1N36C

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1n36C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1n36C02
3J81D 3IEVA 1USPB 4X66C 4DR5C 1QWIA 4DCTA 2UUCC 1N2FA 2E8CA 4B3RC 3CJEA 2QL8A 1J5EC 4DCVA 2D7VA 4LFBC 1L2FA 3GKUA 2EGTA 4DV7C 4DV0C 3R9WA 2DYJA 3EERA 3J80D 4X62C 5IT9D 1ZB9A 4JI5C 2CY1A 4DR6C 2YCBA 1USPA 1LQLA 4KHPC 1XMQC 4B3MC 4OX9C 4JI7C 2CXCA 4DUZC 4YY3C 2E7GA 5LMUC 4JV5C 1ZB8A 2PT7G 1XNRC 2UXCC 2UU9C 4JI1C 1KKGA 1HNZC 2VQFC 2UXBC 4B3SC 4LF9C 1N32C 3AF6A 1HH2P 1WF3A 4DCUA 1N33C 4JI0C 2PN2A 4LFAC 2ATWA 4DV2C 1XMOC 1UKKA 4B3TC 2UUAC 2VQEC 4DR7C 4DV3C 1MKYA 3IEUA 4DCSA 4JI8C 1XNQC 4LF7C 4AQYC 4MTNA 2XR1A 4YHHC 4DV6C 4JYAC 4JI4C 5IWAC 3JAMD 3OTOC 4DR4C 4X64C 3LUSA 1K0RA 2ASBA 1IBLC 4BSZA 4X65C 2KZFA 1IBKC 4JI6C 2UXDC 3AF5A 1VLAA 4DR2C 3T1YC 2OPLB 1HR0C 4DR1C 3I07A 2JMPA 4GKJC 4DR3C 1N36C 4XX2A 1N34C 4NOZA 4DV5C 4DV1C 4LF5C 4MH4A 1WH9A 2F4VC 2E8EA 1JOSA 1PA4A 4DV4C 1IBMC 2UUBC 5BR8C 3J7AD 2HHHC 4DUYC 5FLXD 2E8FA 2ZM6C 3T1HC 4JI2C 1FJGC 1HNWC 4LFCC 1EGAA 1HNXC 3R9XA 4LF6C 1I94C 4NXNC 4NXMC 2OPLA 4K0KC 5A2QD 2BJOA 2HJGA 2ONFA 4JI3C 2E5LC 4LF8C 1NYEA 4LF4C 4GKKC 5LMNC 1ML8A
chains in the Genus database with same CATH superfamily
3IEVA 3A25A 3G7SA 4DR5C 3IMLA 2E8CA 4B3RC 3CJEA 4DG9A 1MXBA 1PG3A 5H9UA 1P7LA 3N54B 3E7WA 3R9WA 3DAYA 1ZB9A 4JI5C 2Y27A 4G1IA 3ETCA 4DR6C 3FM7A 2MM9A 3O2EA 1XHJA 5AE1A 1XNRC 4D56A 4JI1C 3GPCA 3AF6A 2YWBA 3ETOA 3CQ3A 1N33C 5BURA 2Z51A 2ATWA 3TR3A 4FUQA 1UKKA 2VQEC 4DR7C 4DV3C 4FTFA 3IEUA 1XNQC 4R0MA 4AQYC 5IWAC 2MCQA 1O9TA 5E7QA 5KEIA 3T1YC 1VLAA 4RMNA 5A1GA 3S82A 2OBVA 3CW8X 4R1MA 4DR1C 1HR0C 4KTVA 1M6XC 4PHTA 4XX2A 4DV5C 2DPLA 4LF5C 3LNVA 4G36A 2E8EA 1PA4A 4DV4C 2UUBC 4FUTA 3T1HC 3SO4A 1MXCA 3NYQA 1FJGC 4LFCC 1EGAA 1AMUA 2QVYX 1I94C 5A2QD 5KYVA 1QM4A 4RM3A 4DG8A 4LF8C 2NCLA 4LF4C 5LMNC 1GPMA 2M5HA 1USPB 1QWIA 2MMAB 2QVZX 5GTDA 3CQ1A 4DCVA 1MXAA 3UZ0A 3E7XA 4DV7C 1O93A 1O92A 1PG4A 3B7WA 4X62C 1O90A 2P2FA 1YJ7A 2V7BA 2VSQA 3DLPX 3KXWA 4OX9C 4JI7C 2CXCA 4WV3A 4KTTA 4EATA 3PESA 3LAXA 2UXCC 1P4EC 2QVXX 1KKGA 1HNZC 5DV9A 4B3SC 4ZJZA 1MDBA 5KYTA 1XS3A 5IFIA 3RG2A 3EQ6A 4PUGA 1P4EA 4D57A 4BBYA 5BSVA 4B3TC 1ULTA 1MKYA 5CZVA 5BUQA 4JI8C 5ADZA 4I9GA 2WP0C 4PUHA 5AE2A 2AYAA 4K0BA 4JYAC 4JI4C 3OTOC 3JAMD 4X64C 2P2QA 3LGXA 3NPDA 3PROC 1IBLC 4GXRA 2D1QA 2KZFA 5BSUA 1IBKC 4DR2C 2YX1A 4JM1A 4R1LA 2PG1E 2JMPA 1N36C 5A1IA 1N34C 3A4IA 3UEBA 4OYCA 4MH4A 4GXQA 3GR0A 1WH9A 3NYRA 2D1SA 1IBMC 2P02A 4PROC 3J7AD 3IPLA 5FLXD 2E8FA 4L7IA 4BCAA 2WD9A 2ZM6C 1YGTA 2D27A 2PROA 1HNWC 1HNXC 4LF6C 4NXNC 2OPLA 3PBKA 4WS9A 4JI3C 3H2TA 4D4IA 5T8SA 1ML8A 4X66C 4PUIA 3FCCA 3VNSA 3LNOA 1PU1A 1FUGA 2QL8A 1J5EC 2KDNA 2D7VA 3A26A 2EGTA 4DV0C 2DYJA 3GR1A 4ZLPA 2YCBA 4KHPC 4B3MC 4DUZC 2E7GA 2M5OA 2KZ0A 1T5HX 2PT7G 5BSWA 2UU9C 2UXBC 3K6RA 4LF9C 2ZTBA 4L4QA 2D28C 2P2MA 5BSTA 2ZZMA 4BC9A 3TDEA 4LFAC 1V26A 3A9VA 1NY8A 3UX2A 4DCSA 3UOWA 4G37A 4MTNA 2DHMA 2BH1X 5K85A 4DR4C 4I9FA 3TUFA 1FLOA 4RVOA 3L8CA 2YWCA 1K0RA 1BA3A 4BSZA 1V60A 4JI6C 3CQ2A 4D4GA 1MD9A 4RM2A 2P20A 2P2JA 3I07A 5AE3A 4DR3C 4DV1C 5BUSA 2VZEA 1JOSA 5K8FA 1VEHA 5BR8C 4OXIA 4DUYC 1IB8A 4RLQA 1V25A 3R9XA 5LCIA 4K0KC 4TPSB 3TQIA 2E5LC 3J81D 2Y4NA 1XDXA 4RVNA 4DCTA 2D1TA 3L95X 1RG9A 3VNQA 2UUCC 1N2FA 5BSRA 1T5DX 3C5EA 2Y4OA 1L2FA 4LFBC 3GKUA 2P2BA 4IR7A 3EERA 3J80D 1MDFA 5IT9D 3AY0A 1LCIA 2E0GA 1XRBA 2CY1A 1TH5A 1USPA 1LQLA 1XMQC 3R44A 1XRCA 4YY3C 4GS5A 5LMUC 4HPVA 4JV5C 1ZB8A 4PZPA 4NDNA 2VQFC 5BSMA 1N32C 3RV2A 2OO4A 1HH2P 1WF3A 4DCUA 4JI0C 2PN2A 3CW9A 4L2ZA 4RLFA 4DV2C 1XMOC 2UUAC 5JRHA 4LF7C 4BC7A 2XR1A 4YHHC 1RY2A 4DV6C 1M6XA 4U5YD 1XRAA 2D1RA 4ISBA 3LUSA 2ASBA 3N2QA 3FCEA 4X65C 2UXDC 3AF5A 4LE5A 2OPLB 3A9UA 4GKJC 2JNVA 4ODJA 2CU6A 4NOZA 2ZZNA 2F4VC 4IZ6A 3UX3A 5CZXA 3DHVA 2HHHC 3VNRA 5A19A 1WCJA 4JI2C 1UWDA 4NXMC 5T8TA 2BJOA 2HJGA 2ONFA 1NYEA 4GKKC 3NI2A 3I08A 2QW0X
chains in the Genus database with same CATH topology
3IEVA 3G7SA 4DR5C 3IMLA 2E8CA 4B3RC 3CJEA 4DG9A 1MXBA 1PG3A 5H9UA 1P7LA 3N54B 3E7WA 3R9WA 3DAYA 1ZB9A 4JI5C 2Y27A 4G1IA 3ETCA 4DR6C 5AE1A 1XNRC 4D56A 4JI1C 3GPCA 3AF6A 2YWBA 3ETOA 1N33C 5BURA 2ATWA 4FUQA 1UKKA 2VQEC 4DR7C 4DV3C 4FTFA 3IEUA 1XNQC 4R0MA 4AQYC 5IWAC 1O9TA 5E7QA 5KEIA 3T1YC 1VLAA 4RMNA 5A1GA 3S82A 2OBVA 3CW8X 4R1MA 4DR1C 1HR0C 4KTVA 4PHTA 4XX2A 4DV5C 2DPLA 4LF5C 3LNVA 4G36A 2E8EA 1PA4A 4DV4C 2UUBC 4FUTA 3T1HC 3SO4A 1MXCA 3NYQA 1FJGC 4LFCC 1EGAA 1AMUA 2QVYX 1I94C 5A2QD 5KYVA 1QM4A 4RM3A 4DG8A 4LF8C 4LF4C 5LMNC 1GPMA 1USPB 1QWIA 2QVZX 5GTDA 4DCVA 1MXAA 3UZ0A 4DV7C 3E7XA 1O93A 1O92A 1PG4A 3B7WA 4X62C 1O90A 2P2FA 1YJ7A 2V7BA 2VSQA 3DLPX 3KXWA 4OX9C 4JI7C 2CXCA 4WV3A 4KTTA 4EATA 3PESA 3LAXA 2UXCC 2QVXX 1KKGA 1HNZC 5DV9A 4B3SC 4ZJZA 1MDBA 5KYTA 5IFIA 3RG2A 3EQ6A 4D57A 4BBYA 5BSVA 4B3TC 1ULTA 1MKYA 5CZVA 5BUQA 4JI8C 5ADZA 4I9GA 2WP0C 5AE2A 2AYAA 4K0BA 4JYAC 4JI4C 3OTOC 3JAMD 4X64C 2P2QA 3LGXA 3NPDA 3PROC 1IBLC 4GXRA 2D1QA 2KZFA 5BSUA 1IBKC 4DR2C 4JM1A 4R1LA 2JMPA 1N36C 5A1IA 1N34C 3A4IA 4OYCA 4MH4A 4GXQA 3GR0A 1WH9A 3NYRA 2D1SA 1IBMC 2P02A 4PROC 3J7AD 3IPLA 5FLXD 2E8FA 4L7IA 4BCAA 2WD9A 2ZM6C 2D27A 2PROA 1HNWC 1HNXC 4LF6C 4NXNC 2OPLA 3PBKA 4WS9A 4JI3C 3H2TA 4D4IA 5T8SA 1ML8A 4X66C 3FCCA 3VNSA 1FUGA 2QL8A 1J5EC 2D7VA 2EGTA 4DV0C 2DYJA 3GR1A 4ZLPA 2YCBA 4KHPC 4B3MC 4DUZC 2E7GA 1T5HX 2PT7G 5BSWA 2UU9C 2UXBC 4LF9C 4L4QA 2D28C 2P2MA 5BSTA 4BC9A 3TDEA 4LFAC 1V26A 3A9VA 4DCSA 3UOWA 4G37A 4MTNA 2BH1X 5K85A 4DR4C 4I9FA 3TUFA 4RVOA 3L8CA 2YWCA 1K0RA 1BA3A 4BSZA 4JI6C 4D4GA 1MD9A 4RM2A 2P20A 2P2JA 3I07A 5AE3A 4DR3C 4DV1C 5BUSA 2VZEA 1JOSA 5K8FA 5BR8C 4OXIA 4DUYC 4RLQA 1V25A 3R9XA 4K0KC 4TPSB 3TQIA 2E5LC 3J81D 2Y4NA 4RVNA 4DCTA 2D1TA 3L95X 1RG9A 3VNQA 2UUCC 1N2FA 5BSRA 1T5DX 3C5EA 2Y4OA 1L2FA 4LFBC 3GKUA 2P2BA 4IR7A 3EERA 3J80D 1MDFA 5IT9D 1LCIA 2E0GA 1XRBA 2CY1A 1USPA 1LQLA 1XMQC 3R44A 1XRCA 4YY3C 4GS5A 5LMUC 4HPVA 4JV5C 1ZB8A 4PZPA 4NDNA 2VQFC 5BSMA 1N32C 3RV2A 2OO4A 1HH2P 1WF3A 4DCUA 4JI0C 2PN2A 3CW9A 4L2ZA 4RLFA 4DV2C 1XMOC 2UUAC 5JRHA 4LF7C 4BC7A 2XR1A 4YHHC 1RY2A 4DV6C 4U5YD 1XRAA 2D1RA 4ISBA 3LUSA 2ASBA 3N2QA 3FCEA 4X65C 2UXDC 3AF5A 4LE5A 2OPLB 3A9UA 4GKJC 4ODJA 4NOZA 2F4VC 4IZ6A 5CZXA 3DHVA 2HHHC 3VNRA 5A19A 4JI2C 4NXMC 5T8TA 2BJOA 2HJGA 2ONFA 1NYEA 4GKKC 3NI2A 3I08A 2QW0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 D;  3IEV A;  1USP B;  4X66 C;  4DR5 C;  1QWI A;  4DCT A;  2UUC C;  1N2F A;  2E8C A;  4B3R C;  3CJE A;  2QL8 A;  1J5E C;  4DCV A;  2D7V A;  4LFB C;  1L2F A;  3GKU A;  2EGT A;  4DV7 C;  4DV0 C;  3R9W A;  2DYJ A;  3EER A;  3J80 D;  4X62 C;  5IT9 D;  1ZB9 A;  4JI5 C;  2CY1 A;  4DR6 C;  2YCB A;  1USP A;  1LQL A;  4KHP C;  1XMQ C;  4B3M C;  4OX9 C;  4JI7 C;  2CXC A;  4DUZ C;  4YY3 C;  2E7G A;  5LMU C;  4JV5 C;  1ZB8 A;  2PT7 G;  1XNR C;  2UXC C;  2UU9 C;  4JI1 C;  1KKG A;  1HNZ C;  2VQF C;  2UXB C;  4B3S C;  4LF9 C;  1N32 C;  3AF6 A;  1HH2 P;  1WF3 A;  4DCU A;  1N33 C;  4JI0 C;  2PN2 A;  4LFA C;  2ATW A;  4DV2 C;  1XMO C;  1UKK A;  4B3T C;  2UUA C;  2VQE C;  4DR7 C;  4DV3 C;  1MKY A;  3IEU A;  4DCS A;  4JI8 C;  1XNQ C;  4LF7 C;  4AQY C;  4MTN A;  2XR1 A;  4YHH C;  4DV6 C;  4JYA C;  4JI4 C;  5IWA C;  3JAM D;  3OTO C;  4DR4 C;  4X64 C;  3LUS A;  1K0R A;  2ASB A;  1IBL C;  4BSZ A;  4X65 C;  2KZF A;  1IBK C;  4JI6 C;  2UXD C;  3AF5 A;  1VLA A;  4DR2 C;  3T1Y C;  2OPL B;  1HR0 C;  4DR1 C;  3I07 A;  2JMP A;  4GKJ C;  4DR3 C;  1N36 C;  4XX2 A;  1N34 C;  4NOZ A;  4DV5 C;  4DV1 C;  4LF5 C;  4MH4 A;  1WH9 A;  2F4V C;  2E8E A;  1JOS A;  1PA4 A;  4DV4 C;  1IBM C;  2UUB C;  5BR8 C;  3J7A D;  2HHH C;  4DUY C;  5FLX D;  2E8F A;  2ZM6 C;  3T1H C;  4JI2 C;  1FJG C;  1HNW C;  4LFC C;  1EGA A;  1HNX C;  3R9X A;  4LF6 C;  1I94 C;  4NXN C;  4NXM C;  2OPL A;  4K0K C;  5A2Q D;  2BJO A;  2HJG A;  2ONF A;  4JI3 C;  2E5L C;  4LF8 C;  1NYE A;  4LF4 C;  4GKK C;  5LMN C;  1ML8 A; 
#chains in the Genus database with same CATH topology
 3IEV A;  3A25 A;  3G7S A;  4DR5 C;  3IML A;  2E8C A;  4B3R C;  3CJE A;  4DG9 A;  1MXB A;  1PG3 A;  5H9U A;  1P7L A;  3N54 B;  3E7W A;  3R9W A;  3DAY A;  1ZB9 A;  4JI5 C;  2Y27 A;  4G1I A;  3ETC A;  4DR6 C;  3FM7 A;  2MM9 A;  3O2E A;  1XHJ A;  5AE1 A;  1XNR C;  4D56 A;  4JI1 C;  3GPC A;  3AF6 A;  2YWB A;  3ETO A;  3CQ3 A;  1N33 C;  5BUR A;  2Z51 A;  2ATW A;  3TR3 A;  4FUQ A;  1UKK A;  2VQE C;  4DR7 C;  4DV3 C;  4FTF A;  3IEU A;  1XNQ C;  4R0M A;  4AQY C;  5IWA C;  2MCQ A;  1O9T A;  5E7Q A;  5KEI A;  3T1Y C;  1VLA A;  4RMN A;  5A1G A;  3S82 A;  2OBV A;  3CW8 X;  4R1M A;  4DR1 C;  1HR0 C;  4KTV A;  1M6X C;  4PHT A;  4XX2 A;  4DV5 C;  2DPL A;  4LF5 C;  3LNV A;  4G36 A;  2E8E A;  1PA4 A;  4DV4 C;  2UUB C;  4FUT A;  3T1H C;  3SO4 A;  1MXC A;  3NYQ A;  1FJG C;  4LFC C;  1EGA A;  1AMU A;  2QVY X;  1I94 C;  5A2Q D;  5KYV A;  1QM4 A;  4RM3 A;  4DG8 A;  4LF8 C;  2NCL A;  4LF4 C;  5LMN C;  1GPM A;  2M5H A;  1USP B;  1QWI A;  2MMA B;  2QVZ X;  5GTD A;  3CQ1 A;  4DCV A;  1MXA A;  3UZ0 A;  3E7X A;  4DV7 C;  1O93 A;  1O92 A;  1PG4 A;  3B7W A;  4X62 C;  1O90 A;  2P2F A;  1YJ7 A;  2V7B A;  2VSQ A;  3DLP X;  3KXW A;  4OX9 C;  4JI7 C;  2CXC A;  4WV3 A;  4KTT A;  4EAT A;  3PES A;  3LAX A;  2UXC C;  1P4E C;  2QVX X;  1KKG A;  1HNZ C;  5DV9 A;  4B3S C;  4ZJZ A;  1MDB A;  5KYT A;  1XS3 A;  5IFI A;  3RG2 A;  3EQ6 A;  4PUG A;  1P4E A;  4D57 A;  4BBY A;  5BSV A;  4B3T C;  1ULT A;  1MKY A;  5CZV A;  5BUQ A;  4JI8 C;  5ADZ A;  4I9G A;  2WP0 C;  4PUH A;  5AE2 A;  2AYA A;  4K0B A;  4JYA C;  4JI4 C;  3OTO C;  3JAM D;  4X64 C;  2P2Q A;  3LGX A;  3NPD A;  3PRO C;  1IBL C;  4GXR A;  2D1Q A;  2KZF A;  5BSU A;  1IBK C;  4DR2 C;  2YX1 A;  4JM1 A;  4R1L A;  2PG1 E;  2JMP A;  1N36 C;  5A1I A;  1N34 C;  3A4I A;  3UEB A;  4OYC A;  4MH4 A;  4GXQ A;  3GR0 A;  1WH9 A;  3NYR A;  2D1S A;  1IBM C;  2P02 A;  4PRO C;  3J7A D;  3IPL A;  5FLX D;  2E8F A;  4L7I A;  4BCA A;  2WD9 A;  2ZM6 C;  1YGT A;  2D27 A;  2PRO A;  1HNW C;  1HNX C;  4LF6 C;  4NXN C;  2OPL A;  3PBK A;  4WS9 A;  4JI3 C;  3H2T A;  4D4I A;  5T8S A;  1ML8 A;  4X66 C;  4PUI A;  3FCC A;  3VNS A;  3LNO A;  1PU1 A;  1FUG A;  2QL8 A;  1J5E C;  2KDN A;  2D7V A;  3A26 A;  2EGT A;  4DV0 C;  2DYJ A;  3GR1 A;  4ZLP A;  2YCB A;  4KHP C;  4B3M C;  4DUZ C;  2E7G A;  2M5O A;  2KZ0 A;  1T5H X;  2PT7 G;  5BSW A;  2UU9 C;  2UXB C;  3K6R A;  4LF9 C;  2ZTB A;  4L4Q A;  2D28 C;  2P2M A;  5BST A;  2ZZM A;  4BC9 A;  3TDE A;  4LFA C;  1V26 A;  3A9V A;  1NY8 A;  3UX2 A;  4DCS A;  3UOW A;  4G37 A;  4MTN A;  2DHM A;  2BH1 X;  5K85 A;  4DR4 C;  4I9F A;  3TUF A;  1FLO A;  4RVO A;  3L8C A;  2YWC A;  1K0R A;  1BA3 A;  4BSZ A;  1V60 A;  4JI6 C;  3CQ2 A;  4D4G A;  1MD9 A;  4RM2 A;  2P20 A;  2P2J A;  3I07 A;  5AE3 A;  4DR3 C;  4DV1 C;  5BUS A;  2VZE A;  1JOS A;  5K8F A;  1VEH A;  5BR8 C;  4OXI A;  4DUY C;  1IB8 A;  4RLQ A;  1V25 A;  3R9X A;  5LCI A;  4K0K C;  4TPS B;  3TQI A;  2E5L C;  3J81 D;  2Y4N A;  1XDX A;  4RVN A;  4DCT A;  2D1T A;  3L95 X;  1RG9 A;  3VNQ A;  2UUC C;  1N2F A;  5BSR A;  1T5D X;  3C5E A;  2Y4O A;  1L2F A;  4LFB C;  3GKU A;  2P2B A;  4IR7 A;  3EER A;  3J80 D;  1MDF A;  5IT9 D;  3AY0 A;  1LCI A;  2E0G A;  1XRB A;  2CY1 A;  1TH5 A;  1USP A;  1LQL A;  1XMQ C;  3R44 A;  1XRC A;  4YY3 C;  4GS5 A;  5LMU C;  4HPV A;  4JV5 C;  1ZB8 A;  4PZP A;  4NDN A;  2VQF C;  5BSM A;  1N32 C;  3RV2 A;  2OO4 A;  1HH2 P;  1WF3 A;  4DCU A;  4JI0 C;  2PN2 A;  3CW9 A;  4L2Z A;  4RLF A;  4DV2 C;  1XMO C;  2UUA C;  5JRH A;  4LF7 C;  4BC7 A;  2XR1 A;  4YHH C;  1RY2 A;  4DV6 C;  1M6X A;  4U5Y D;  1XRA A;  2D1R A;  4ISB A;  3LUS A;  2ASB A;  3N2Q A;  3FCE A;  4X65 C;  2UXD C;  3AF5 A;  4LE5 A;  2OPL B;  3A9U A;  4GKJ C;  2JNV A;  4ODJ A;  2CU6 A;  4NOZ A;  2ZZN A;  2F4V C;  4IZ6 A;  3UX3 A;  5CZX A;  3DHV A;  2HHH C;  3VNR A;  5A19 A;  1WCJ A;  4JI2 C;  1UWD A;  4NXM C;  5T8T A;  2BJO A;  2HJG A;  2ONF A;  1NYE A;  4GKK C;  3NI2 A;  3I08 A;  2QW0 X; 
#chains in the Genus database with same CATH homology
 3IEV A;  3G7S A;  4DR5 C;  3IML A;  2E8C A;  4B3R C;  3CJE A;  4DG9 A;  1MXB A;  1PG3 A;  5H9U A;  1P7L A;  3N54 B;  3E7W A;  3R9W A;  3DAY A;  1ZB9 A;  4JI5 C;  2Y27 A;  4G1I A;  3ETC A;  4DR6 C;  5AE1 A;  1XNR C;  4D56 A;  4JI1 C;  3GPC A;  3AF6 A;  2YWB A;  3ETO A;  1N33 C;  5BUR A;  2ATW A;  4FUQ A;  1UKK A;  2VQE C;  4DR7 C;  4DV3 C;  4FTF A;  3IEU A;  1XNQ C;  4R0M A;  4AQY C;  5IWA C;  1O9T A;  5E7Q A;  5KEI A;  3T1Y C;  1VLA A;  4RMN A;  5A1G A;  3S82 A;  2OBV A;  3CW8 X;  4R1M A;  4DR1 C;  1HR0 C;  4KTV A;  4PHT A;  4XX2 A;  4DV5 C;  2DPL A;  4LF5 C;  3LNV A;  4G36 A;  2E8E A;  1PA4 A;  4DV4 C;  2UUB C;  4FUT A;  3T1H C;  3SO4 A;  1MXC A;  3NYQ A;  1FJG C;  4LFC C;  1EGA A;  1AMU A;  2QVY X;  1I94 C;  5A2Q D;  5KYV A;  1QM4 A;  4RM3 A;  4DG8 A;  4LF8 C;  4LF4 C;  5LMN C;  1GPM A;  1USP B;  1QWI A;  2QVZ X;  5GTD A;  4DCV A;  1MXA A;  3UZ0 A;  4DV7 C;  3E7X A;  1O93 A;  1O92 A;  1PG4 A;  3B7W A;  4X62 C;  1O90 A;  2P2F A;  1YJ7 A;  2V7B A;  2VSQ A;  3DLP X;  3KXW A;  4OX9 C;  4JI7 C;  2CXC A;  4WV3 A;  4KTT A;  4EAT A;  3PES A;  3LAX A;  2UXC C;  2QVX X;  1KKG A;  1HNZ C;  5DV9 A;  4B3S C;  4ZJZ A;  1MDB A;  5KYT A;  5IFI A;  3RG2 A;  3EQ6 A;  4D57 A;  4BBY A;  5BSV A;  4B3T C;  1ULT A;  1MKY A;  5CZV A;  5BUQ A;  4JI8 C;  5ADZ A;  4I9G A;  2WP0 C;  5AE2 A;  2AYA A;  4K0B A;  4JYA C;  4JI4 C;  3OTO C;  3JAM D;  4X64 C;  2P2Q A;  3LGX A;  3NPD A;  3PRO C;  1IBL C;  4GXR A;  2D1Q A;  2KZF A;  5BSU A;  1IBK C;  4DR2 C;  4JM1 A;  4R1L A;  2JMP A;  1N36 C;  5A1I A;  1N34 C;  3A4I A;  4OYC A;  4MH4 A;  4GXQ A;  3GR0 A;  1WH9 A;  3NYR A;  2D1S A;  1IBM C;  2P02 A;  4PRO C;  3J7A D;  3IPL A;  5FLX D;  2E8F A;  4L7I A;  4BCA A;  2WD9 A;  2ZM6 C;  2D27 A;  2PRO A;  1HNW C;  1HNX C;  4LF6 C;  4NXN C;  2OPL A;  3PBK A;  4WS9 A;  4JI3 C;  3H2T A;  4D4I A;  5T8S A;  1ML8 A;  4X66 C;  3FCC A;  3VNS A;  1FUG A;  2QL8 A;  1J5E C;  2D7V A;  2EGT A;  4DV0 C;  2DYJ A;  3GR1 A;  4ZLP A;  2YCB A;  4KHP C;  4B3M C;  4DUZ C;  2E7G A;  1T5H X;  2PT7 G;  5BSW A;  2UU9 C;  2UXB C;  4LF9 C;  4L4Q A;  2D28 C;  2P2M A;  5BST A;  4BC9 A;  3TDE A;  4LFA C;  1V26 A;  3A9V A;  4DCS A;  3UOW A;  4G37 A;  4MTN A;  2BH1 X;  5K85 A;  4DR4 C;  4I9F A;  3TUF A;  4RVO A;  3L8C A;  2YWC A;  1K0R A;  1BA3 A;  4BSZ A;  4JI6 C;  4D4G A;  1MD9 A;  4RM2 A;  2P20 A;  2P2J A;  3I07 A;  5AE3 A;  4DR3 C;  4DV1 C;  5BUS A;  2VZE A;  1JOS A;  5K8F A;  5BR8 C;  4OXI A;  4DUY C;  4RLQ A;  1V25 A;  3R9X A;  4K0K C;  4TPS B;  3TQI A;  2E5L C;  3J81 D;  2Y4N A;  4RVN A;  4DCT A;  2D1T A;  3L95 X;  1RG9 A;  3VNQ A;  2UUC C;  1N2F A;  5BSR A;  1T5D X;  3C5E A;  2Y4O A;  1L2F A;  4LFB C;  3GKU A;  2P2B A;  4IR7 A;  3EER A;  3J80 D;  1MDF A;  5IT9 D;  1LCI A;  2E0G A;  1XRB A;  2CY1 A;  1USP A;  1LQL A;  1XMQ C;  3R44 A;  1XRC A;  4YY3 C;  4GS5 A;  5LMU C;  4HPV A;  4JV5 C;  1ZB8 A;  4PZP A;  4NDN A;  2VQF C;  5BSM A;  1N32 C;  3RV2 A;  2OO4 A;  1HH2 P;  1WF3 A;  4DCU A;  4JI0 C;  2PN2 A;  3CW9 A;  4L2Z A;  4RLF A;  4DV2 C;  1XMO C;  2UUA C;  5JRH A;  4LF7 C;  4BC7 A;  2XR1 A;  4YHH C;  1RY2 A;  4DV6 C;  4U5Y D;  1XRA A;  2D1R A;  4ISB A;  3LUS A;  2ASB A;  3N2Q A;  3FCE A;  4X65 C;  2UXD C;  3AF5 A;  4LE5 A;  2OPL B;  3A9U A;  4GKJ C;  4ODJ A;  4NOZ A;  2F4V C;  4IZ6 A;  5CZX A;  3DHV A;  2HHH C;  3VNR A;  5A19 A;  4JI2 C;  4NXM C;  5T8T A;  2BJO A;  2HJG A;  2ONF A;  1NYE A;  4GKK C;  3NI2 A;  3I08 A;  2QW0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...