2UU9C

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uu9C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uu9C02
4AQYC 1HNXC 4JI0C 4LF5C 2E7GA 1EGAA 2ZM6C 4B3MC 1ML8A 4JI1C 4DR7C 4DV6C 4DR2C 2CY1A 2HJGA 2JMPA 3R9XA 1XMQC 1N33C 4K0KC 2UXCC 3R9WA 4GKKC 3IEUA 4DUZC 4LFBC 4DV7C 1HNWC 2UUCC 2CXCA 2VQEC 4JI4C 2ATWA 3EERA 4GKJC 3J7AD 1FJGC 1WF3A 2UXDC 5LMNC 5IT9D 3J81D 2EGTA 1J5EC 1ZB8A 1I94C 1L2FA 4LF6C 3LUSA 3JAMD 4DCSA 1KKGA 4LF8C 1XMOC 1N36C 4NXNC 4DR4C 2UU9C 4LF4C 1ZB9A 2BJOA 2OPLA 1K0RA 4BSZA 1XNQC 1JOSA 4DUYC 4YY3C 4B3SC 4X65C 1QWIA 2YCBA 4DR5C 2KZFA 3T1YC 4YHHC 4B3TC 4DV2C 1HR0C 1MKYA 2HHHC 4DV1C 2ASBA 4JI2C 4DR6C 2PT7G 4JV5C 4B3RC 4JI3C 2VQFC 3AF5A 4KHPC 1N2FA 5IWAC 4DCUA 4OX9C 3IEVA 1WH9A 1IBMC 2D7VA 4LF9C 4JI6C 3GKUA 2UUAC 2QL8A 1HH2P 1PA4A 1IBLC 1NYEA 1USPB 1LQLA 4DCVA 5FLXD 4X64C 3J80D 1USPA 1HNZC 4DR3C 5BR8C 2DYJA 4JI5C 4NOZA 3CJEA 2XR1A 2UXBC 2E8FA 4MTNA 4DV5C 4X62C 3T1HC 2E5LC 2E8EA 4XX2A 1UKKA 4DR1C 4LFCC 3I07A 1XNRC 4X66C 5LMUC 2OPLB 4DV3C 2PN2A 4LF7C 1N32C 4MH4A 2ONFA 2UUBC 5A2QD 1VLAA 4NXMC 4LFAC 1IBKC 4DCTA 4DV4C 4DV0C 4JI8C 4JI7C 2E8CA 3AF6A 2F4VC 4JYAC 3OTOC 1N34C
chains in the Genus database with same CATH superfamily
5BUSA 4LF5C 2QVZX 5T8SA 2ZM6C 4PUIA 2CY1A 2HJGA 3H2TA 2M5HA 2JMPA 1XMQC 4K0KC 4GKKC 3TR3A 4ZLPA 4DV7C 2CXCA 2VQEC 3DAYA 4JI4C 3EERA 4GKJC 3J7AD 2UXDC 5LMNC 5CZVA 1L2FA 1MDBA 3DHVA 2Z51A 4DCSA 2D1QA 4IZ6A 3A4IA 2P2FA 1RG9A 5DV9A 4LF4C 3K6RA 1JOSA 3LAXA 4DUYC 4RVNA 2M5OA 1IB8A 2P2QA 3LNVA 3VNQA 3E7WA 2Y27A 2KZFA 4YHHC 4B3TC 1HR0C 1MKYA 4DV1C 4JI2C 3PESA 2PT7G 4I9FA 4PHTA 3CQ3A 2KDNA 4KHPC 2WP0C 2P02A 1WH9A 2D1SA 4PUGA 3GKUA 2QL8A 1TH5A 2ZTBA 1USPB 4X64C 1XRAA 2Y4NA 3J80D 4BC7A 4PROC 4OXIA 5BR8C 1O93A 5A19A 1ULTA 1P4EA 1O92A 2PG1E 5BSTA 4D4GA 2P2BA 3CW9A 4XX2A 1UKKA 4LFCC 4G1IA 4X66C 2OPLB 3IMLA 2AYAA 4D4IA 2UUBC 1VLAA 2YWCA 4DV0C 4JI7C 4ISBA 4GXRA 4AQYC 4G36A 3CQ1A 1ML8A 4D57A 4JI1C 2WD9A 3PROC 4DV6C 4DR2C 1MDFA 1RY2A 3VNRA 4LFBC 2UUCC 1MXBA 2ATWA 4R1MA 1FJGC 1WF3A 2D27A 1PU1A 5KYTA 4OYCA 3JAMD 4L4QA 3N2QA 4LF8C 5JRHA 4DR4C 1ZB9A 2BJOA 1VEHA 2NCLA 2PROA 2QVXX 2YCBA 3O2EA 3GPCA 1P4EC 2ZZNA 1LCIA 2ASBA 3E7XA 4BCAA 3NI2A 4JI3C 2VQFC 1MXCA 3UX2A 4WS9A 5IWAC 4L7IA 4U5YD 3NYQA 4OX9C 4BBYA 4R0MA 2D7VA 2MMAB 4GS5A 3GR0A 2UUAC 1LQLA 4DCVA 2YX1A 4RM2A 1USPA 5T8TA 3ETCA 4KTVA 5AE3A 2QW0X 2XR1A 2E8FA 4EATA 4DV5C 4FTFA 5AE2A 2E8EA 2YWBA 2JNVA 3RV2A 1XNRC 1YGTA 4G37A 2PN2A 2V7BA 2ONFA 4IR7A 5A2QD 3TUFA 1XS3A 4NXMC 4JM1A 5BUQA 3A26A 1QM4A 1HNXC 4JI0C 1EGAA 2DPLA 3A9VA 3B7WA 3FCEA 3R9XA 4D56A 5A1GA 4KTTA 5K85A 4RLQA 4ZJZA 2D1RA 3J81D 3PBKA 2E0GA 1I94C 1GPMA 3GR1A 4LF6C 3NYRA 2VZEA 2VSQA 2KZ0A 1N36C 4NXNC 1UWDA 3L95X 2UU9C 4HPVA 4BSZA 4B3SC 4L2ZA 4DG8A 4X65C 1NY8A 4I9GA 3T1YC 2Y4OA 2D1TA 2HHHC 4DR6C 4JV5C 4B3RC 2P20A 5KYVA 4TPSB 2QVYX 5BSMA 3IPLA 4LE5A 3EQ6A 1IBMC 3I08A 5A1IA 1MD9A 3G7SA 5BSUA 3TDEA 4JI6C 1NYEA 3TQIA 1MXAA 4DG9A 4DR3C 1HNZC 3S82A 4JI5C 4RMNA 1M6XA 3DLPX 2UXBC 4MTNA 4PUHA 3T1HC 4RVOA 1M6XC 4NDNA 1BA3A 5AE1A 1T5HX 1V60A 1O90A 3VNSA 4DV3C 1V26A 5GTDA 4MH4A 1XRBA 2CU6A 4R1LA 2BH1X 5BSRA 4LFAC 2MCQA 5KEIA 4DCTA 3OTOC 1N34C 4BC9A 3N54B 2E7GA 3RG2A 4B3MC 5K8FA 4DR7C 2P2MA 2D28C 1N33C 5E7QA 3C5EA 2UXCC 3R9WA 1PG3A 3IEUA 4DUZC 1HNWC 2ZZMA 4PZPA 3FCCA 5IT9D 3ETOA 2EGTA 1J5EC 1ZB8A 1WCJA 3LUSA 5LCIA 3SO4A 3CW8X 1KKGA 1XMOC 3KXWA 4RM3A 5BURA 3LGXA 2OPLA 1K0RA 1XHJA 1XRCA 3A9UA 1XNQC 4YY3C 2MM9A 5BSWA 1V25A 1QWIA 3UEBA 1XDXA 3LNOA 5BSVA 2DHMA 4DR5C 4ODJA 4DV2C 1YJ7A 4RLFA 1PG4A 2OO4A 5ADZA 3AF5A 3CQ2A 4WV3A 5CZXA 4FUTA 3A25A 1N2FA 2OBVA 4DCUA 5H9UA 3IEVA 3UOWA 1O9TA 3AY0A 3R44A 4LF9C 3UX3A 1FUGA 1HH2P 1PA4A 1IBLC 5FLXD 3FM7A 1P7LA 5IFIA 2DYJA 4NOZA 1T5DX 3CJEA 4GXQA 3L8CA 4X62C 1FLOA 4K0BA 3NPDA 2E5LC 1AMUA 4DR1C 3UZ0A 3I07A 5LMUC 2P2JA 4LF7C 1N32C 4FUQA 1IBKC 4DV4C 4JI8C 2E8CA 3AF6A 2F4VC 4JYAC
chains in the Genus database with same CATH topology
5BUSA 4LF5C 2QVZX 5T8SA 2ZM6C 2CY1A 2HJGA 3H2TA 2JMPA 1XMQC 4K0KC 4GKKC 4ZLPA 4DV7C 2CXCA 2VQEC 3DAYA 4JI4C 3EERA 4GKJC 3J7AD 2UXDC 5LMNC 5CZVA 1L2FA 1MDBA 3DHVA 4DCSA 2D1QA 4IZ6A 3A4IA 2P2FA 1RG9A 5DV9A 4LF4C 1JOSA 3LAXA 4DUYC 4RVNA 2P2QA 3LNVA 3VNQA 3E7WA 2Y27A 2KZFA 4YHHC 4B3TC 1HR0C 1MKYA 4DV1C 4JI2C 3PESA 2PT7G 4I9FA 4PHTA 4KHPC 2WP0C 2P02A 1WH9A 2D1SA 3GKUA 2QL8A 1USPB 4X64C 1XRAA 2Y4NA 3J80D 4BC7A 4PROC 4OXIA 5BR8C 1O93A 5A19A 1ULTA 1O92A 5BSTA 4D4GA 2P2BA 3CW9A 4XX2A 1UKKA 4LFCC 4G1IA 4X66C 2OPLB 3IMLA 2AYAA 4D4IA 2UUBC 1VLAA 2YWCA 4DV0C 4JI7C 4ISBA 4GXRA 4AQYC 4G36A 1ML8A 4D57A 4JI1C 2WD9A 3PROC 4DV6C 4DR2C 1MDFA 1RY2A 3VNRA 4LFBC 2UUCC 1MXBA 2ATWA 4R1MA 1FJGC 1WF3A 2D27A 5KYTA 4OYCA 3JAMD 4L4QA 3N2QA 4LF8C 5JRHA 4DR4C 1ZB9A 2BJOA 2PROA 2QVXX 2YCBA 3GPCA 1LCIA 2ASBA 3E7XA 4BCAA 3NI2A 4JI3C 2VQFC 1MXCA 4WS9A 5IWAC 4L7IA 4U5YD 3NYQA 4OX9C 4BBYA 4R0MA 2D7VA 4GS5A 3GR0A 2UUAC 1LQLA 4DCVA 4RM2A 1USPA 5T8TA 3ETCA 4KTVA 5AE3A 2QW0X 2XR1A 2E8FA 4EATA 4DV5C 4FTFA 5AE2A 2E8EA 2YWBA 3RV2A 1XNRC 4G37A 2PN2A 2V7BA 2ONFA 4IR7A 5A2QD 3TUFA 4NXMC 4JM1A 5BUQA 1QM4A 1HNXC 4JI0C 1EGAA 2DPLA 3A9VA 3B7WA 3FCEA 3R9XA 4D56A 5A1GA 4KTTA 5K85A 4RLQA 4ZJZA 2D1RA 3J81D 3PBKA 2E0GA 1I94C 1GPMA 3GR1A 4LF6C 3NYRA 2VZEA 2VSQA 1N36C 4NXNC 3L95X 2UU9C 4HPVA 4BSZA 4B3SC 4L2ZA 4DG8A 4X65C 4I9GA 3T1YC 2Y4OA 2D1TA 2HHHC 4DR6C 4JV5C 4B3RC 2P20A 5KYVA 4TPSB 2QVYX 5BSMA 3IPLA 4LE5A 3EQ6A 1IBMC 3I08A 5A1IA 1MD9A 3G7SA 5BSUA 3TDEA 4JI6C 1NYEA 3TQIA 1MXAA 4DG9A 4DR3C 1HNZC 3S82A 4JI5C 4RMNA 3DLPX 2UXBC 4MTNA 3T1HC 4RVOA 4NDNA 1BA3A 5AE1A 1T5HX 1O90A 3VNSA 4DV3C 1V26A 5GTDA 4MH4A 1XRBA 4R1LA 2BH1X 5BSRA 4LFAC 5KEIA 4DCTA 3OTOC 1N34C 4BC9A 3N54B 2E7GA 3RG2A 4B3MC 5K8FA 4DR7C 2P2MA 2D28C 1N33C 5E7QA 3C5EA 2UXCC 3R9WA 1PG3A 3IEUA 4DUZC 1HNWC 4PZPA 3FCCA 5IT9D 3ETOA 2EGTA 1J5EC 1ZB8A 3LUSA 3SO4A 3CW8X 1KKGA 1XMOC 3KXWA 4RM3A 5BURA 3LGXA 2OPLA 1K0RA 3A9UA 1XRCA 1XNQC 4YY3C 5BSWA 1V25A 1QWIA 5BSVA 4DR5C 4ODJA 4DV2C 1YJ7A 4RLFA 1PG4A 2OO4A 5ADZA 3AF5A 4WV3A 5CZXA 4FUTA 1N2FA 2OBVA 4DCUA 5H9UA 3IEVA 3UOWA 1O9TA 3R44A 4LF9C 1FUGA 1HH2P 1PA4A 1IBLC 5FLXD 1P7LA 5IFIA 2DYJA 4NOZA 1T5DX 3CJEA 4GXQA 3L8CA 4X62C 4K0BA 3NPDA 2E5LC 1AMUA 4DR1C 3UZ0A 3I07A 5LMUC 2P2JA 4LF7C 1N32C 4FUQA 1IBKC 4DV4C 4JI8C 2E8CA 3AF6A 2F4VC 4JYAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY C;  1HNX C;  4JI0 C;  4LF5 C;  2E7G A;  1EGA A;  2ZM6 C;  4B3M C;  1ML8 A;  4JI1 C;  4DR7 C;  4DV6 C;  4DR2 C;  2CY1 A;  2HJG A;  2JMP A;  3R9X A;  1XMQ C;  1N33 C;  4K0K C;  2UXC C;  3R9W A;  4GKK C;  3IEU A;  4DUZ C;  4LFB C;  4DV7 C;  1HNW C;  2UUC C;  2CXC A;  2VQE C;  4JI4 C;  2ATW A;  3EER A;  4GKJ C;  3J7A D;  1FJG C;  1WF3 A;  2UXD C;  5LMN C;  5IT9 D;  3J81 D;  2EGT A;  1J5E C;  1ZB8 A;  1I94 C;  1L2F A;  4LF6 C;  3LUS A;  3JAM D;  4DCS A;  1KKG A;  4LF8 C;  1XMO C;  1N36 C;  4NXN C;  4DR4 C;  2UU9 C;  4LF4 C;  1ZB9 A;  2BJO A;  2OPL A;  1K0R A;  4BSZ A;  1XNQ C;  1JOS A;  4DUY C;  4YY3 C;  4B3S C;  4X65 C;  1QWI A;  2YCB A;  4DR5 C;  2KZF A;  3T1Y C;  4YHH C;  4B3T C;  4DV2 C;  1HR0 C;  1MKY A;  2HHH C;  4DV1 C;  2ASB A;  4JI2 C;  4DR6 C;  2PT7 G;  4JV5 C;  4B3R C;  4JI3 C;  2VQF C;  3AF5 A;  4KHP C;  1N2F A;  5IWA C;  4DCU A;  4OX9 C;  3IEV A;  1WH9 A;  1IBM C;  2D7V A;  4LF9 C;  4JI6 C;  3GKU A;  2UUA C;  2QL8 A;  1HH2 P;  1PA4 A;  1IBL C;  1NYE A;  1USP B;  1LQL A;  4DCV A;  5FLX D;  4X64 C;  3J80 D;  1USP A;  1HNZ C;  4DR3 C;  5BR8 C;  2DYJ A;  4JI5 C;  4NOZ A;  3CJE A;  2XR1 A;  2UXB C;  2E8F A;  4MTN A;  4DV5 C;  4X62 C;  3T1H C;  2E5L C;  2E8E A;  4XX2 A;  1UKK A;  4DR1 C;  4LFC C;  3I07 A;  1XNR C;  4X66 C;  5LMU C;  2OPL B;  4DV3 C;  2PN2 A;  4LF7 C;  1N32 C;  4MH4 A;  2ONF A;  2UUB C;  5A2Q D;  1VLA A;  4NXM C;  4LFA C;  1IBK C;  4DCT A;  4DV4 C;  4DV0 C;  4JI8 C;  4JI7 C;  2E8C A;  3AF6 A;  2F4V C;  4JYA C;  3OTO C;  1N34 C; 
#chains in the Genus database with same CATH topology
 5BUS A;  4LF5 C;  2QVZ X;  5T8S A;  2ZM6 C;  4PUI A;  2CY1 A;  2HJG A;  3H2T A;  2M5H A;  2JMP A;  1XMQ C;  4K0K C;  4GKK C;  3TR3 A;  4ZLP A;  4DV7 C;  2CXC A;  2VQE C;  3DAY A;  4JI4 C;  3EER A;  4GKJ C;  3J7A D;  2UXD C;  5LMN C;  5CZV A;  1L2F A;  1MDB A;  3DHV A;  2Z51 A;  4DCS A;  2D1Q A;  4IZ6 A;  3A4I A;  2P2F A;  1RG9 A;  5DV9 A;  4LF4 C;  3K6R A;  1JOS A;  3LAX A;  4DUY C;  4RVN A;  2M5O A;  1IB8 A;  2P2Q A;  3LNV A;  3VNQ A;  3E7W A;  2Y27 A;  2KZF A;  4YHH C;  4B3T C;  1HR0 C;  1MKY A;  4DV1 C;  4JI2 C;  3PES A;  2PT7 G;  4I9F A;  4PHT A;  3CQ3 A;  2KDN A;  4KHP C;  2WP0 C;  2P02 A;  1WH9 A;  2D1S A;  4PUG A;  3GKU A;  2QL8 A;  1TH5 A;  2ZTB A;  1USP B;  4X64 C;  1XRA A;  2Y4N A;  3J80 D;  4BC7 A;  4PRO C;  4OXI A;  5BR8 C;  1O93 A;  5A19 A;  1ULT A;  1P4E A;  1O92 A;  2PG1 E;  5BST A;  4D4G A;  2P2B A;  3CW9 A;  4XX2 A;  1UKK A;  4LFC C;  4G1I A;  4X66 C;  2OPL B;  3IML A;  2AYA A;  4D4I A;  2UUB C;  1VLA A;  2YWC A;  4DV0 C;  4JI7 C;  4ISB A;  4GXR A;  4AQY C;  4G36 A;  3CQ1 A;  1ML8 A;  4D57 A;  4JI1 C;  2WD9 A;  3PRO C;  4DV6 C;  4DR2 C;  1MDF A;  1RY2 A;  3VNR A;  4LFB C;  2UUC C;  1MXB A;  2ATW A;  4R1M A;  1FJG C;  1WF3 A;  2D27 A;  1PU1 A;  5KYT A;  4OYC A;  3JAM D;  4L4Q A;  3N2Q A;  4LF8 C;  5JRH A;  4DR4 C;  1ZB9 A;  2BJO A;  1VEH A;  2NCL A;  2PRO A;  2QVX X;  2YCB A;  3O2E A;  3GPC A;  1P4E C;  2ZZN A;  1LCI A;  2ASB A;  3E7X A;  4BCA A;  3NI2 A;  4JI3 C;  2VQF C;  1MXC A;  3UX2 A;  4WS9 A;  5IWA C;  4L7I A;  4U5Y D;  3NYQ A;  4OX9 C;  4BBY A;  4R0M A;  2D7V A;  2MMA B;  4GS5 A;  3GR0 A;  2UUA C;  1LQL A;  4DCV A;  2YX1 A;  4RM2 A;  1USP A;  5T8T A;  3ETC A;  4KTV A;  5AE3 A;  2QW0 X;  2XR1 A;  2E8F A;  4EAT A;  4DV5 C;  4FTF A;  5AE2 A;  2E8E A;  2YWB A;  2JNV A;  3RV2 A;  1XNR C;  1YGT A;  4G37 A;  2PN2 A;  2V7B A;  2ONF A;  4IR7 A;  5A2Q D;  3TUF A;  1XS3 A;  4NXM C;  4JM1 A;  5BUQ A;  3A26 A;  1QM4 A;  1HNX C;  4JI0 C;  1EGA A;  2DPL A;  3A9V A;  3B7W A;  3FCE A;  3R9X A;  4D56 A;  5A1G A;  4KTT A;  5K85 A;  4RLQ A;  4ZJZ A;  2D1R A;  3J81 D;  3PBK A;  2E0G A;  1I94 C;  1GPM A;  3GR1 A;  4LF6 C;  3NYR A;  2VZE A;  2VSQ A;  2KZ0 A;  1N36 C;  4NXN C;  1UWD A;  3L95 X;  2UU9 C;  4HPV A;  4BSZ A;  4B3S C;  4L2Z A;  4DG8 A;  4X65 C;  1NY8 A;  4I9G A;  3T1Y C;  2Y4O A;  2D1T A;  2HHH C;  4DR6 C;  4JV5 C;  4B3R C;  2P20 A;  5KYV A;  4TPS B;  2QVY X;  5BSM A;  3IPL A;  4LE5 A;  3EQ6 A;  1IBM C;  3I08 A;  5A1I A;  1MD9 A;  3G7S A;  5BSU A;  3TDE A;  4JI6 C;  1NYE A;  3TQI A;  1MXA A;  4DG9 A;  4DR3 C;  1HNZ C;  3S82 A;  4JI5 C;  4RMN A;  1M6X A;  3DLP X;  2UXB C;  4MTN A;  4PUH A;  3T1H C;  4RVO A;  1M6X C;  4NDN A;  1BA3 A;  5AE1 A;  1T5H X;  1V60 A;  1O90 A;  3VNS A;  4DV3 C;  1V26 A;  5GTD A;  4MH4 A;  1XRB A;  2CU6 A;  4R1L A;  2BH1 X;  5BSR A;  4LFA C;  2MCQ A;  5KEI A;  4DCT A;  3OTO C;  1N34 C;  4BC9 A;  3N54 B;  2E7G A;  3RG2 A;  4B3M C;  5K8F A;  4DR7 C;  2P2M A;  2D28 C;  1N33 C;  5E7Q A;  3C5E A;  2UXC C;  3R9W A;  1PG3 A;  3IEU A;  4DUZ C;  1HNW C;  2ZZM A;  4PZP A;  3FCC A;  5IT9 D;  3ETO A;  2EGT A;  1J5E C;  1ZB8 A;  1WCJ A;  3LUS A;  5LCI A;  3SO4 A;  3CW8 X;  1KKG A;  1XMO C;  3KXW A;  4RM3 A;  5BUR A;  3LGX A;  2OPL A;  1K0R A;  1XHJ A;  1XRC A;  3A9U A;  1XNQ C;  4YY3 C;  2MM9 A;  5BSW A;  1V25 A;  1QWI A;  3UEB A;  1XDX A;  3LNO A;  5BSV A;  2DHM A;  4DR5 C;  4ODJ A;  4DV2 C;  1YJ7 A;  4RLF A;  1PG4 A;  2OO4 A;  5ADZ A;  3AF5 A;  3CQ2 A;  4WV3 A;  5CZX A;  4FUT A;  3A25 A;  1N2F A;  2OBV A;  4DCU A;  5H9U A;  3IEV A;  3UOW A;  1O9T A;  3AY0 A;  3R44 A;  4LF9 C;  3UX3 A;  1FUG A;  1HH2 P;  1PA4 A;  1IBL C;  5FLX D;  3FM7 A;  1P7L A;  5IFI A;  2DYJ A;  4NOZ A;  1T5D X;  3CJE A;  4GXQ A;  3L8C A;  4X62 C;  1FLO A;  4K0B A;  3NPD A;  2E5L C;  1AMU A;  4DR1 C;  3UZ0 A;  3I07 A;  5LMU C;  2P2J A;  4LF7 C;  1N32 C;  4FUQ A;  1IBK C;  4DV4 C;  4JI8 C;  2E8C A;  3AF6 A;  2F4V C;  4JYA C; 
#chains in the Genus database with same CATH homology
 5BUS A;  4LF5 C;  2QVZ X;  5T8S A;  2ZM6 C;  2CY1 A;  2HJG A;  3H2T A;  2JMP A;  1XMQ C;  4K0K C;  4GKK C;  4ZLP A;  4DV7 C;  2CXC A;  2VQE C;  3DAY A;  4JI4 C;  3EER A;  4GKJ C;  3J7A D;  2UXD C;  5LMN C;  5CZV A;  1L2F A;  1MDB A;  3DHV A;  4DCS A;  2D1Q A;  4IZ6 A;  3A4I A;  2P2F A;  1RG9 A;  5DV9 A;  4LF4 C;  1JOS A;  3LAX A;  4DUY C;  4RVN A;  2P2Q A;  3LNV A;  3VNQ A;  3E7W A;  2Y27 A;  2KZF A;  4YHH C;  4B3T C;  1HR0 C;  1MKY A;  4DV1 C;  4JI2 C;  3PES A;  2PT7 G;  4I9F A;  4PHT A;  4KHP C;  2WP0 C;  2P02 A;  1WH9 A;  2D1S A;  3GKU A;  2QL8 A;  1USP B;  4X64 C;  1XRA A;  2Y4N A;  3J80 D;  4BC7 A;  4PRO C;  4OXI A;  5BR8 C;  1O93 A;  5A19 A;  1ULT A;  1O92 A;  5BST A;  4D4G A;  2P2B A;  3CW9 A;  4XX2 A;  1UKK A;  4LFC C;  4G1I A;  4X66 C;  2OPL B;  3IML A;  2AYA A;  4D4I A;  2UUB C;  1VLA A;  2YWC A;  4DV0 C;  4JI7 C;  4ISB A;  4GXR A;  4AQY C;  4G36 A;  1ML8 A;  4D57 A;  4JI1 C;  2WD9 A;  3PRO C;  4DV6 C;  4DR2 C;  1MDF A;  1RY2 A;  3VNR A;  4LFB C;  2UUC C;  1MXB A;  2ATW A;  4R1M A;  1FJG C;  1WF3 A;  2D27 A;  5KYT A;  4OYC A;  3JAM D;  4L4Q A;  3N2Q A;  4LF8 C;  5JRH A;  4DR4 C;  1ZB9 A;  2BJO A;  2PRO A;  2QVX X;  2YCB A;  3GPC A;  1LCI A;  2ASB A;  3E7X A;  4BCA A;  3NI2 A;  4JI3 C;  2VQF C;  1MXC A;  4WS9 A;  5IWA C;  4L7I A;  4U5Y D;  3NYQ A;  4OX9 C;  4BBY A;  4R0M A;  2D7V A;  4GS5 A;  3GR0 A;  2UUA C;  1LQL A;  4DCV A;  4RM2 A;  1USP A;  5T8T A;  3ETC A;  4KTV A;  5AE3 A;  2QW0 X;  2XR1 A;  2E8F A;  4EAT A;  4DV5 C;  4FTF A;  5AE2 A;  2E8E A;  2YWB A;  3RV2 A;  1XNR C;  4G37 A;  2PN2 A;  2V7B A;  2ONF A;  4IR7 A;  5A2Q D;  3TUF A;  4NXM C;  4JM1 A;  5BUQ A;  1QM4 A;  1HNX C;  4JI0 C;  1EGA A;  2DPL A;  3A9V A;  3B7W A;  3FCE A;  3R9X A;  4D56 A;  5A1G A;  4KTT A;  5K85 A;  4RLQ A;  4ZJZ A;  2D1R A;  3J81 D;  3PBK A;  2E0G A;  1I94 C;  1GPM A;  3GR1 A;  4LF6 C;  3NYR A;  2VZE A;  2VSQ A;  1N36 C;  4NXN C;  3L95 X;  2UU9 C;  4HPV A;  4BSZ A;  4B3S C;  4L2Z A;  4DG8 A;  4X65 C;  4I9G A;  3T1Y C;  2Y4O A;  2D1T A;  2HHH C;  4DR6 C;  4JV5 C;  4B3R C;  2P20 A;  5KYV A;  4TPS B;  2QVY X;  5BSM A;  3IPL A;  4LE5 A;  3EQ6 A;  1IBM C;  3I08 A;  5A1I A;  1MD9 A;  3G7S A;  5BSU A;  3TDE A;  4JI6 C;  1NYE A;  3TQI A;  1MXA A;  4DG9 A;  4DR3 C;  1HNZ C;  3S82 A;  4JI5 C;  4RMN A;  3DLP X;  2UXB C;  4MTN A;  3T1H C;  4RVO A;  4NDN A;  1BA3 A;  5AE1 A;  1T5H X;  1O90 A;  3VNS A;  4DV3 C;  1V26 A;  5GTD A;  4MH4 A;  1XRB A;  4R1L A;  2BH1 X;  5BSR A;  4LFA C;  5KEI A;  4DCT A;  3OTO C;  1N34 C;  4BC9 A;  3N54 B;  2E7G A;  3RG2 A;  4B3M C;  5K8F A;  4DR7 C;  2P2M A;  2D28 C;  1N33 C;  5E7Q A;  3C5E A;  2UXC C;  3R9W A;  1PG3 A;  3IEU A;  4DUZ C;  1HNW C;  4PZP A;  3FCC A;  5IT9 D;  3ETO A;  2EGT A;  1J5E C;  1ZB8 A;  3LUS A;  3SO4 A;  3CW8 X;  1KKG A;  1XMO C;  3KXW A;  4RM3 A;  5BUR A;  3LGX A;  2OPL A;  1K0R A;  3A9U A;  1XRC A;  1XNQ C;  4YY3 C;  5BSW A;  1V25 A;  1QWI A;  5BSV A;  4DR5 C;  4ODJ A;  4DV2 C;  1YJ7 A;  4RLF A;  1PG4 A;  2OO4 A;  5ADZ A;  3AF5 A;  4WV3 A;  5CZX A;  4FUT A;  1N2F A;  2OBV A;  4DCU A;  5H9U A;  3IEV A;  3UOW A;  1O9T A;  3R44 A;  4LF9 C;  1FUG A;  1HH2 P;  1PA4 A;  1IBL C;  5FLX D;  1P7L A;  5IFI A;  2DYJ A;  4NOZ A;  1T5D X;  3CJE A;  4GXQ A;  3L8C A;  4X62 C;  4K0B A;  3NPD A;  2E5L C;  1AMU A;  4DR1 C;  3UZ0 A;  3I07 A;  5LMU C;  2P2J A;  4LF7 C;  1N32 C;  4FUQ A;  1IBK C;  4DV4 C;  4JI8 C;  2E8C A;  3AF6 A;  2F4V C;  4JYA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...