2UU9C

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uu9C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uu9C02
1I94C 4B3TC 1EGAA 3GKUA 4DV0C 4BSZA 4DV7C 4JI2C 4MTNA 3JAMD 2UUBC 4DUZC 2UU9C 2UXDC 1XNRC 2D7VA 4X62C 1FJGC 1WH9A 4X64C 1N2FA 4LF4C 1HH2P 2JMPA 4DV1C 5IT9D 2EGTA 3R9WA 1ML8A 4LF5C 1KKGA 2HJGA 3IEVA 3R9XA 3LUSA 2BJOA 2ATWA 1PA4A 1XNQC 4JI7C 2HHHC 4DR7C 2CXCA 1USPB 4DR6C 1L2FA 4KHPC 1HR0C 4X65C 2XR1A 4GKJC 2UUCC 2E8FA 4DV2C 4DR1C 2E7GA 1K0RA 5FLXD 4K0KC 4JI0C 2UXCC 2E8CA 5LMUC 1N33C 4B3RC 1J5EC 4JI3C 4DCVA 2DYJA 4DR3C 4B3SC 2OPLA 4DCTA 5BR8C 4LF9C 4DR2C 4DR4C 1JOSA 1USPA 4LFCC 4DCSA 4NXMC 2VQFC 3T1HC 4LF7C 3CJEA 3AF5A 4GKKC 2ONFA 3OTOC 4XX2A 4YY3C 4JI8C 4JI5C 1NYEA 1XMQC 4DCUA 1XMOC 4LFBC 1N32C 1VLAA 4LFAC 3J7AD 1IBLC 4JI6C 3I07A 1HNZC 4JI4C 3J81D 1HNWC 2ASBA 4JV5C 1LQLA 2CY1A 5IWAC 2PT7G 4DV6C 1N36C 1ZB9A 1WF3A 4YHHC 2E5LC 4NOZA 4DUYC 1UKKA 4DV5C 1IBKC 4DV3C 5LMNC 1QWIA 3EERA 1MKYA 4X66C 4LF6C 1IBMC 4NXNC 2F4VC 2YCBA 4LF8C 1N34C 2PN2A 4MH4A 2ZM6C 4B3MC 2E8EA 5A2QD 2QL8A 3J80D 1ZB8A 4AQYC 2KZFA 1HNXC 2UXBC 2VQEC 4DV4C 4DR5C 2UUAC 3T1YC 4OX9C 4JYAC 3AF6A 3IEUA 2OPLB 4JI1C
chains in the Genus database with same CATH superfamily
1T5DX 2WP0C 1YGTA 4DV7C 4DUZC 3R44A 4IR7A 2D1RA 5A1GA 2D7VA 4EATA 1ULTA 1T5HX 4LF4C 2JMPA 1MDBA 2EGTA 4RLFA 3H2TA 5KYTA 3L8CA 1O93A 2BJOA 4JI7C 3PESA 4K0BA 1L2FA 3ETOA 1NY8A 2P2JA 4GKJC 1XRAA 2UUCC 4DR1C 2E7GA 3UEBA 2E8CA 1N33C 4JM1A 1J5EC 5KYVA 2Y4NA 1PG4A 4DR3C 1MXAA 2OO4A 2OPLA 5BR8C 4DR4C 2Z51A 4WV3A 1USPA 4PUGA 1XDXA 4DCSA 4NXMC 3UOWA 3T1HC 4LF7C 1QM4A 3CJEA 1MD9A 2KZ0A 5BSWA 3UX3A 5BUQA 4JI6C 4PROC 1HNZC 4D4GA 2ASBA 2WD9A 4R1LA 5KEIA 4FUQA 1N36C 5K8FA 2MCQA 3I08A 4NOZA 1UKKA 4FTFA 4DV5C 4X66C 2F4VC 2P2MA 4NXNC 2YCBA 2ZM6C 1PU1A 4GS5A 4PZPA 2D1TA 2ZZMA 2VQEC 4DV4C 1V60A 4DR5C 3T1YC 2VZEA 4JYAC 3TR3A 2Y27A 3N2QA 3DLPX 3IEUA 2M5HA 4JI1C 1I94C 4B3TC 4GXQA 2E0GA 3IPLA 4HPVA 3RG2A 3CQ1A 4OYCA 2UXDC 1TH5A 4X64C 5JRHA 3GPCA 1XHJA 3B7WA 3G7SA 1ML8A 1AMUA 1KKGA 3TUFA 3IEVA 3R9XA 4U5YD 3AY0A 1UWDA 2QVYX 4RMNA 2HHHC 1MXCA 1USPB 1FLOA 3LGXA 3EQ6A 4L2ZA 4BCAA 3C5EA 4DV2C 3CW8X 5K85A 4D4IA 1K0RA 3TDEA 1FUGA 4G37A 3K6RA 4JI0C 5LMUC 4B3RC 5LCIA 1GPMA 4DCVA 4GXRA 3NI2A 3A9VA 1WCJA 4LF9C 5BSRA 2D1QA 4GKKC 2ONFA 5BSTA 1O9TA 4PHTA 1XMQC 2D1SA 1VLAA 3I07A 3J81D 3GR0A 5BSVA 4ODJA 4DV6C 4DG8A 3NPDA 1WF3A 4G1IA 1MXBA 3CQ3A 4DUYC 5LMNC 4LE5A 3EERA 1V26A 1MKYA 1IBMC 5T8SA 4MH4A 3FCCA 3DAYA 1O92A 3J80D 2KZFA 4BC7A 2BH1X 3LNVA 1XRCA 4OX9C 3KXWA 3SO4A 1EGAA 4JI2C 4MTNA 2DHMA 2UU9C 1XNRC 4RVOA 1FJGC 1P7LA 1WH9A 4DV1C 2CU6A 2V7BA 5DV9A 3R9WA 4LF5C 1LCIA 3LUSA 2ATWA 2OBVA 1XNQC 2CXCA 2YWCA 4KHPC 1HR0C 2PG1E 4X65C 5AE3A 3VNSA 2P2BA 2P20A 1P4EC 5E7QA 4K0KC 5CZXA 2UXCC 2M5OA 2NCLA 2JNVA 3FM7A 4JI3C 2AYAA 2DYJA 4DCTA 4DR2C 1JOSA 3LAXA 4I9FA 4R1MA 4YY3C 1RG9A 5IFIA 3L95X 3J7AD 3UX2A 1IBLC 1PG3A 3VNRA 3UZ0A 4JI4C 2P02A 1HNWC 3A4IA 4L4QA 4OXIA 2MMAB 1O90A 5GTDA 1VEHA 2KDNA 5T8TA 4RM3A 1LQLA 5IWAC 2PT7G 1ZB9A 4YHHC 2QVXX 4PUHA 1IBKC 4WS9A 4DV3C 3VNQA 4LF6C 4NDNA 4LF8C 2YWBA 2PN2A 1N34C 5AE2A 4KTTA 4B3MC 2E8EA 3NYQA 3RV2A 4AQYC 1ZB8A 5A19A 1HNXC 4ISBA 2MM9A 3PBKA 4G36A 1V25A 2QW0X 5A1IA 2D28C 3AF6A 3E7XA 3FCEA 3GKUA 3DHVA 4DV0C 4TPSB 4BSZA 3A26A 3JAMD 2UUBC 5H9UA 2QVZX 4X62C 1N2FA 1HH2P 1XRBA 5IT9D 4R0MA 1YJ7A 3N54B 2ZZNA 3A9UA 2HJGA 3CQ2A 1PA4A 1P4EA 4DR7C 2Y4OA 4DR6C 3IMLA 4D56A 2XR1A 2E8FA 5FLXD 4FUTA 4BBYA 2YX1A 4D57A 5ADZA 1M6XA 3A25A 1MDFA 1IB8A 4B3SC 2DPLA 3GR1A 4LFCC 4ZJZA 3S82A 2VQFC 2OPLB 3AF5A 4ZLPA 3OTOC 2VSQA 4XX2A 4JI8C 4JI5C 3NYRA 1NYEA 1XMOC 4DCUA 4LFBC 1N32C 2P2FA 4LFAC 2PROA 3CW9A 4JV5C 1BA3A 4RVNA 2CY1A 2UXBC 2E5LC 4DG9A 4L7IA 4KTVA 5BSUA 1QWIA 3PROC 2ZTBA 3O2EA 4IZ6A 1RY2A 1M6XC 5A2QD 3E7WA 2QL8A 5BURA 5CZVA 2P2QA 4RM2A 4PUIA 4BC9A 2D27A 5BUSA 2UUAC 3TQIA 4RLQA 4I9GA 3LNOA 1XS3A 3ETCA 5AE1A 5BSMA
chains in the Genus database with same CATH topology
1T5DX 2WP0C 4DV7C 4DUZC 3R44A 4IR7A 2D1RA 5A1GA 2D7VA 4EATA 1ULTA 1T5HX 4LF4C 2JMPA 1MDBA 2EGTA 4RLFA 3H2TA 5KYTA 3L8CA 1O93A 2BJOA 4JI7C 3PESA 4K0BA 1L2FA 3ETOA 2P2JA 4GKJC 1XRAA 2UUCC 4DR1C 2E7GA 2E8CA 1N33C 4JM1A 1J5EC 5KYVA 2Y4NA 1PG4A 4DR3C 1MXAA 2OO4A 2OPLA 5BR8C 4DR4C 4WV3A 1USPA 4DCSA 4NXMC 3UOWA 3T1HC 4LF7C 1QM4A 3CJEA 1MD9A 5BSWA 5BUQA 4JI6C 4PROC 1HNZC 4D4GA 2ASBA 2WD9A 4R1LA 5KEIA 4FUQA 1N36C 5K8FA 3I08A 4NOZA 1UKKA 4FTFA 4DV5C 4X66C 2F4VC 2P2MA 4NXNC 2YCBA 2ZM6C 4GS5A 4PZPA 2D1TA 2VQEC 4DV4C 4DR5C 3T1YC 2VZEA 4JYAC 2Y27A 3N2QA 3DLPX 3IEUA 4JI1C 1I94C 4B3TC 4GXQA 2E0GA 3IPLA 4HPVA 3RG2A 4OYCA 2UXDC 4X64C 5JRHA 3GPCA 3B7WA 3G7SA 1ML8A 1AMUA 1KKGA 3TUFA 3IEVA 3R9XA 4U5YD 2QVYX 4RMNA 2HHHC 1MXCA 1USPB 3LGXA 3EQ6A 4L2ZA 4BCAA 3C5EA 4DV2C 3CW8X 5K85A 4D4IA 1K0RA 3TDEA 1FUGA 4G37A 4JI0C 5LMUC 4B3RC 1GPMA 4DCVA 4GXRA 3NI2A 3A9VA 4LF9C 5BSRA 2D1QA 4GKKC 2ONFA 5BSTA 1O9TA 4PHTA 1XMQC 2D1SA 1VLAA 3I07A 3J81D 3GR0A 5BSVA 4ODJA 4DV6C 4DG8A 3NPDA 1WF3A 4G1IA 1MXBA 4DUYC 5LMNC 4LE5A 3EERA 1V26A 1MKYA 1IBMC 5T8SA 4MH4A 3FCCA 3DAYA 1O92A 3J80D 2KZFA 4BC7A 2BH1X 3LNVA 1XRCA 4OX9C 3KXWA 3SO4A 1EGAA 4JI2C 4MTNA 2UU9C 1XNRC 4RVOA 1FJGC 1P7LA 1WH9A 4DV1C 2V7BA 5DV9A 3R9WA 4LF5C 1LCIA 3LUSA 2ATWA 2OBVA 1XNQC 2CXCA 2YWCA 4KHPC 1HR0C 4X65C 5AE3A 3VNSA 2P2BA 2P20A 5E7QA 4K0KC 5CZXA 2UXCC 4JI3C 2AYAA 2DYJA 4DCTA 4DR2C 1JOSA 3LAXA 4I9FA 4R1MA 4YY3C 1RG9A 5IFIA 3L95X 3J7AD 1IBLC 1PG3A 3VNRA 3UZ0A 4JI4C 2P02A 1HNWC 3A4IA 4L4QA 4OXIA 1O90A 5GTDA 5T8TA 4RM3A 1LQLA 5IWAC 2PT7G 1ZB9A 4YHHC 2QVXX 1IBKC 4WS9A 4DV3C 3VNQA 4LF6C 4NDNA 4LF8C 2YWBA 2PN2A 1N34C 5AE2A 4KTTA 4B3MC 2E8EA 3NYQA 3RV2A 4AQYC 1ZB8A 5A19A 1HNXC 4ISBA 3PBKA 4G36A 1V25A 2QW0X 5A1IA 2D28C 3AF6A 3E7XA 3FCEA 3GKUA 3DHVA 4DV0C 4TPSB 4BSZA 3JAMD 2UUBC 5H9UA 2QVZX 4X62C 1N2FA 1HH2P 1XRBA 5IT9D 4R0MA 1YJ7A 3N54B 3A9UA 2HJGA 1PA4A 4DR7C 2Y4OA 4DR6C 3IMLA 4D56A 2XR1A 2E8FA 5FLXD 4FUTA 4BBYA 4D57A 5ADZA 1MDFA 4B3SC 2DPLA 3GR1A 4LFCC 4ZJZA 3S82A 2VQFC 2OPLB 3AF5A 4ZLPA 3OTOC 2VSQA 4XX2A 4JI8C 4JI5C 3NYRA 1NYEA 1XMOC 4DCUA 4LFBC 1N32C 2P2FA 4LFAC 2PROA 3CW9A 4JV5C 1BA3A 4RVNA 2CY1A 2UXBC 2E5LC 4L7IA 4DG9A 4KTVA 5BSUA 1QWIA 3PROC 4IZ6A 1RY2A 5A2QD 3E7WA 2QL8A 5BURA 5CZVA 2P2QA 4RM2A 4BC9A 2D27A 5BUSA 2UUAC 3TQIA 4RLQA 4I9GA 3ETCA 5AE1A 5BSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 C;  4B3T C;  1EGA A;  3GKU A;  4DV0 C;  4BSZ A;  4DV7 C;  4JI2 C;  4MTN A;  3JAM D;  2UUB C;  4DUZ C;  2UU9 C;  2UXD C;  1XNR C;  2D7V A;  4X62 C;  1FJG C;  1WH9 A;  4X64 C;  1N2F A;  4LF4 C;  1HH2 P;  2JMP A;  4DV1 C;  5IT9 D;  2EGT A;  3R9W A;  1ML8 A;  4LF5 C;  1KKG A;  2HJG A;  3IEV A;  3R9X A;  3LUS A;  2BJO A;  2ATW A;  1PA4 A;  1XNQ C;  4JI7 C;  2HHH C;  4DR7 C;  2CXC A;  1USP B;  4DR6 C;  1L2F A;  4KHP C;  1HR0 C;  4X65 C;  2XR1 A;  4GKJ C;  2UUC C;  2E8F A;  4DV2 C;  4DR1 C;  2E7G A;  1K0R A;  5FLX D;  4K0K C;  4JI0 C;  2UXC C;  2E8C A;  5LMU C;  1N33 C;  4B3R C;  1J5E C;  4JI3 C;  4DCV A;  2DYJ A;  4DR3 C;  4B3S C;  2OPL A;  4DCT A;  5BR8 C;  4LF9 C;  4DR2 C;  4DR4 C;  1JOS A;  1USP A;  4LFC C;  4DCS A;  4NXM C;  2VQF C;  3T1H C;  4LF7 C;  3CJE A;  3AF5 A;  4GKK C;  2ONF A;  3OTO C;  4XX2 A;  4YY3 C;  4JI8 C;  4JI5 C;  1NYE A;  1XMQ C;  4DCU A;  1XMO C;  4LFB C;  1N32 C;  1VLA A;  4LFA C;  3J7A D;  1IBL C;  4JI6 C;  3I07 A;  1HNZ C;  4JI4 C;  3J81 D;  1HNW C;  2ASB A;  4JV5 C;  1LQL A;  2CY1 A;  5IWA C;  2PT7 G;  4DV6 C;  1N36 C;  1ZB9 A;  1WF3 A;  4YHH C;  2E5L C;  4NOZ A;  4DUY C;  1UKK A;  4DV5 C;  1IBK C;  4DV3 C;  5LMN C;  1QWI A;  3EER A;  1MKY A;  4X66 C;  4LF6 C;  1IBM C;  4NXN C;  2F4V C;  2YCB A;  4LF8 C;  1N34 C;  2PN2 A;  4MH4 A;  2ZM6 C;  4B3M C;  2E8E A;  5A2Q D;  2QL8 A;  3J80 D;  1ZB8 A;  4AQY C;  2KZF A;  1HNX C;  2UXB C;  2VQE C;  4DV4 C;  4DR5 C;  2UUA C;  3T1Y C;  4OX9 C;  4JYA C;  3AF6 A;  3IEU A;  2OPL B;  4JI1 C; 
#chains in the Genus database with same CATH topology
 1T5D X;  2WP0 C;  1YGT A;  4DV7 C;  4DUZ C;  3R44 A;  4IR7 A;  2D1R A;  5A1G A;  2D7V A;  4EAT A;  1ULT A;  1T5H X;  4LF4 C;  2JMP A;  1MDB A;  2EGT A;  4RLF A;  3H2T A;  5KYT A;  3L8C A;  1O93 A;  2BJO A;  4JI7 C;  3PES A;  4K0B A;  1L2F A;  3ETO A;  1NY8 A;  2P2J A;  4GKJ C;  1XRA A;  2UUC C;  4DR1 C;  2E7G A;  3UEB A;  2E8C A;  1N33 C;  4JM1 A;  1J5E C;  5KYV A;  2Y4N A;  1PG4 A;  4DR3 C;  1MXA A;  2OO4 A;  2OPL A;  5BR8 C;  4DR4 C;  2Z51 A;  4WV3 A;  1USP A;  4PUG A;  1XDX A;  4DCS A;  4NXM C;  3UOW A;  3T1H C;  4LF7 C;  1QM4 A;  3CJE A;  1MD9 A;  2KZ0 A;  5BSW A;  3UX3 A;  5BUQ A;  4JI6 C;  4PRO C;  1HNZ C;  4D4G A;  2ASB A;  2WD9 A;  4R1L A;  5KEI A;  4FUQ A;  1N36 C;  5K8F A;  2MCQ A;  3I08 A;  4NOZ A;  1UKK A;  4FTF A;  4DV5 C;  4X66 C;  2F4V C;  2P2M A;  4NXN C;  2YCB A;  2ZM6 C;  1PU1 A;  4GS5 A;  4PZP A;  2D1T A;  2ZZM A;  2VQE C;  4DV4 C;  1V60 A;  4DR5 C;  3T1Y C;  2VZE A;  4JYA C;  3TR3 A;  2Y27 A;  3N2Q A;  3DLP X;  3IEU A;  2M5H A;  4JI1 C;  1I94 C;  4B3T C;  4GXQ A;  2E0G A;  3IPL A;  4HPV A;  3RG2 A;  3CQ1 A;  4OYC A;  2UXD C;  1TH5 A;  4X64 C;  5JRH A;  3GPC A;  1XHJ A;  3B7W A;  3G7S A;  1ML8 A;  1AMU A;  1KKG A;  3TUF A;  3IEV A;  3R9X A;  4U5Y D;  3AY0 A;  1UWD A;  2QVY X;  4RMN A;  2HHH C;  1MXC A;  1USP B;  1FLO A;  3LGX A;  3EQ6 A;  4L2Z A;  4BCA A;  3C5E A;  4DV2 C;  3CW8 X;  5K85 A;  4D4I A;  1K0R A;  3TDE A;  1FUG A;  4G37 A;  3K6R A;  4JI0 C;  5LMU C;  4B3R C;  5LCI A;  1GPM A;  4DCV A;  4GXR A;  3NI2 A;  3A9V A;  1WCJ A;  4LF9 C;  5BSR A;  2D1Q A;  4GKK C;  2ONF A;  5BST A;  1O9T A;  4PHT A;  1XMQ C;  2D1S A;  1VLA A;  3I07 A;  3J81 D;  3GR0 A;  5BSV A;  4ODJ A;  4DV6 C;  4DG8 A;  3NPD A;  1WF3 A;  4G1I A;  1MXB A;  3CQ3 A;  4DUY C;  5LMN C;  4LE5 A;  3EER A;  1V26 A;  1MKY A;  1IBM C;  5T8S A;  4MH4 A;  3FCC A;  3DAY A;  1O92 A;  3J80 D;  2KZF A;  4BC7 A;  2BH1 X;  3LNV A;  1XRC A;  4OX9 C;  3KXW A;  3SO4 A;  1EGA A;  4JI2 C;  4MTN A;  2DHM A;  2UU9 C;  1XNR C;  4RVO A;  1FJG C;  1P7L A;  1WH9 A;  4DV1 C;  2CU6 A;  2V7B A;  5DV9 A;  3R9W A;  4LF5 C;  1LCI A;  3LUS A;  2ATW A;  2OBV A;  1XNQ C;  2CXC A;  2YWC A;  4KHP C;  1HR0 C;  2PG1 E;  4X65 C;  5AE3 A;  3VNS A;  2P2B A;  2P20 A;  1P4E C;  5E7Q A;  4K0K C;  5CZX A;  2UXC C;  2M5O A;  2NCL A;  2JNV A;  3FM7 A;  4JI3 C;  2AYA A;  2DYJ A;  4DCT A;  4DR2 C;  1JOS A;  3LAX A;  4I9F A;  4R1M A;  4YY3 C;  1RG9 A;  5IFI A;  3L95 X;  3J7A D;  3UX2 A;  1IBL C;  1PG3 A;  3VNR A;  3UZ0 A;  4JI4 C;  2P02 A;  1HNW C;  3A4I A;  4L4Q A;  4OXI A;  2MMA B;  1O90 A;  5GTD A;  1VEH A;  2KDN A;  5T8T A;  4RM3 A;  1LQL A;  5IWA C;  2PT7 G;  1ZB9 A;  4YHH C;  2QVX X;  4PUH A;  1IBK C;  4WS9 A;  4DV3 C;  3VNQ A;  4LF6 C;  4NDN A;  4LF8 C;  2YWB A;  2PN2 A;  1N34 C;  5AE2 A;  4KTT A;  4B3M C;  2E8E A;  3NYQ A;  3RV2 A;  4AQY C;  1ZB8 A;  5A19 A;  1HNX C;  4ISB A;  2MM9 A;  3PBK A;  4G36 A;  1V25 A;  2QW0 X;  5A1I A;  2D28 C;  3AF6 A;  3E7X A;  3FCE A;  3GKU A;  3DHV A;  4DV0 C;  4TPS B;  4BSZ A;  3A26 A;  3JAM D;  2UUB C;  5H9U A;  2QVZ X;  4X62 C;  1N2F A;  1HH2 P;  1XRB A;  5IT9 D;  4R0M A;  1YJ7 A;  3N54 B;  2ZZN A;  3A9U A;  2HJG A;  3CQ2 A;  1PA4 A;  1P4E A;  4DR7 C;  2Y4O A;  4DR6 C;  3IML A;  4D56 A;  2XR1 A;  2E8F A;  5FLX D;  4FUT A;  4BBY A;  2YX1 A;  4D57 A;  5ADZ A;  1M6X A;  3A25 A;  1MDF A;  1IB8 A;  4B3S C;  2DPL A;  3GR1 A;  4LFC C;  4ZJZ A;  3S82 A;  2VQF C;  2OPL B;  3AF5 A;  4ZLP A;  3OTO C;  2VSQ A;  4XX2 A;  4JI8 C;  4JI5 C;  3NYR A;  1NYE A;  1XMO C;  4DCU A;  4LFB C;  1N32 C;  2P2F A;  4LFA C;  2PRO A;  3CW9 A;  4JV5 C;  1BA3 A;  4RVN A;  2CY1 A;  2UXB C;  2E5L C;  4DG9 A;  4L7I A;  4KTV A;  5BSU A;  1QWI A;  3PRO C;  2ZTB A;  3O2E A;  4IZ6 A;  1RY2 A;  1M6X C;  5A2Q D;  3E7W A;  2QL8 A;  5BUR A;  5CZV A;  2P2Q A;  4RM2 A;  4PUI A;  4BC9 A;  2D27 A;  5BUS A;  2UUA C;  3TQI A;  4RLQ A;  4I9G A;  3LNO A;  1XS3 A;  3ETC A;  5AE1 A;  5BSM A; 
#chains in the Genus database with same CATH homology
 1T5D X;  2WP0 C;  4DV7 C;  4DUZ C;  3R44 A;  4IR7 A;  2D1R A;  5A1G A;  2D7V A;  4EAT A;  1ULT A;  1T5H X;  4LF4 C;  2JMP A;  1MDB A;  2EGT A;  4RLF A;  3H2T A;  5KYT A;  3L8C A;  1O93 A;  2BJO A;  4JI7 C;  3PES A;  4K0B A;  1L2F A;  3ETO A;  2P2J A;  4GKJ C;  1XRA A;  2UUC C;  4DR1 C;  2E7G A;  2E8C A;  1N33 C;  4JM1 A;  1J5E C;  5KYV A;  2Y4N A;  1PG4 A;  4DR3 C;  1MXA A;  2OO4 A;  2OPL A;  5BR8 C;  4DR4 C;  4WV3 A;  1USP A;  4DCS A;  4NXM C;  3UOW A;  3T1H C;  4LF7 C;  1QM4 A;  3CJE A;  1MD9 A;  5BSW A;  5BUQ A;  4JI6 C;  4PRO C;  1HNZ C;  4D4G A;  2ASB A;  2WD9 A;  4R1L A;  5KEI A;  4FUQ A;  1N36 C;  5K8F A;  3I08 A;  4NOZ A;  1UKK A;  4FTF A;  4DV5 C;  4X66 C;  2F4V C;  2P2M A;  4NXN C;  2YCB A;  2ZM6 C;  4GS5 A;  4PZP A;  2D1T A;  2VQE C;  4DV4 C;  4DR5 C;  3T1Y C;  2VZE A;  4JYA C;  2Y27 A;  3N2Q A;  3DLP X;  3IEU A;  4JI1 C;  1I94 C;  4B3T C;  4GXQ A;  2E0G A;  3IPL A;  4HPV A;  3RG2 A;  4OYC A;  2UXD C;  4X64 C;  5JRH A;  3GPC A;  3B7W A;  3G7S A;  1ML8 A;  1AMU A;  1KKG A;  3TUF A;  3IEV A;  3R9X A;  4U5Y D;  2QVY X;  4RMN A;  2HHH C;  1MXC A;  1USP B;  3LGX A;  3EQ6 A;  4L2Z A;  4BCA A;  3C5E A;  4DV2 C;  3CW8 X;  5K85 A;  4D4I A;  1K0R A;  3TDE A;  1FUG A;  4G37 A;  4JI0 C;  5LMU C;  4B3R C;  1GPM A;  4DCV A;  4GXR A;  3NI2 A;  3A9V A;  4LF9 C;  5BSR A;  2D1Q A;  4GKK C;  2ONF A;  5BST A;  1O9T A;  4PHT A;  1XMQ C;  2D1S A;  1VLA A;  3I07 A;  3J81 D;  3GR0 A;  5BSV A;  4ODJ A;  4DV6 C;  4DG8 A;  3NPD A;  1WF3 A;  4G1I A;  1MXB A;  4DUY C;  5LMN C;  4LE5 A;  3EER A;  1V26 A;  1MKY A;  1IBM C;  5T8S A;  4MH4 A;  3FCC A;  3DAY A;  1O92 A;  3J80 D;  2KZF A;  4BC7 A;  2BH1 X;  3LNV A;  1XRC A;  4OX9 C;  3KXW A;  3SO4 A;  1EGA A;  4JI2 C;  4MTN A;  2UU9 C;  1XNR C;  4RVO A;  1FJG C;  1P7L A;  1WH9 A;  4DV1 C;  2V7B A;  5DV9 A;  3R9W A;  4LF5 C;  1LCI A;  3LUS A;  2ATW A;  2OBV A;  1XNQ C;  2CXC A;  2YWC A;  4KHP C;  1HR0 C;  4X65 C;  5AE3 A;  3VNS A;  2P2B A;  2P20 A;  5E7Q A;  4K0K C;  5CZX A;  2UXC C;  4JI3 C;  2AYA A;  2DYJ A;  4DCT A;  4DR2 C;  1JOS A;  3LAX A;  4I9F A;  4R1M A;  4YY3 C;  1RG9 A;  5IFI A;  3L95 X;  3J7A D;  1IBL C;  1PG3 A;  3VNR A;  3UZ0 A;  4JI4 C;  2P02 A;  1HNW C;  3A4I A;  4L4Q A;  4OXI A;  1O90 A;  5GTD A;  5T8T A;  4RM3 A;  1LQL A;  5IWA C;  2PT7 G;  1ZB9 A;  4YHH C;  2QVX X;  1IBK C;  4WS9 A;  4DV3 C;  3VNQ A;  4LF6 C;  4NDN A;  4LF8 C;  2YWB A;  2PN2 A;  1N34 C;  5AE2 A;  4KTT A;  4B3M C;  2E8E A;  3NYQ A;  3RV2 A;  4AQY C;  1ZB8 A;  5A19 A;  1HNX C;  4ISB A;  3PBK A;  4G36 A;  1V25 A;  2QW0 X;  5A1I A;  2D28 C;  3AF6 A;  3E7X A;  3FCE A;  3GKU A;  3DHV A;  4DV0 C;  4TPS B;  4BSZ A;  3JAM D;  2UUB C;  5H9U A;  2QVZ X;  4X62 C;  1N2F A;  1HH2 P;  1XRB A;  5IT9 D;  4R0M A;  1YJ7 A;  3N54 B;  3A9U A;  2HJG A;  1PA4 A;  4DR7 C;  2Y4O A;  4DR6 C;  3IML A;  4D56 A;  2XR1 A;  2E8F A;  5FLX D;  4FUT A;  4BBY A;  4D57 A;  5ADZ A;  1MDF A;  4B3S C;  2DPL A;  3GR1 A;  4LFC C;  4ZJZ A;  3S82 A;  2VQF C;  2OPL B;  3AF5 A;  4ZLP A;  3OTO C;  2VSQ A;  4XX2 A;  4JI8 C;  4JI5 C;  3NYR A;  1NYE A;  1XMO C;  4DCU A;  4LFB C;  1N32 C;  2P2F A;  4LFA C;  2PRO A;  3CW9 A;  4JV5 C;  1BA3 A;  4RVN A;  2CY1 A;  2UXB C;  2E5L C;  4L7I A;  4DG9 A;  4KTV A;  5BSU A;  1QWI A;  3PRO C;  4IZ6 A;  1RY2 A;  5A2Q D;  3E7W A;  2QL8 A;  5BUR A;  5CZV A;  2P2Q A;  4RM2 A;  4BC9 A;  2D27 A;  5BUS A;  2UUA C;  3TQI A;  4RLQ A;  4I9G A;  3ETC A;  5AE1 A;  5BSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...