C;  5KEI A;  2P02 A;  1P7L A;  2P2Q A;  2QVX X;  3AF5 A;  4JI8 C;  2OO4 A;  5GTD A;  3ETO A;  2P20 A;  5H9U A;  5BSR A;  4JV5 C;  2DPL A;  4KHP C;  4JI5 C;  3T1Y C;  3NYR A;  4RVO A;  3E7W A;  2CXC A;  1RY2 A;  1XMQ C;  3IEV A;  5CZX A;  4PZP A;  4R0M A;  5A1I A;  1K0R A;  2PRO A;  3R9W A;  3GPC A;  1RG9 A;  4DV4 C;  4JI7 C;  5FLX D;  4DV3 C;  4DUY C;  4MH4 A;  1AMU A;  1J5E C;  4X65 C;  2WD9 A;  1L2F A;  1HNX C;  5BSU A;  2BH1 X;  4DCS A;  5K85 A;  3GKU A;  1HR0 C;  4L7I A;  3SO4 A;  1HNZ C;  3OTO C;  1MKY A;  5BSV A;  2JMP A;  3LAX A;  4JI0 C;  4K0B A;  5BUR A;  4DV5 C;  3FCE A;  2DYJ A;  1KKG A;  2UXD C;  4LFB C;  1N32 C;  2QW0 X;  4BCA A;  2VQF C;  3T1H C;  3TUF A;  4DV1 C;  3PBK A;  4ZJZ A;  4DV0 C;  1HNW C;  1USP B;  4YHH C;  4RLQ A;  5E7Q A;  4I9F A;  4B3T C;  4JM1 A;  1JOS A;  4D4I A;  2VQE C;  1V26 A;  2VSQ A;  2UXC C;  2Y27 A;  2E8C A;  2P2M A;  5BUS A;  3EQ6 A;  3A4I A;  4GKK C;  4X66 C;  3A9U A;  3NYQ A;  4G36 A;  2UU9 C;  4R1L A;  3VNR A;  1XRA A;  4YY3 C;  4L4Q A;  1WF3 A;  4U5Y D;  3EER A;  2E7G A;  4DCU A;  5BST A;  4IR7 A;  4DV6 C;  1XNQ C;  2D1S A;  1IBK C;  4NXN C;  4LF9 C;  4RVN A;  1VLA A;  4DG8 A;  4BSZ A;  1QM4 A;  2UUB C;  2D1T A;  2E8E A;  4DR3 C;  4JYA C;  4WS9 A;  4B3R C;  5IT9 D;  4K0K C;  1MDF A;  5T8S A;  2D7V A;  2AYA A;  3TDE A;  2QL8 A;  1WH9 A;  5AE2 A;  3G7S A;  4RMN A;  4I9G A;  3I08 A;  2OPL B;  3J7A D;  4G1I A;  5AE1 A;  5A1G A;  5BUQ A;  3ETC A;  3IPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...