1N36C

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1n36C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1n36C02
2PN2A 2UUCC 4YHHC 3T1HC 1N32C 2UU9C 4YY3C 2BJOA 3J80D 3CJEA 3JAMD 2UUAC 4B3TC 4LF5C 1I94C 4X62C 2VQFC 4GKKC 4DR2C 4MTNA 2E8EA 4DCSA 4KHPC 4DR1C 1XMOC 1K0RA 4LF7C 4JI3C 4B3RC 4NXMC 4DV7C 5A2QD 4LF8C 4DCUA 2ATWA 4DR6C 4DR4C 4NXNC 3OTOC 4DCTA 1USPB 4X66C 5BR8C 4LFCC 2E8FA 3R9WA 2D7VA 4JI4C 1XMQC 1ZB8A 1N34C 4JI1C 2ONFA 2HHHC 1N33C 4XX2A 2UXDC 4B3SC 5LMNC 4DV4C 3J7AD 2HJGA 4JI5C 4JI0C 4DV2C 4JI8C 4AQYC 1HH2P 4JYAC 2QL8A 4DUYC 3EERA 4JI2C 1LQLA 1IBLC 1FJGC 4OX9C 1L2FA 1VLAA 1HNZC 1ZB9A 1KKGA 4X64C 1J5EC 1XNQC 4DV0C 2E8CA 3GKUA 3J81D 1PA4A 3AF5A 5LMUC 4DUZC 4DR7C 1USPA 2F4VC 2VQEC 2CXCA 4JV5C 4DCVA 4LF4C 2KZFA 1ML8A 2PT7G 4LF6C 1WH9A 2XR1A 2YCBA 1HR0C 4LF9C 3T1YC 2ASBA 1HNXC 2DYJA 4JI7C 1HNWC 3I07A 3LUSA 4JI6C 2E7GA 1IBMC 4LFAC 4X65C 5IWAC 1UKKA 4DV1C 1EGAA 2ZM6C 1JOSA 4DR3C 4BSZA 1QWIA 4B3MC 2EGTA 3R9XA 2UXCC 2UUBC 2JMPA 1IBKC 1N36C 5FLXD 4LFBC 4GKJC 4DV6C 2OPLB 1MKYA 4MH4A 2CY1A 3IEVA 1WF3A 4DR5C 4K0KC 1XNRC 1NYEA 2E5LC 4DV5C 3AF6A 1N2FA 5IT9D 3IEUA 2OPLA 4NOZA 4DV3C 2UXBC
chains in the Genus database with same CATH superfamily
2KDNA 3T1HC 1WCJA 2UU9C 3JAMD 4B3TC 4NDNA 4GXRA 1I94C 4BBYA 5BURA 2CU6A 2ZZNA 4IR7A 4DR1C 1K0RA 1QM4A 1MXBA 2Y27A 4DCUA 4DR6C 4DR4C 2QW0X 4X66C 2E8FA 2D7VA 4RLFA 1MDFA 2ONFA 2HHHC 3A9UA 2UXDC 4B3SC 2YX1A 2M5HA 4JI0C 4JI8C 4AQYC 1HH2P 1YJ7A 3VNQA 5KEIA 2QL8A 3NYQA 1FJGC 4FUTA 1V60A 3FCEA 3EQ6A 1BA3A 1L2FA 1VLAA 4BCAA 1XNQC 3PESA 4DV0C 2E8CA 5AE3A 3GKUA 3TR3A 1NY8A 4L4QA 3AF5A 4DUZC 1P7LA 1USPA 2Y4NA 3PROC 4OXIA 5A1GA 1O93A 2AYAA 2KZFA 1P4EA 2XR1A 2YCBA 4DG8A 2JNVA 3I07A 1HNWC 3DHVA 3LUSA 5IWAC 3DLPX 4B3MC 2EGTA 3R9XA 4R0MA 5FLXD 1TH5A 2OPLB 3G7SA 2CY1A 1XRCA 3S82A 4K0KC 3A26A 2V7BA 4R1MA 4PROC 4DV3C 2UXBC 2UUCC 3A9VA 4GS5A 4RVNA 2E8EA 3UX2A 4DCSA 2D1RA 4JI3C 1XDXA 4B3RC 4RLQA 4DV7C 5A2QD 2ATWA 4NXNC 3OTOC 4DCTA 2P2QA 1USPB 5T8TA 4LFCC 3L95X 4G1IA 3LGXA 1XMQC 3ETCA 2D1TA 4XX2A 5BSMA 4DV4C 2HJGA 3CQ1A 4D4GA 1P4EC 4JYAC 4EATA 4DUYC 1MDBA 3UZ0A 4JI2C 1LQLA 1IBLC 3FM7A 4BC7A 1PG3A 3A4IA 4L7IA 1KKGA 3N2QA 1IB8A 3CW9A 2M5OA 5K8FA 4DR7C 4KTVA 2D28C 4JV5C 1O90A 5K85A 5CZVA 3T1YC 4WS9A 2OO4A 5E7QA 4LFAC 4X65C 1GPMA 3O2EA 4DV1C 3GPCA 4DR3C 4BSZA 2DPLA 1MXCA 2KZ0A 1MD9A 1QWIA 2UXCC 2JMPA 4LFBC 4DV6C 1WF3A 3DAYA 1NYEA 3NPDA 4DV5C 3AF6A 5CZXA 5KYTA 3CQ2A 2YWBA 4ZLPA 4PZPA 2PN2A 5JRHA 4YHHC 2UUAC 3IMLA 2QVZX 5KYVA 1V26A 2VZEA 3PBKA 2PG1E 2E0GA 2VSQA 3UOWA 2P20A 3L8CA 4PHTA 4PUGA 1XMOC 4LF7C 2Y4OA 5BSRA 4WV3A 4LF8C 3NYRA 4BC9A 1M6XA 4I9GA 4LE5A 5BR8C 1UWDA 3R9WA 4JI4C 1ZB8A 3ETOA 4JI1C 2QVYX 4D56A 1AMUA 5LMNC 3J7AD 3NI2A 4DV2C 3H2TA 1XRAA 2PROA 4D57A 4K0BA 1T5HX 3LNVA 2P02A 4L2ZA 4RVOA 4OX9C 3I08A 3CQ3A 3SO4A 4RM2A 5AE1A 1J5EC 3J81D 1PA4A 2QVXX 1O92A 5BSUA 5LMUC 2VQEC 2CXCA 1VEHA 4LF4C 1YGTA 1ML8A 2PT7G 4LF6C 1HR0C 2ASBA 2ZTBA 1HNXC 1FLOA 5BSWA 4JI6C 1XRBA 4G37A 3AY0A 4U5YD 3N54B 1UKKA 2ZM6C 5ADZA 1JOSA 3TDEA 3GR1A 2WP0C 4DG9A 2UUBC 3K6RA 1IBKC 1T5DX 4GKJC 1MKYA 5BUSA 4MH4A 3IEVA 4ODJA 4JM1A 1M6XC 2P2FA 2E5LC 4OYCA 1N2FA 5IT9D 1V25A 2OPLA 4PUHA 1O9TA 5H9UA 5BSTA 4D4IA 1N32C 2MM9A 2P2JA 3E7WA 3UX3A 2BJOA 4YY3C 3CJEA 3J80D 4LF5C 1MXAA 4FUQA 4X62C 2VQFC 5BSVA 4RM3A 3VNRA 3TUFA 4DR2C 4GKKC 5LCIA 4PUIA 3C5EA 4MTNA 4HPVA 2ZZMA 4KHPC 3VNSA 3UEBA 4TPSB 2YWCA 4NXMC 1FUGA 4ISBA 5AE2A 3R44A 2NCLA 4GXQA 3GR0A 1N34C 1N33C 1XHJA 3TQIA 5GTDA 3LNOA 2WD9A 3FCCA 4JI5C 4I9FA 4IZ6A 3IPLA 4ZJZA 4G36A 2Z51A 2P2BA 5A1IA 3CW8X 2P2MA 3EERA 5BUQA 3KXWA 1RY2A 1XS3A 5DV9A 1HNZC 4RMNA 1ZB9A 4X64C 1RG9A 1PG4A 2MMAB 1ULTA 5T8SA 2DHMA 5IFIA 3LAXA 2F4VC 3B7WA 4DCVA 2D27A 1WH9A 4LF9C 2D1SA 2DYJA 4JI7C 2OBVA 2E7GA 3E7XA 1IBMC 3RG2A 4FTFA 1EGAA 3RV2A 2D1QA 1N36C 2MCQA 4KTTA 3A25A 4R1LA 4DR5C 1XNRC 1LCIA 5A19A 2BH1X 1PU1A 3IEUA 4NOZA
chains in the Genus database with same CATH topology
3T1HC 2UU9C 3JAMD 4B3TC 4NDNA 4GXRA 1I94C 4BBYA 5BURA 4IR7A 4DR1C 1K0RA 1QM4A 1MXBA 2Y27A 4DCUA 4DR6C 4DR4C 2QW0X 4X66C 2E8FA 2D7VA 4RLFA 1MDFA 2ONFA 2HHHC 3A9UA 2UXDC 4B3SC 4JI0C 4JI8C 4AQYC 1HH2P 1YJ7A 3VNQA 5KEIA 2QL8A 3NYQA 1FJGC 4FUTA 3FCEA 3EQ6A 1BA3A 1L2FA 1VLAA 4BCAA 1XNQC 3PESA 4DV0C 2E8CA 5AE3A 3GKUA 4L4QA 3AF5A 4DUZC 1P7LA 1USPA 2Y4NA 3PROC 4OXIA 5A1GA 1O93A 2AYAA 2KZFA 2XR1A 2YCBA 4DG8A 1HNWC 3I07A 3DHVA 3LUSA 5IWAC 3DLPX 4B3MC 2EGTA 3R9XA 4R0MA 5FLXD 2OPLB 3G7SA 2CY1A 1XRCA 3S82A 4K0KC 2V7BA 4R1MA 4PROC 4DV3C 2UXBC 2UUCC 3A9VA 4GS5A 4RVNA 2E8EA 4DCSA 2D1RA 4JI3C 4B3RC 4RLQA 4DV7C 5A2QD 2ATWA 4NXNC 3OTOC 4DCTA 2P2QA 1USPB 5T8TA 4LFCC 3L95X 4G1IA 3LGXA 1XMQC 3ETCA 2D1TA 4XX2A 5BSMA 4DV4C 2HJGA 4D4GA 4JYAC 4EATA 4DUYC 1MDBA 3UZ0A 4JI2C 1LQLA 1IBLC 4BC7A 1PG3A 3A4IA 4L7IA 1KKGA 3N2QA 3CW9A 5K8FA 4DR7C 4KTVA 2D28C 4JV5C 1O90A 5K85A 5CZVA 3T1YC 4WS9A 2OO4A 5E7QA 4LFAC 4X65C 1GPMA 4DV1C 3GPCA 4DR3C 4BSZA 2DPLA 1MXCA 1MD9A 1QWIA 2UXCC 2JMPA 4LFBC 4DV6C 1WF3A 3DAYA 1NYEA 3NPDA 4DV5C 3AF6A 5CZXA 5KYTA 2YWBA 4ZLPA 4PZPA 2PN2A 5JRHA 4YHHC 2UUAC 3IMLA 2QVZX 5KYVA 1V26A 2VZEA 3PBKA 2E0GA 2VSQA 3UOWA 2P20A 3L8CA 4PHTA 1XMOC 4LF7C 2Y4OA 5BSRA 4WV3A 4LF8C 3NYRA 4BC9A 4I9GA 5BR8C 4LE5A 3R9WA 4JI4C 1ZB8A 3ETOA 4JI1C 2QVYX 4D56A 1AMUA 5LMNC 3J7AD 3NI2A 4DV2C 3H2TA 1XRAA 2PROA 4D57A 4K0BA 1T5HX 3LNVA 2P02A 4L2ZA 4RVOA 4OX9C 3I08A 3SO4A 4RM2A 5AE1A 1J5EC 3J81D 1PA4A 2QVXX 1O92A 5BSUA 5LMUC 2VQEC 2CXCA 4LF4C 1ML8A 2PT7G 4LF6C 1HR0C 2ASBA 1HNXC 5BSWA 4JI6C 1XRBA 4G37A 4U5YD 3N54B 1UKKA 2ZM6C 5ADZA 1JOSA 3TDEA 3GR1A 2WP0C 4DG9A 2UUBC 1IBKC 1T5DX 4GKJC 1MKYA 5BUSA 4MH4A 3IEVA 4ODJA 4JM1A 2P2FA 2E5LC 4OYCA 1N2FA 5IT9D 1V25A 2OPLA 1O9TA 5H9UA 5BSTA 4D4IA 1N32C 2P2JA 3E7WA 4YY3C 2BJOA 3J80D 3CJEA 4LF5C 1MXAA 4FUQA 4X62C 2VQFC 5BSVA 4RM3A 3VNRA 3TUFA 4DR2C 4GKKC 3C5EA 4MTNA 4HPVA 4KHPC 3VNSA 4TPSB 2YWCA 4NXMC 1FUGA 4ISBA 5AE2A 3R44A 4GXQA 3GR0A 1N34C 1N33C 3TQIA 5GTDA 2WD9A 3FCCA 4JI5C 4I9FA 4IZ6A 3IPLA 4ZJZA 4G36A 2P2BA 5A1IA 3CW8X 2P2MA 3EERA 5BUQA 3KXWA 1RY2A 5DV9A 1HNZC 4RMNA 1ZB9A 4X64C 1RG9A 1PG4A 1ULTA 5T8SA 5IFIA 3LAXA 2F4VC 3B7WA 4DCVA 2D27A 1WH9A 4LF9C 2D1SA 2DYJA 4JI7C 2OBVA 2E7GA 3E7XA 1IBMC 3RG2A 4FTFA 1EGAA 3RV2A 2D1QA 1N36C 4KTTA 4R1LA 4DR5C 1XNRC 1LCIA 5A19A 2BH1X 3IEUA 4NOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PN2 A;  2UUC C;  4YHH C;  3T1H C;  1N32 C;  2UU9 C;  4YY3 C;  2BJO A;  3J80 D;  3CJE A;  3JAM D;  2UUA C;  4B3T C;  4LF5 C;  1I94 C;  4X62 C;  2VQF C;  4GKK C;  4DR2 C;  4MTN A;  2E8E A;  4DCS A;  4KHP C;  4DR1 C;  1XMO C;  1K0R A;  4LF7 C;  4JI3 C;  4B3R C;  4NXM C;  4DV7 C;  5A2Q D;  4LF8 C;  4DCU A;  2ATW A;  4DR6 C;  4DR4 C;  4NXN C;  3OTO C;  4DCT A;  1USP B;  4X66 C;  5BR8 C;  4LFC C;  2E8F A;  3R9W A;  2D7V A;  4JI4 C;  1XMQ C;  1ZB8 A;  1N34 C;  4JI1 C;  2ONF A;  2HHH C;  1N33 C;  4XX2 A;  2UXD C;  4B3S C;  5LMN C;  4DV4 C;  3J7A D;  2HJG A;  4JI5 C;  4JI0 C;  4DV2 C;  4JI8 C;  4AQY C;  1HH2 P;  4JYA C;  2QL8 A;  4DUY C;  3EER A;  4JI2 C;  1LQL A;  1IBL C;  1FJG C;  4OX9 C;  1L2F A;  1VLA A;  1HNZ C;  1ZB9 A;  1KKG A;  4X64 C;  1J5E C;  1XNQ C;  4DV0 C;  2E8C A;  3GKU A;  3J81 D;  1PA4 A;  3AF5 A;  5LMU C;  4DUZ C;  4DR7 C;  1USP A;  2F4V C;  2VQE C;  2CXC A;  4JV5 C;  4DCV A;  4LF4 C;  2KZF A;  1ML8 A;  2PT7 G;  4LF6 C;  1WH9 A;  2XR1 A;  2YCB A;  1HR0 C;  4LF9 C;  3T1Y C;  2ASB A;  1HNX C;  2DYJ A;  4JI7 C;  1HNW C;  3I07 A;  3LUS A;  4JI6 C;  2E7G A;  1IBM C;  4LFA C;  4X65 C;  5IWA C;  1UKK A;  4DV1 C;  1EGA A;  2ZM6 C;  1JOS A;  4DR3 C;  4BSZ A;  1QWI A;  4B3M C;  2EGT A;  3R9X A;  2UXC C;  2UUB C;  2JMP A;  1IBK C;  1N36 C;  5FLX D;  4LFB C;  4GKJ C;  4DV6 C;  2OPL B;  1MKY A;  4MH4 A;  2CY1 A;  3IEV A;  1WF3 A;  4DR5 C;  4K0K C;  1XNR C;  1NYE A;  2E5L C;  4DV5 C;  3AF6 A;  1N2F A;  5IT9 D;  3IEU A;  2OPL A;  4NOZ A;  4DV3 C;  2UXB C; 
#chains in the Genus database with same CATH topology
 2KDN A;  3T1H C;  1WCJ A;  2UU9 C;  3JAM D;  4B3T C;  4NDN A;  4GXR A;  1I94 C;  4BBY A;  5BUR A;  2CU6 A;  2ZZN A;  4IR7 A;  4DR1 C;  1K0R A;  1QM4 A;  1MXB A;  2Y27 A;  4DCU A;  4DR6 C;  4DR4 C;  2QW0 X;  4X66 C;  2E8F A;  2D7V A;  4RLF A;  1MDF A;  2ONF A;  2HHH C;  3A9U A;  2UXD C;  4B3S C;  2YX1 A;  2M5H A;  4JI0 C;  4JI8 C;  4AQY C;  1HH2 P;  1YJ7 A;  3VNQ A;  5KEI A;  2QL8 A;  3NYQ A;  1FJG C;  4FUT A;  1V60 A;  3FCE A;  3EQ6 A;  1BA3 A;  1L2F A;  1VLA A;  4BCA A;  1XNQ C;  3PES A;  4DV0 C;  2E8C A;  5AE3 A;  3GKU A;  3TR3 A;  1NY8 A;  4L4Q A;  3AF5 A;  4DUZ C;  1P7L A;  1USP A;  2Y4N A;  3PRO C;  4OXI A;  5A1G A;  1O93 A;  2AYA A;  2KZF A;  1P4E A;  2XR1 A;  2YCB A;  4DG8 A;  2JNV A;  3I07 A;  1HNW C;  3DHV A;  3LUS A;  5IWA C;  3DLP X;  4B3M C;  2EGT A;  3R9X A;  4R0M A;  5FLX D;  1TH5 A;  2OPL B;  3G7S A;  2CY1 A;  1XRC A;  3S82 A;  4K0K C;  3A26 A;  2V7B A;  4R1M A;  4PRO C;  4DV3 C;  2UXB C;  2UUC C;  3A9V A;  4GS5 A;  4RVN A;  2E8E A;  3UX2 A;  4DCS A;  2D1R A;  4JI3 C;  1XDX A;  4B3R C;  4RLQ A;  4DV7 C;  5A2Q D;  2ATW A;  4NXN C;  3OTO C;  4DCT A;  2P2Q A;  1USP B;  5T8T A;  4LFC C;  3L95 X;  4G1I A;  3LGX A;  1XMQ C;  3ETC A;  2D1T A;  4XX2 A;  5BSM A;  4DV4 C;  2HJG A;  3CQ1 A;  4D4G A;  1P4E C;  4JYA C;  4EAT A;  4DUY C;  1MDB A;  3UZ0 A;  4JI2 C;  1LQL A;  1IBL C;  3FM7 A;  4BC7 A;  1PG3 A;  3A4I A;  4L7I A;  1KKG A;  3N2Q A;  1IB8 A;  3CW9 A;  2M5O A;  5K8F A;  4DR7 C;  4KTV A;  2D28 C;  4JV5 C;  1O90 A;  5K85 A;  5CZV A;  3T1Y C;  4WS9 A;  2OO4 A;  5E7Q A;  4LFA C;  4X65 C;  1GPM A;  3O2E A;  4DV1 C;  3GPC A;  4DR3 C;  4BSZ A;  2DPL A;  1MXC A;  2KZ0 A;  1MD9 A;  1QWI A;  2UXC C;  2JMP A;  4LFB C;  4DV6 C;  1WF3 A;  3DAY A;  1NYE A;  3NPD A;  4DV5 C;  3AF6 A;  5CZX A;  5KYT A;  3CQ2 A;  2YWB A;  4ZLP A;  4PZP A;  2PN2 A;  5JRH A;  4YHH C;  2UUA C;  3IML A;  2QVZ X;  5KYV A;  1V26 A;  2VZE A;  3PBK A;  2PG1 E;  2E0G A;  2VSQ A;  3UOW A;  2P20 A;  3L8C A;  4PHT A;  4PUG A;  1XMO C;  4LF7 C;  2Y4O A;  5BSR A;  4WV3 A;  4LF8 C;  3NYR A;  4BC9 A;  1M6X A;  4I9G A;  4LE5 A;  5BR8 C;  1UWD A;  3R9W A;  4JI4 C;  1ZB8 A;  3ETO A;  4JI1 C;  2QVY X;  4D56 A;  1AMU A;  5LMN C;  3J7A D;  3NI2 A;  4DV2 C;  3H2T A;  1XRA A;  2PRO A;  4D57 A;  4K0B A;  1T5H X;  3LNV A;  2P02 A;  4L2Z A;  4RVO A;  4OX9 C;  3I08 A;  3CQ3 A;  3SO4 A;  4RM2 A;  5AE1 A;  1J5E C;  3J81 D;  1PA4 A;  2QVX X;  1O92 A;  5BSU A;  5LMU C;  2VQE C;  2CXC A;  1VEH A;  4LF4 C;  1YGT A;  1ML8 A;  2PT7 G;  4LF6 C;  1HR0 C;  2ASB A;  2ZTB A;  1HNX C;  1FLO A;  5BSW A;  4JI6 C;  1XRB A;  4G37 A;  3AY0 A;  4U5Y D;  3N54 B;  1UKK A;  2ZM6 C;  5ADZ A;  1JOS A;  3TDE A;  3GR1 A;  2WP0 C;  4DG9 A;  2UUB C;  3K6R A;  1IBK C;  1T5D X;  4GKJ C;  1MKY A;  5BUS A;  4MH4 A;  3IEV A;  4ODJ A;  4JM1 A;  1M6X C;  2P2F A;  2E5L C;  4OYC A;  1N2F A;  5IT9 D;  1V25 A;  2OPL A;  4PUH A;  1O9T A;  5H9U A;  5BST A;  4D4I A;  1N32 C;  2MM9 A;  2P2J A;  3E7W A;  3UX3 A;  2BJO A;  4YY3 C;  3CJE A;  3J80 D;  4LF5 C;  1MXA A;  4FUQ A;  4X62 C;  2VQF C;  5BSV A;  4RM3 A;  3VNR A;  3TUF A;  4DR2 C;  4GKK C;  5LCI A;  4PUI A;  3C5E A;  4MTN A;  4HPV A;  2ZZM A;  4KHP C;  3VNS A;  3UEB A;  4TPS B;  2YWC A;  4NXM C;  1FUG A;  4ISB A;  5AE2 A;  3R44 A;  2NCL A;  4GXQ A;  3GR0 A;  1N34 C;  1N33 C;  1XHJ A;  3TQI A;  5GTD A;  3LNO A;  2WD9 A;  3FCC A;  4JI5 C;  4I9F A;  4IZ6 A;  3IPL A;  4ZJZ A;  4G36 A;  2Z51 A;  2P2B A;  5A1I A;  3CW8 X;  2P2M A;  3EER A;  5BUQ A;  3KXW A;  1RY2 A;  1XS3 A;  5DV9 A;  1HNZ C;  4RMN A;  1ZB9 A;  4X64 C;  1RG9 A;  1PG4 A;  2MMA B;  1ULT A;  5T8S A;  2DHM A;  5IFI A;  3LAX A;  2F4V C;  3B7W A;  4DCV A;  2D27 A;  1WH9 A;  4LF9 C;  2D1S A;  2DYJ A;  4JI7 C;  2OBV A;  2E7G A;  3E7X A;  1IBM C;  3RG2 A;  4FTF A;  1EGA A;  3RV2 A;  2D1Q A;  1N36 C;  2MCQ A;  4KTT A;  3A25 A;  4R1L A;  4DR5 C;  1XNR C;  1LCI A;  5A19 A;  2BH1 X;  1PU1 A;  3IEU A;  4NOZ A; 
#chains in the Genus database with same CATH homology
 3T1H C;  2UU9 C;  3JAM D;  4B3T C;  4NDN A;  4GXR A;  1I94 C;  4BBY A;  5BUR A;  4IR7 A;  4DR1 C;  1K0R A;  1QM4 A;  1MXB A;  2Y27 A;  4DCU A;  4DR6 C;  4DR4 C;  2QW0 X;  4X66 C;  2E8F A;  2D7V A;  4RLF A;  1MDF A;  2ONF A;  2HHH C;  3A9U A;  2UXD C;  4B3S C;  4JI0 C;  4JI8 C;  4AQY C;  1HH2 P;  1YJ7 A;  3VNQ A;  5KEI A;  2QL8 A;  3NYQ A;  1FJG C;  4FUT A;  3FCE A;  3EQ6 A;  1BA3 A;  1L2F A;  1VLA A;  4BCA A;  1XNQ C;  3PES A;  4DV0 C;  2E8C A;  5AE3 A;  3GKU A;  4L4Q A;  3AF5 A;  4DUZ C;  1P7L A;  1USP A;  2Y4N A;  3PRO C;  4OXI A;  5A1G A;  1O93 A;  2AYA A;  2KZF A;  2XR1 A;  2YCB A;  4DG8 A;  1HNW C;  3I07 A;  3DHV A;  3LUS A;  5IWA C;  3DLP X;  4B3M C;  2EGT A;  3R9X A;  4R0M A;  5FLX D;  2OPL B;  3G7S A;  2CY1 A;  1XRC A;  3S82 A;  4K0K C;  2V7B A;  4R1M A;  4PRO C;  4DV3 C;  2UXB C;  2UUC C;  3A9V A;  4GS5 A;  4RVN A;  2E8E A;  4DCS A;  2D1R A;  4JI3 C;  4B3R C;  4RLQ A;  4DV7 C;  5A2Q D;  2ATW A;  4NXN C;  3OTO C;  4DCT A;  2P2Q A;  1USP B;  5T8T A;  4LFC C;  3L95 X;  4G1I A;  3LGX A;  1XMQ C;  3ETC A;  2D1T A;  4XX2 A;  5BSM A;  4DV4 C;  2HJG A;  4D4G A;  4JYA C;  4EAT A;  4DUY C;  1MDB A;  3UZ0 A;  4JI2 C;  1LQL A;  1IBL C;  4BC7 A;  1PG3 A;  3A4I A;  4L7I A;  1KKG A;  3N2Q A;  3CW9 A;  5K8F A;  4DR7 C;  4KTV A;  2D28 C;  4JV5 C;  1O90 A;  5K85 A;  5CZV A;  3T1Y C;  4WS9 A;  2OO4 A;  5E7Q A;  4LFA C;  4X65 C;  1GPM A;  4DV1 C;  3GPC A;  4DR3 C;  4BSZ A;  2DPL A;  1MXC A;  1MD9 A;  1QWI A;  2UXC C;  2JMP A;  4LFB C;  4DV6 C;  1WF3 A;  3DAY A;  1NYE A;  3NPD A;  4DV5 C;  3AF6 A;  5CZX A;  5KYT A;  2YWB A;  4ZLP A;  4PZP A;  2PN2 A;  5JRH A;  4YHH C;  2UUA C;  3IML A;  2QVZ X;  5KYV A;  1V26 A;  2VZE A;  3PBK A;  2E0G A;  2VSQ A;  3UOW A;  2P20 A;  3L8C A;  4PHT A;  1XMO C;  4LF7 C;  2Y4O A;  5BSR A;  4WV3 A;  4LF8 C;  3NYR A;  4BC9 A;  4I9G A;  5BR8 C;  4LE5 A;  3R9W A;  4JI4 C;  1ZB8 A;  3ETO A;  4JI1 C;  2QVY X;  4D56 A;  1AMU A;  5LMN C;  3J7A D;  3NI2 A;  4DV2 C;  3H2T A;  1XRA A;  2PRO A;  4D57 A;  4K0B A;  1T5H X;  3LNV A;  2P02 A;  4L2Z A;  4RVO A;  4OX9 C;  3I08 A;  3SO4 A;  4RM2 A;  5AE1 A;  1J5E C;  3J81 D;  1PA4 A;  2QVX X;  1O92 A;  5BSU A;  5LMU C;  2VQE C;  2CXC A;  4LF4 C;  1ML8 A;  2PT7 G;  4LF6 C;  1HR0 C;  2ASB A;  1HNX C;  5BSW A;  4JI6 C;  1XRB A;  4G37 A;  4U5Y D;  3N54 B;  1UKK A;  2ZM6 C;  5ADZ A;  1JOS A;  3TDE A;  3GR1 A;  2WP0 C;  4DG9 A;  2UUB C;  1IBK C;  1T5D X;  4GKJ C;  1MKY A;  5BUS A;  4MH4 A;  3IEV A;  4ODJ A;  4JM1 A;  2P2F A;  2E5L C;  4OYC A;  1N2F A;  5IT9 D;  1V25 A;  2OPL A;  1O9T A;  5H9U A;  5BST A;  4D4I A;  1N32 C;  2P2J A;  3E7W A;  4YY3 C;  2BJO A;  3J80 D;  3CJE A;  4LF5 C;  1MXA A;  4FUQ A;  4X62 C;  2VQF C;  5BSV A;  4RM3 A;  3VNR A;  3TUF A;  4DR2 C;  4GKK C;  3C5E A;  4MTN A;  4HPV A;  4KHP C;  3VNS A;  4TPS B;  2YWC A;  4NXM C;  1FUG A;  4ISB A;  5AE2 A;  3R44 A;  4GXQ A;  3GR0 A;  1N34 C;  1N33 C;  3TQI A;  5GTD A;  2WD9 A;  3FCC A;  4JI5 C;  4I9F A;  4IZ6 A;  3IPL A;  4ZJZ A;  4G36 A;  2P2B A;  5A1I A;  3CW8 X;  2P2M A;  3EER A;  5BUQ A;  3KXW A;  1RY2 A;  5DV9 A;  1HNZ C;  4RMN A;  1ZB9 A;  4X64 C;  1RG9 A;  1PG4 A;  1ULT A;  5T8S A;  5IFI A;  3LAX A;  2F4V C;  3B7W A;  4DCV A;  2D27 A;  1WH9 A;  4LF9 C;  2D1S A;  2DYJ A;  4JI7 C;  2OBV A;  2E7G A;  3E7X A;  1IBM C;  3RG2 A;  4FTF A;  1EGA A;  3RV2 A;  2D1Q A;  1N36 C;  4KTT A;  4R1L A;  4DR5 C;  1XNR C;  1LCI A;  5A19 A;  2BH1 X;  3IEU A;  4NOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...