2UU9C

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uu9C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uu9C02
4MTNA 4XX2A 3J7AD 4B3TC 1XNRC 2JMPA 4DR5C 4DV0C 3J80D 1IBKC 4X65C 3T1YC 1IBLC 4NXMC 2UXBC 4LF6C 1L2FA 4LFAC 1QWIA 4LF7C 2YCBA 4DR7C 1MKYA 4LF4C 1HNWC 1KKGA 1LQLA 1USPA 5LMUC 4JI4C 2HJGA 1USPB 1XMOC 4X64C 5FLXD 3R9XA 3AF5A 4DUYC 4B3SC 5A2QD 4JV5C 4JI3C 4DCTA 1UKKA 3IEVA 1ZB8A 4DV1C 4DR1C 4JI6C 2UU9C 1IBMC 1HR0C 1JOSA 1ZB9A 2ZM6C 4JYAC 3T1HC 3J81D 2E7GA 1N34C 3CJEA 4X66C 1HNZC 4B3MC 2XR1A 5IT9D 4KHPC 5IWAC 2UUCC 1K0RA 4YHHC 1HH2P 2UXDC 4LF5C 3IEUA 4GKJC 4JI8C 3EERA 2OPLA 3I07A 4JI1C 4MH4A 2OPLB 1XMQC 2ASBA 2EGTA 1N2FA 4NOZA 2KZFA 2PT7G 4JI2C 4DR2C 2D7VA 4NXNC 4K0KC 2CXCA 2VQEC 2F4VC 3LUSA 2PN2A 4OX9C 3GKUA 4DV5C 2E8FA 5LMNC 4DR3C 1PA4A 1N33C 1FJGC 2DYJA 2QL8A 1N36C 3JAMD 4DV2C 4DCSA 4GKKC 5BR8C 4DUZC 4DR6C 3R9WA 2BJOA 2E5LC 1EGAA 4DCUA 2E8EA 4DCVA 4B3RC 4DV7C 1XNQC 2UUAC 1NYEA 2E8CA 4DV4C 2CY1A 1I94C 2UUBC 4LFBC 1VLAA 4X62C 3AF6A 4LFCC 4JI0C 1ML8A 4DR4C 4AQYC 2HHHC 2VQFC 4LF8C 4BSZA 4JI7C 1WF3A 4DV3C 3OTOC 4LF9C 2ATWA 1WH9A 2UXCC 1HNXC 4DV6C 4YY3C 2ONFA 1N32C 1J5EC 4JI5C
chains in the Genus database with same CATH superfamily
4XX2A 5AE2A 4B3TC 2P2FA 1IB8A 3ETCA 2D1TA 3A9UA 4D4IA 5LCIA 1O93A 2Y4OA 1O90A 2D28C 4DR7C 1MKYA 2P2QA 1KKGA 1USPA 4JI4C 1GPMA 2MM9A 3C5EA 3NI2A 4RLFA 5BSTA 1MD9A 4DR1C 5BSWA 3FM7A 1IBMC 1HR0C 3A9VA 3LGXA 2ZM6C 1N34C 3NYQA 2OBVA 4B3MC 2XR1A 1P4EC 1MXAA 3GR1A 4JI1C 4MH4A 2JNVA 1N2FA 1FLOA 5AE1A 4GS5A 3IPLA 4D4GA 2VQEC 1T5HX 5E7QA 4D57A 2PN2A 2E8FA 2D27A 1N33C 1YJ7A 3PESA 4DV7C 4ODJA 4HPVA 4K0BA 2E8CA 4NDNA 4DV4C 2UUBC 4ZJZA 2VQFC 3GPCA 4IR7A 5K85A 3PROC 2UXCC 4WV3A 4DV6C 2ONFA 4I9FA 1BA3A 2JMPA 4WS9A 4DV0C 1IBKC 3T1YC 1MXCA 4LF6C 4RLQA 2Z51A 4ZLPA 4IZ6A 4DG9A 4R1MA 3DAYA 2PROA 1USPB 1XMOC 5A1IA 5FLXD 3AF5A 4DUYC 2VSQA 4JI3C 1UKKA 4PZPA 4L7IA 2NCLA 4DV1C 4GXRA 5KYTA 1TH5A 5BUSA 4OXIA 4OYCA 4JYAC 3T1HC 2QVYX 2E7GA 1XHJA 4X66C 5T8SA 4PUIA 4KHPC 2UUCC 3RG2A 3N2QA 4YHHC 2QW0X 5A19A 3FCCA 4GKJC 3EERA 2OPLA 2EGTA 2DHMA 4JI2C 4NXNC 4L2ZA 4K0KC 2YX1A 2P20A 5ADZA 4TPSB 3GKUA 5BUQA 4RM2A 2P2JA 1ULTA 3KXWA 2DYJA 2QL8A 1T5DX 3JAMD 3L8CA 1RY2A 3G7SA 4PUHA 4DUZC 5CZXA 3UX2A 1V60A 4D56A 2PG1E 4B3RC 4PUGA 1WCJA 2VZEA 4R1LA 2UUAC 5IFIA 2KDNA 3E7XA 2ZTBA 2DPLA 1VLAA 2QVXX 4X62C 3AF6A 5BURA 1O9TA 4BC9A 3UX3A 1MDFA 4DR4C 2P2BA 2HHHC 4RVOA 3CW8X 1XRCA 2KZ0A 4RMNA 4JI7C 4BC7A 4DG8A 1WH9A 5A1GA 4G1IA 4JI5C 4MTNA 3J80D 1QM4A 4NXMC 2P2MA 1L2FA 3LAXA 1QWIA 4JM1A 4KTTA 4LF7C 3AY0A 4LF4C 1HNWC 5LMUC 2HJGA 3H2TA 5KEIA 3L95X 3O2EA 2D1QA 4B3SC 5A2QD 1RG9A 3IEVA 5BSUA 1XS3A 3PBKA 5BSVA 2UU9C 1O92A 1ZB9A 1YGTA 2D1RA 5K8FA 3UEBA 2E0GA 3CJEA 3EQ6A 5IT9D 2AYAA 5IWAC 3VNRA 5GTDA 1PU1A 3A25A 2UXDC 4LF5C 3B7WA 2OPLB 4G37A 1XMQC 2Y27A 3GR0A 2KZFA 2PT7G 2WP0C 2M5OA 3A4IA 2WD9A 1MDBA 2CXCA 4GXQA 3LUSA 4PHTA 5LMNC 4BCAA 3ETOA 3CQ3A 4KTVA 4FUTA 4GKKC 5JRHA 2BJOA 1EGAA 4RM3A 3N54B 3E7WA 2Y4NA 2E8EA 5H9UA 3SO4A 4U5YD 3TUFA 1NYEA 2CU6A 4G36A 1I94C 3TR3A 2QVZX 3CQ1A 4AQYC 1M6XA 3UOWA 4LF8C 1WF3A 4DV3C 4PROC 3OTOC 3CQ2A 4EATA 4YY3C 1N32C 1J5EC 3J7AD 1XNRC 4DR5C 4X65C 1IBLC 2UXBC 2M5HA 3K6RA 5AE3A 4LFAC 4L4QA 2YCBA 1XRAA 2D1SA 1LQLA 3A26A 3R44A 1UWDA 4X64C 2V7BA 4R0MA 1PG4A 3R9XA 4JV5C 3LNVA 1VEHA 1NY8A 2YWCA 5CZVA 4DCTA 3FCEA 3TDEA 1ZB8A 2ZZNA 3DLPX 4I9GA 4JI6C 1JOSA 2P02A 3J81D 4LE5A 3IMLA 5T8TA 1LCIA 3VNQA 2YWBA 1HNZC 1AMUA 1V26A 4BBYA 1K0RA 1HH2P 3IEUA 4JI8C 3UZ0A 3I07A 1M6XC 2ASBA 4FUQA 4NOZA 4DR2C 2D7VA 3CW9A 5DV9A 3NPDA 2F4VC 4FTFA 4OX9C 4DV5C 4DR3C 2ZZMA 1PA4A 5BSMA 5BSRA 1FJGC 1N36C 1V25A 4DV2C 4DCSA 5BR8C 1MXBA 4DR6C 2BH1X 2E5LC 3R9WA 3NYRA 1P7LA 3LNOA 1XDXA 4DCUA 3RV2A 4DCVA 2OO4A 1XRBA 5KYVA 1XNQC 1FUGA 4RVNA 2CY1A 4LFBC 1PG3A 1P4EA 3S82A 4LFCC 2MCQA 4JI0C 2MMAB 1ML8A 3TQIA 3VNSA 4BSZA 4ISBA 4LF9C 2ATWA 1HNXC 3DHVA 3I08A
chains in the Genus database with same CATH topology
4XX2A 5AE2A 4B3TC 2P2FA 3ETCA 2D1TA 3A9UA 4D4IA 1O93A 2Y4OA 1O90A 2D28C 4DR7C 1MKYA 2P2QA 1KKGA 1USPA 4JI4C 1GPMA 3C5EA 3NI2A 4RLFA 5BSTA 1MD9A 4DR1C 5BSWA 1IBMC 1HR0C 3A9VA 3LGXA 2ZM6C 1N34C 3NYQA 2OBVA 4B3MC 2XR1A 1MXAA 3GR1A 4JI1C 4MH4A 1N2FA 5AE1A 4GS5A 3IPLA 4D4GA 2VQEC 1T5HX 5E7QA 4D57A 2PN2A 2E8FA 2D27A 1N33C 1YJ7A 3PESA 4DV7C 4ODJA 4HPVA 4K0BA 2E8CA 4NDNA 4DV4C 2UUBC 4ZJZA 2VQFC 3GPCA 4IR7A 5K85A 3PROC 2UXCC 4WV3A 4DV6C 2ONFA 4I9FA 1BA3A 2JMPA 4WS9A 4DV0C 1IBKC 3T1YC 1MXCA 4LF6C 4RLQA 4ZLPA 4IZ6A 4DG9A 4R1MA 3DAYA 2PROA 1USPB 1XMOC 5A1IA 5FLXD 3AF5A 4DUYC 2VSQA 4JI3C 1UKKA 4PZPA 4L7IA 4DV1C 4GXRA 5KYTA 5BUSA 4OXIA 4OYCA 4JYAC 3T1HC 2QVYX 2E7GA 4X66C 5T8SA 4KHPC 2UUCC 3RG2A 3N2QA 4YHHC 2QW0X 5A19A 3FCCA 4GKJC 3EERA 2OPLA 2EGTA 4JI2C 4NXNC 4L2ZA 4K0KC 2P20A 5ADZA 4TPSB 3GKUA 5BUQA 4RM2A 2P2JA 1ULTA 3KXWA 2DYJA 2QL8A 1T5DX 3JAMD 3L8CA 1RY2A 3G7SA 4DUZC 5CZXA 4D56A 4B3RC 2VZEA 4R1LA 2UUAC 5IFIA 3E7XA 2DPLA 1VLAA 2QVXX 4X62C 3AF6A 5BURA 1O9TA 4BC9A 1MDFA 4DR4C 2P2BA 2HHHC 4RVOA 3CW8X 1XRCA 4JI7C 4RMNA 4BC7A 4DG8A 1WH9A 5A1GA 4G1IA 4JI5C 4MTNA 3J80D 1QM4A 4NXMC 2P2MA 1L2FA 3LAXA 1QWIA 4JM1A 4KTTA 4LF7C 4LF4C 1HNWC 5LMUC 2HJGA 3H2TA 5KEIA 3L95X 2D1QA 4B3SC 5A2QD 1RG9A 3IEVA 5BSUA 3PBKA 5BSVA 2UU9C 1O92A 1ZB9A 2D1RA 5K8FA 2E0GA 3CJEA 3EQ6A 5IT9D 2AYAA 5IWAC 3VNRA 5GTDA 2UXDC 4LF5C 3B7WA 2OPLB 4G37A 1XMQC 2Y27A 3GR0A 2KZFA 2PT7G 2WP0C 3A4IA 2WD9A 1MDBA 2CXCA 4GXQA 3LUSA 4PHTA 5LMNC 4BCAA 3ETOA 4KTVA 4FUTA 4GKKC 5JRHA 2BJOA 1EGAA 4RM3A 3N54B 3E7WA 2Y4NA 2E8EA 5H9UA 3SO4A 4U5YD 3TUFA 1NYEA 4G36A 1I94C 2QVZX 4AQYC 3UOWA 4LF8C 1WF3A 4DV3C 4PROC 3OTOC 4EATA 4YY3C 1N32C 1J5EC 3J7AD 1XNRC 4DR5C 4X65C 1IBLC 2UXBC 5AE3A 4LFAC 4L4QA 2YCBA 1XRAA 2D1SA 1LQLA 3R44A 4X64C 2V7BA 4R0MA 1PG4A 3R9XA 4JV5C 3LNVA 2YWCA 5CZVA 4DCTA 3FCEA 3TDEA 1ZB8A 3DLPX 4I9GA 4JI6C 1JOSA 2P02A 3J81D 4LE5A 3IMLA 5T8TA 1LCIA 3VNQA 2YWBA 1HNZC 1AMUA 1V26A 4BBYA 1K0RA 1HH2P 3IEUA 4JI8C 3UZ0A 3I07A 2ASBA 4FUQA 4NOZA 4DR2C 2D7VA 3CW9A 5DV9A 3NPDA 2F4VC 4FTFA 4OX9C 4DV5C 4DR3C 1PA4A 5BSMA 5BSRA 1FJGC 1N36C 1V25A 4DV2C 4DCSA 5BR8C 1MXBA 4DR6C 2BH1X 2E5LC 3R9WA 3NYRA 1P7LA 4DCUA 3RV2A 4DCVA 2OO4A 1XRBA 5KYVA 1XNQC 1FUGA 4RVNA 2CY1A 4LFBC 1PG3A 3S82A 4LFCC 4JI0C 3VNSA 1ML8A 3TQIA 4BSZA 4ISBA 4LF9C 2ATWA 1HNXC 3DHVA 3I08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MTN A;  4XX2 A;  3J7A D;  4B3T C;  1XNR C;  2JMP A;  4DR5 C;  4DV0 C;  3J80 D;  1IBK C;  4X65 C;  3T1Y C;  1IBL C;  4NXM C;  2UXB C;  4LF6 C;  1L2F A;  4LFA C;  1QWI A;  4LF7 C;  2YCB A;  4DR7 C;  1MKY A;  4LF4 C;  1HNW C;  1KKG A;  1LQL A;  1USP A;  5LMU C;  4JI4 C;  2HJG A;  1USP B;  1XMO C;  4X64 C;  5FLX D;  3R9X A;  3AF5 A;  4DUY C;  4B3S C;  5A2Q D;  4JV5 C;  4JI3 C;  4DCT A;  1UKK A;  3IEV A;  1ZB8 A;  4DV1 C;  4DR1 C;  4JI6 C;  2UU9 C;  1IBM C;  1HR0 C;  1JOS A;  1ZB9 A;  2ZM6 C;  4JYA C;  3T1H C;  3J81 D;  2E7G A;  1N34 C;  3CJE A;  4X66 C;  1HNZ C;  4B3M C;  2XR1 A;  5IT9 D;  4KHP C;  5IWA C;  2UUC C;  1K0R A;  4YHH C;  1HH2 P;  2UXD C;  4LF5 C;  3IEU A;  4GKJ C;  4JI8 C;  3EER A;  2OPL A;  3I07 A;  4JI1 C;  4MH4 A;  2OPL B;  1XMQ C;  2ASB A;  2EGT A;  1N2F A;  4NOZ A;  2KZF A;  2PT7 G;  4JI2 C;  4DR2 C;  2D7V A;  4NXN C;  4K0K C;  2CXC A;  2VQE C;  2F4V C;  3LUS A;  2PN2 A;  4OX9 C;  3GKU A;  4DV5 C;  2E8F A;  5LMN C;  4DR3 C;  1PA4 A;  1N33 C;  1FJG C;  2DYJ A;  2QL8 A;  1N36 C;  3JAM D;  4DV2 C;  4DCS A;  4GKK C;  5BR8 C;  4DUZ C;  4DR6 C;  3R9W A;  2BJO A;  2E5L C;  1EGA A;  4DCU A;  2E8E A;  4DCV A;  4B3R C;  4DV7 C;  1XNQ C;  2UUA C;  1NYE A;  2E8C A;  4DV4 C;  2CY1 A;  1I94 C;  2UUB C;  4LFB C;  1VLA A;  4X62 C;  3AF6 A;  4LFC C;  4JI0 C;  1ML8 A;  4DR4 C;  4AQY C;  2HHH C;  2VQF C;  4LF8 C;  4BSZ A;  4JI7 C;  1WF3 A;  4DV3 C;  3OTO C;  4LF9 C;  2ATW A;  1WH9 A;  2UXC C;  1HNX C;  4DV6 C;  4YY3 C;  2ONF A;  1N32 C;  1J5E C;  4JI5 C; 
#chains in the Genus database with same CATH topology
 4XX2 A;  5AE2 A;  4B3T C;  2P2F A;  1IB8 A;  3ETC A;  2D1T A;  3A9U A;  4D4I A;  5LCI A;  1O93 A;  2Y4O A;  1O90 A;  2D28 C;  4DR7 C;  1MKY A;  2P2Q A;  1KKG A;  1USP A;  4JI4 C;  1GPM A;  2MM9 A;  3C5E A;  3NI2 A;  4RLF A;  5BST A;  1MD9 A;  4DR1 C;  5BSW A;  3FM7 A;  1IBM C;  1HR0 C;  3A9V A;  3LGX A;  2ZM6 C;  1N34 C;  3NYQ A;  2OBV A;  4B3M C;  2XR1 A;  1P4E C;  1MXA A;  3GR1 A;  4JI1 C;  4MH4 A;  2JNV A;  1N2F A;  1FLO A;  5AE1 A;  4GS5 A;  3IPL A;  4D4G A;  2VQE C;  1T5H X;  5E7Q A;  4D57 A;  2PN2 A;  2E8F A;  2D27 A;  1N33 C;  1YJ7 A;  3PES A;  4DV7 C;  4ODJ A;  4HPV A;  4K0B A;  2E8C A;  4NDN A;  4DV4 C;  2UUB C;  4ZJZ A;  2VQF C;  3GPC A;  4IR7 A;  5K85 A;  3PRO C;  2UXC C;  4WV3 A;  4DV6 C;  2ONF A;  4I9F A;  1BA3 A;  2JMP A;  4WS9 A;  4DV0 C;  1IBK C;  3T1Y C;  1MXC A;  4LF6 C;  4RLQ A;  2Z51 A;  4ZLP A;  4IZ6 A;  4DG9 A;  4R1M A;  3DAY A;  2PRO A;  1USP B;  1XMO C;  5A1I A;  5FLX D;  3AF5 A;  4DUY C;  2VSQ A;  4JI3 C;  1UKK A;  4PZP A;  4L7I A;  2NCL A;  4DV1 C;  4GXR A;  5KYT A;  1TH5 A;  5BUS A;  4OXI A;  4OYC A;  4JYA C;  3T1H C;  2QVY X;  2E7G A;  1XHJ A;  4X66 C;  5T8S A;  4PUI A;  4KHP C;  2UUC C;  3RG2 A;  3N2Q A;  4YHH C;  2QW0 X;  5A19 A;  3FCC A;  4GKJ C;  3EER A;  2OPL A;  2EGT A;  2DHM A;  4JI2 C;  4NXN C;  4L2Z A;  4K0K C;  2YX1 A;  2P20 A;  5ADZ A;  4TPS B;  3GKU A;  5BUQ A;  4RM2 A;  2P2J A;  1ULT A;  3KXW A;  2DYJ A;  2QL8 A;  1T5D X;  3JAM D;  3L8C A;  1RY2 A;  3G7S A;  4PUH A;  4DUZ C;  5CZX A;  3UX2 A;  1V60 A;  4D56 A;  2PG1 E;  4B3R C;  4PUG A;  1WCJ A;  2VZE A;  4R1L A;  2UUA C;  5IFI A;  2KDN A;  3E7X A;  2ZTB A;  2DPL A;  1VLA A;  2QVX X;  4X62 C;  3AF6 A;  5BUR A;  1O9T A;  4BC9 A;  3UX3 A;  1MDF A;  4DR4 C;  2P2B A;  2HHH C;  4RVO A;  3CW8 X;  1XRC A;  2KZ0 A;  4RMN A;  4JI7 C;  4BC7 A;  4DG8 A;  1WH9 A;  5A1G A;  4G1I A;  4JI5 C;  4MTN A;  3J80 D;  1QM4 A;  4NXM C;  2P2M A;  1L2F A;  3LAX A;  1QWI A;  4JM1 A;  4KTT A;  4LF7 C;  3AY0 A;  4LF4 C;  1HNW C;  5LMU C;  2HJG A;  3H2T A;  5KEI A;  3L95 X;  3O2E A;  2D1Q A;  4B3S C;  5A2Q D;  1RG9 A;  3IEV A;  5BSU A;  1XS3 A;  3PBK A;  5BSV A;  2UU9 C;  1O92 A;  1ZB9 A;  1YGT A;  2D1R A;  5K8F A;  3UEB A;  2E0G A;  3CJE A;  3EQ6 A;  5IT9 D;  2AYA A;  5IWA C;  3VNR A;  5GTD A;  1PU1 A;  3A25 A;  2UXD C;  4LF5 C;  3B7W A;  2OPL B;  4G37 A;  1XMQ C;  2Y27 A;  3GR0 A;  2KZF A;  2PT7 G;  2WP0 C;  2M5O A;  3A4I A;  2WD9 A;  1MDB A;  2CXC A;  4GXQ A;  3LUS A;  4PHT A;  5LMN C;  4BCA A;  3ETO A;  3CQ3 A;  4KTV A;  4FUT A;  4GKK C;  5JRH A;  2BJO A;  1EGA A;  4RM3 A;  3N54 B;  3E7W A;  2Y4N A;  2E8E A;  5H9U A;  3SO4 A;  4U5Y D;  3TUF A;  1NYE A;  2CU6 A;  4G36 A;  1I94 C;  3TR3 A;  2QVZ X;  3CQ1 A;  4AQY C;  1M6X A;  3UOW A;  4LF8 C;  1WF3 A;  4DV3 C;  4PRO C;  3OTO C;  3CQ2 A;  4EAT A;  4YY3 C;  1N32 C;  1J5E C;  3J7A D;  1XNR C;  4DR5 C;  4X65 C;  1IBL C;  2UXB C;  2M5H A;  3K6R A;  5AE3 A;  4LFA C;  4L4Q A;  2YCB A;  1XRA A;  2D1S A;  1LQL A;  3A26 A;  3R44 A;  1UWD A;  4X64 C;  2V7B A;  4R0M A;  1PG4 A;  3R9X A;  4JV5 C;  3LNV A;  1VEH A;  1NY8 A;  2YWC A;  5CZV A;  4DCT A;  3FCE A;  3TDE A;  1ZB8 A;  2ZZN A;  3DLP X;  4I9G A;  4JI6 C;  1JOS A;  2P02 A;  3J81 D;  4LE5 A;  3IML A;  5T8T A;  1LCI A;  3VNQ A;  2YWB A;  1HNZ C;  1AMU A;  1V26 A;  4BBY A;  1K0R A;  1HH2 P;  3IEU A;  4JI8 C;  3UZ0 A;  3I07 A;  1M6X C;  2ASB A;  4FUQ A;  4NOZ A;  4DR2 C;  2D7V A;  3CW9 A;  5DV9 A;  3NPD A;  2F4V C;  4FTF A;  4OX9 C;  4DV5 C;  4DR3 C;  2ZZM A;  1PA4 A;  5BSM A;  5BSR A;  1FJG C;  1N36 C;  1V25 A;  4DV2 C;  4DCS A;  5BR8 C;  1MXB A;  4DR6 C;  2BH1 X;  2E5L C;  3R9W A;  3NYR A;  1P7L A;  3LNO A;  1XDX A;  4DCU A;  3RV2 A;  4DCV A;  2OO4 A;  1XRB A;  5KYV A;  1XNQ C;  1FUG A;  4RVN A;  2CY1 A;  4LFB C;  1PG3 A;  1P4E A;  3S82 A;  4LFC C;  2MCQ A;  4JI0 C;  2MMA B;  1ML8 A;  3TQI A;  3VNS A;  4BSZ A;  4ISB A;  4LF9 C;  2ATW A;  1HNX C;  3DHV A;  3I08 A; 
#chains in the Genus database with same CATH homology
 4XX2 A;  5AE2 A;  4B3T C;  2P2F A;  3ETC A;  2D1T A;  3A9U A;  4D4I A;  1O93 A;  2Y4O A;  1O90 A;  2D28 C;  4DR7 C;  1MKY A;  2P2Q A;  1KKG A;  1USP A;  4JI4 C;  1GPM A;  3C5E A;  3NI2 A;  4RLF A;  5BST A;  1MD9 A;  4DR1 C;  5BSW A;  1IBM C;  1HR0 C;  3A9V A;  3LGX A;  2ZM6 C;  1N34 C;  3NYQ A;  2OBV A;  4B3M C;  2XR1 A;  1MXA A;  3GR1 A;  4JI1 C;  4MH4 A;  1N2F A;  5AE1 A;  4GS5 A;  3IPL A;  4D4G A;  2VQE C;  1T5H X;  5E7Q A;  4D57 A;  2PN2 A;  2E8F A;  2D27 A;  1N33 C;  1YJ7 A;  3PES A;  4DV7 C;  4ODJ A;  4HPV A;  4K0B A;  2E8C A;  4NDN A;  4DV4 C;  2UUB C;  4ZJZ A;  2VQF C;  3GPC A;  4IR7 A;  5K85 A;  3PRO C;  2UXC C;  4WV3 A;  4DV6 C;  2ONF A;  4I9F A;  1BA3 A;  2JMP A;  4WS9 A;  4DV0 C;  1IBK C;  3T1Y C;  1MXC A;  4LF6 C;  4RLQ A;  4ZLP A;  4IZ6 A;  4DG9 A;  4R1M A;  3DAY A;  2PRO A;  1USP B;  1XMO C;  5A1I A;  5FLX D;  3AF5 A;  4DUY C;  2VSQ A;  4JI3 C;  1UKK A;  4PZP A;  4L7I A;  4DV1 C;  4GXR A;  5KYT A;  5BUS A;  4OXI A;  4OYC A;  4JYA C;  3T1H C;  2QVY X;  2E7G A;  4X66 C;  5T8S A;  4KHP C;  2UUC C;  3RG2 A;  3N2Q A;  4YHH C;  2QW0 X;  5A19 A;  3FCC A;  4GKJ C;  3EER A;  2OPL A;  2EGT A;  4JI2 C;  4NXN C;  4L2Z A;  4K0K C;  2P20 A;  5ADZ A;  4TPS B;  3GKU A;  5BUQ A;  4RM2 A;  2P2J A;  1ULT A;  3KXW A;  2DYJ A;  2QL8 A;  1T5D X;  3JAM D;  3L8C A;  1RY2 A;  3G7S A;  4DUZ C;  5CZX A;  4D56 A;  4B3R C;  2VZE A;  4R1L A;  2UUA C;  5IFI A;  3E7X A;  2DPL A;  1VLA A;  2QVX X;  4X62 C;  3AF6 A;  5BUR A;  1O9T A;  4BC9 A;  1MDF A;  4DR4 C;  2P2B A;  2HHH C;  4RVO A;  3CW8 X;  1XRC A;  4JI7 C;  4RMN A;  4BC7 A;  4DG8 A;  1WH9 A;  5A1G A;  4G1I A;  4JI5 C;  4MTN A;  3J80 D;  1QM4 A;  4NXM C;  2P2M A;  1L2F A;  3LAX A;  1QWI A;  4JM1 A;  4KTT A;  4LF7 C;  4LF4 C;  1HNW C;  5LMU C;  2HJG A;  3H2T A;  5KEI A;  3L95 X;  2D1Q A;  4B3S C;  5A2Q D;  1RG9 A;  3IEV A;  5BSU A;  3PBK A;  5BSV A;  2UU9 C;  1O92 A;  1ZB9 A;  2D1R A;  5K8F A;  2E0G A;  3CJE A;  3EQ6 A;  5IT9 D;  2AYA A;  5IWA C;  3VNR A;  5GTD A;  2UXD C;  4LF5 C;  3B7W A;  2OPL B;  4G37 A;  1XMQ C;  2Y27 A;  3GR0 A;  2KZF A;  2PT7 G;  2WP0 C;  3A4I A;  2WD9 A;  1MDB A;  2CXC A;  4GXQ A;  3LUS A;  4PHT A;  5LMN C;  4BCA A;  3ETO A;  4KTV A;  4FUT A;  4GKK C;  5JRH A;  2BJO A;  1EGA A;  4RM3 A;  3N54 B;  3E7W A;  2Y4N A;  2E8E A;  5H9U A;  3SO4 A;  4U5Y D;  3TUF A;  1NYE A;  4G36 A;  1I94 C;  2QVZ X;  4AQY C;  3UOW A;  4LF8 C;  1WF3 A;  4DV3 C;  4PRO C;  3OTO C;  4EAT A;  4YY3 C;  1N32 C;  1J5E C;  3J7A D;  1XNR C;  4DR5 C;  4X65 C;  1IBL C;  2UXB C;  5AE3 A;  4LFA C;  4L4Q A;  2YCB A;  1XRA A;  2D1S A;  1LQL A;  3R44 A;  4X64 C;  2V7B A;  4R0M A;  1PG4 A;  3R9X A;  4JV5 C;  3LNV A;  2YWC A;  5CZV A;  4DCT A;  3FCE A;  3TDE A;  1ZB8 A;  3DLP X;  4I9G A;  4JI6 C;  1JOS A;  2P02 A;  3J81 D;  4LE5 A;  3IML A;  5T8T A;  1LCI A;  3VNQ A;  2YWB A;  1HNZ C;  1AMU A;  1V26 A;  4BBY A;  1K0R A;  1HH2 P;  3IEU A;  4JI8 C;  3UZ0 A;  3I07 A;  2ASB A;  4FUQ A;  4NOZ A;  4DR2 C;  2D7V A;  3CW9 A;  5DV9 A;  3NPD A;  2F4V C;  4FTF A;  4OX9 C;  4DV5 C;  4DR3 C;  1PA4 A;  5BSM A;  5BSR A;  1FJG C;  1N36 C;  1V25 A;  4DV2 C;  4DCS A;  5BR8 C;  1MXB A;  4DR6 C;  2BH1 X;  2E5L C;  3R9W A;  3NYR A;  1P7L A;  4DCU A;  3RV2 A;  4DCV A;  2OO4 A;  1XRB A;  5KYV A;  1XNQ C;  1FUG A;  4RVN A;  2CY1 A;  4LFB C;  1PG3 A;  3S82 A;  4LFC C;  4JI0 C;  3VNS A;  1ML8 A;  3TQI A;  4BSZ A;  4ISB A;  4LF9 C;  2ATW A;  1HNX C;  3DHV A;  3I08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...