2UU9C

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uu9C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uu9C02
4JI2C 2JMPA 2OPLA 1EGAA 4X64C 3J80D 3JAMD 1XNQC 4DCUA 4JV5C 1QWIA 1J5EC 4JYAC 2BJOA 3IEUA 4JI0C 3IEVA 2EGTA 4DCSA 4DV7C 1N32C 4JI7C 4DR5C 2F4VC 1HNWC 2DYJA 4NXNC 4LF8C 2ATWA 4JI1C 2PN2A 4X65C 4DV2C 4DUYC 3EERA 4DV5C 4DR4C 4LFAC 2YCBA 4BSZA 4DR2C 2XR1A 4DV4C 4B3MC 4JI5C 1LQLA 2ONFA 3AF6A 4DR3C 3CJEA 3T1YC 1L2FA 5A2QD 4AQYC 5IT9D 4K0KC 4DUZC 2UUAC 3I07A 1HH2P 2VQFC 4DR1C 4B3SC 1WF3A 4KHPC 4JI8C 2QL8A 4LFBC 2OPLB 2CXCA 2E8CA 4DR7C 2UXDC 4GKKC 2HHHC 1USPB 4DV0C 1HR0C 1I94C 1N2FA 2E8FA 5IWAC 1ML8A 1NYEA 1ZB9A 1XNRC 3OTOC 1VLAA 2D7VA 4MH4A 4YY3C 4NXMC 2VQEC 1XMQC 4LF5C 1IBKC 3R9XA 1MKYA 1N34C 2PT7G 4DV1C 2E7GA 4X62C 3T1HC 2UU9C 2UUBC 4JI3C 4OX9C 2UXCC 3AF5A 2UXBC 3J7AD 5BR8C 1WH9A 1ZB8A 1N36C 3GKUA 4NOZA 4JI6C 4LF7C 1HNZC 1HNXC 2KZFA 4DCTA 4GKJC 5LMNC 4DCVA 2HJGA 1FJGC 1KKGA 1UKKA 5LMUC 1N33C 4JI4C 2UUCC 1JOSA 1K0RA 2ZM6C 2E5LC 4XX2A 3LUSA 3R9WA 2ASBA 4LF4C 1PA4A 4LF6C 4DR6C 1IBMC 4YHHC 1IBLC 4LFCC 4X66C 5FLXD 3J81D 2E8EA 4DV3C 4B3RC 2CY1A 1XMOC 4B3TC 4DV6C 4LF9C 1USPA 4MTNA
chains in the Genus database with same CATH superfamily
3KXWA 2JMPA 4ISBA 5H9UA 3JAMD 3J80D 1XNQC 3K6RA 1QWIA 3IEUA 4JI0C 3IEVA 1FLOA 1FUGA 4DV7C 5CZVA 1O9TA 1N32C 4DR5C 1HNWC 2DYJA 1MXAA 3GR1A 4I9FA 4JI1C 2ATWA 4DR4C 1XHJA 4LFAC 3L95X 3G7SA 4DV4C 4I9GA 3AF6A 1XS3A 4TPSB 3I07A 2VSQA 2KDNA 5KEIA 1WF3A 2QL8A 2P2QA 2CXCA 4DR7C 4GKKC 4BCAA 2P20A 1ML8A 1NYEA 2D27A 1XNRC 2CU6A 1VLAA 2D7VA 1LCIA 2YWBA 4LF5C 3CW8X 3ETOA 1IBKC 3R9XA 4G37A 2PT7G 2E7GA 4PZPA 5K85A 2UXCC 1T5DX 1O92A 3DLPX 3J7AD 3NYRA 5BSMA 2D1RA 4HPVA 4LF7C 3FCEA 4G36A 4RM2A 4DCTA 4GKJC 4RLFA 4PUGA 5T8TA 4DCVA 2OBVA 5AE2A 1UKKA 5LMUC 1N33C 3L8CA 4FUTA 2ZM6C 2E5LC 2DHMA 2VZEA 4XX2A 3IPLA 2PG1E 5LCIA 1PA4A 4ZLPA 4DR6C 1V60A 4X66C 5BSRA 4DV3C 4B3TC 4DV6C 1P4EA 5BSTA 4KTVA 5DV9A 1XRBA 2OPLA 1MDBA 4JYAC 1M6XA 4RMNA 3DAYA 2Y4OA 2F4VC 2Y4NA 4LF8C 2PN2A 4DV2C 5BSVA 3EERA 4DG9A 1P7LA 4ODJA 4L2ZA 5KYTA 2ONFA 2NCLA 3UX3A 4DR3C 3CJEA 4BBYA 3T1YC 1L2FA 4GS5A 4RVOA 4D56A 3TDEA 2P2BA 3GR0A 5E7QA 3A25A 5BURA 2E8CA 4RM3A 1USPB 4K0BA 2D1TA 1N2FA 4GXRA 4ZJZA 4PUIA 4R0MA 3A4IA 1WCJA 2MMAB 1PU1A 2D1QA 1N34C 4L4QA 5K8FA 4DV1C 2UU9C 4JI3C 4OX9C 2BH1X 5BR8C 3CQ1A 1O90A 1N36C 4JI6C 1YGTA 4D4IA 1O93A 1AMUA 1QM4A 4IR7A 1FJGC 4JI4C 3AY0A 4FTFA 1JOSA 1K0RA 5CZXA 3LGXA 3O2EA 3R9WA 4LF4C 4LF6C 2D28C 4LFCC 3DHVA 5FLXD 5AE1A 1USPA 2JNVA 3A9UA 3B7WA 4X64C 1EGAA 3RV2A 4DCUA 3PBKA 2BJOA 4D57A 2EGTA 3E7WA 3UZ0A 4DCSA 5A19A 1XDXA 4JI7C 2P2MA 2DPLA 2M5OA 4JM1A 2KZ0A 1UWDA 4X65C 4DUYC 4DR2C 2YCBA 1MXCA 4D4GA 1PG3A 3NI2A 5JRHA 3PESA 2QVZX 1MDFA 4AQYC 2UUAC 3IMLA 4WS9A 2QW0X 4B3SC 4KHPC 4G1IA 4JI8C 3UEBA 3CW9A 2OPLB 2D1SA 2QVYX 2HHHC 4DV0C 4BC9A 2E8FA 1BA3A 5IWAC 5GTDA 5A1GA 4YY3C 4NXMC 3NPDA 1XMQC 3UOWA 1MD9A 5T8SA 2YWCA 3S82A 1P4EC 3T1HC 3N2QA 4IZ6A 3GKUA 1VEHA 1XRCA 2KZFA 1T5HX 3R44A 2MCQA 3EQ6A 3I08A 3LNVA 5LMNC 3VNSA 2E0GA 4KTTA 2UUCC 4LE5A 4PHTA 4RVNA 2ASBA 1IB8A 4L7IA 2P02A 1ULTA 4FUQA 1GPMA 4YHHC 4R1MA 1IBLC 3J81D 2E8EA 1XMOC 4LF9C 4MTNA 5AE3A 5BUQA 4JI2C 2ZTBA 4JV5C 1J5EC 1V26A 3FM7A 3A26A 2AYAA 5BSWA 3C5EA 2P2FA 2ZZMA 2Y27A 2PROA 4NXNC 4DV5C 4BC7A 4BSZA 2Z51A 2XR1A 4B3MC 1YJ7A 4JI5C 1LQLA 2ZZNA 1MXBA 3ETCA 5A2QD 5IT9D 4K0KC 4DUZC 4NDNA 2YX1A 1HH2P 2VQFC 4DR1C 3A9VA 4LFBC 3RG2A 3UX2A 3NYQA 1M6XC 4RLQA 2UXDC 1HR0C 4EATA 1I94C 3TQIA 3LAXA 2WP0C 3VNQA 4OXIA 3H2TA 1ZB9A 3OTOC 1XRAA 3E7XA 4MH4A 2VQEC 4OYCA 4U5YD 1MKYA 2M5HA 3CQ2A 1RG9A 4X62C 2UUBC 5KYVA 1PG4A 5BUSA 3AF5A 2V7BA 2UXBC 3N54B 1WH9A 1ZB8A 4GXQA 4NOZA 3GPCA 3PROC 3FCCA 1HNZC 1HNXC 4PROC 1RY2A 1TH5A 2HJGA 3CQ3A 1KKGA 4R1LA 2WD9A 5A1IA 4WV3A 3LNOA 3LUSA 4DG8A 3TUFA 5BSUA 2P2JA 3VNRA 5IFIA 1IBMC 3TR3A 1NY8A 2QVXX 2OO4A 4B3RC 1V25A 2CY1A 4PUHA 5ADZA 3SO4A 2MM9A
chains in the Genus database with same CATH topology
3KXWA 2JMPA 4ISBA 5H9UA 3JAMD 3J80D 1XNQC 1QWIA 3IEUA 4JI0C 3IEVA 1FUGA 4DV7C 5CZVA 1O9TA 1N32C 4DR5C 1HNWC 2DYJA 1MXAA 3GR1A 4I9FA 4JI1C 2ATWA 4DR4C 4LFAC 3L95X 3G7SA 4DV4C 4I9GA 3AF6A 4TPSB 3I07A 2VSQA 5KEIA 1WF3A 2QL8A 2P2QA 2CXCA 4DR7C 4GKKC 4BCAA 2P20A 1ML8A 1NYEA 2D27A 1XNRC 1VLAA 2D7VA 1LCIA 2YWBA 4LF5C 3CW8X 3ETOA 1IBKC 3R9XA 4G37A 2PT7G 2E7GA 4PZPA 5K85A 2UXCC 1T5DX 1O92A 3DLPX 3J7AD 3NYRA 5BSMA 2D1RA 4HPVA 4LF7C 3FCEA 4G36A 4RM2A 4DCTA 4GKJC 4RLFA 5T8TA 4DCVA 2OBVA 5AE2A 1UKKA 5LMUC 1N33C 3L8CA 4FUTA 2ZM6C 2E5LC 2VZEA 4XX2A 3IPLA 1PA4A 4ZLPA 4DR6C 4X66C 5BSRA 4DV3C 4B3TC 4DV6C 5BSTA 4KTVA 5DV9A 1XRBA 2OPLA 1MDBA 4JYAC 4RMNA 3DAYA 2Y4OA 2F4VC 2Y4NA 4LF8C 2PN2A 4DV2C 5BSVA 3EERA 4DG9A 1P7LA 4ODJA 4L2ZA 5KYTA 2ONFA 4DR3C 3CJEA 4BBYA 3T1YC 1L2FA 4GS5A 4RVOA 4D56A 3TDEA 2P2BA 3GR0A 5E7QA 5BURA 2E8CA 4RM3A 1USPB 4K0BA 2D1TA 1N2FA 4GXRA 4ZJZA 4R0MA 3A4IA 2D1QA 1N34C 4L4QA 5K8FA 4DV1C 2UU9C 4JI3C 4OX9C 2BH1X 5BR8C 1O90A 1N36C 4JI6C 4D4IA 1O93A 1AMUA 1QM4A 4IR7A 1FJGC 4JI4C 4FTFA 1JOSA 1K0RA 5CZXA 3LGXA 3R9WA 4LF4C 4LF6C 2D28C 4LFCC 3DHVA 5FLXD 5AE1A 1USPA 3A9UA 3B7WA 4X64C 1EGAA 3RV2A 4DCUA 3PBKA 2BJOA 4D57A 2EGTA 3E7WA 3UZ0A 4DCSA 5A19A 4JI7C 2P2MA 2DPLA 4JM1A 4X65C 4DUYC 4DR2C 2YCBA 1MXCA 4D4GA 1PG3A 3NI2A 5JRHA 3PESA 2QVZX 1MDFA 4AQYC 2UUAC 3IMLA 4WS9A 2QW0X 4B3SC 4KHPC 4G1IA 4JI8C 3CW9A 2OPLB 2D1SA 2QVYX 2HHHC 4DV0C 4BC9A 2E8FA 1BA3A 5IWAC 5GTDA 5A1GA 4YY3C 4NXMC 3NPDA 1XMQC 3UOWA 1MD9A 5T8SA 2YWCA 3S82A 3T1HC 3N2QA 4IZ6A 3GKUA 1XRCA 2KZFA 1T5HX 3R44A 3EQ6A 3I08A 3LNVA 5LMNC 3VNSA 2E0GA 4KTTA 2UUCC 4LE5A 4PHTA 4RVNA 2ASBA 4L7IA 2P02A 1ULTA 4FUQA 1GPMA 4YHHC 4R1MA 1IBLC 3J81D 2E8EA 1XMOC 4LF9C 4MTNA 5AE3A 5BUQA 4JI2C 4JV5C 1J5EC 1V26A 2AYAA 5BSWA 3C5EA 2P2FA 2Y27A 2PROA 4NXNC 4DV5C 4BC7A 4BSZA 2XR1A 4B3MC 1YJ7A 4JI5C 1LQLA 1MXBA 3ETCA 5A2QD 5IT9D 4K0KC 4DUZC 4NDNA 1HH2P 2VQFC 4DR1C 3A9VA 4LFBC 3RG2A 3NYQA 4RLQA 2UXDC 1HR0C 4EATA 1I94C 3TQIA 3LAXA 2WP0C 3VNQA 4OXIA 3H2TA 1ZB9A 3OTOC 1XRAA 3E7XA 4MH4A 2VQEC 4OYCA 4U5YD 1MKYA 1RG9A 4X62C 2UUBC 5KYVA 1PG4A 5BUSA 3AF5A 2V7BA 2UXBC 3N54B 1WH9A 1ZB8A 4GXQA 4NOZA 3GPCA 3PROC 3FCCA 1HNZC 1HNXC 4PROC 1RY2A 2HJGA 1KKGA 4R1LA 2WD9A 5A1IA 4WV3A 3LUSA 4DG8A 3TUFA 5BSUA 2P2JA 3VNRA 5IFIA 1IBMC 2QVXX 2OO4A 4B3RC 1V25A 2CY1A 5ADZA 3SO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 C;  2JMP A;  2OPL A;  1EGA A;  4X64 C;  3J80 D;  3JAM D;  1XNQ C;  4DCU A;  4JV5 C;  1QWI A;  1J5E C;  4JYA C;  2BJO A;  3IEU A;  4JI0 C;  3IEV A;  2EGT A;  4DCS A;  4DV7 C;  1N32 C;  4JI7 C;  4DR5 C;  2F4V C;  1HNW C;  2DYJ A;  4NXN C;  4LF8 C;  2ATW A;  4JI1 C;  2PN2 A;  4X65 C;  4DV2 C;  4DUY C;  3EER A;  4DV5 C;  4DR4 C;  4LFA C;  2YCB A;  4BSZ A;  4DR2 C;  2XR1 A;  4DV4 C;  4B3M C;  4JI5 C;  1LQL A;  2ONF A;  3AF6 A;  4DR3 C;  3CJE A;  3T1Y C;  1L2F A;  5A2Q D;  4AQY C;  5IT9 D;  4K0K C;  4DUZ C;  2UUA C;  3I07 A;  1HH2 P;  2VQF C;  4DR1 C;  4B3S C;  1WF3 A;  4KHP C;  4JI8 C;  2QL8 A;  4LFB C;  2OPL B;  2CXC A;  2E8C A;  4DR7 C;  2UXD C;  4GKK C;  2HHH C;  1USP B;  4DV0 C;  1HR0 C;  1I94 C;  1N2F A;  2E8F A;  5IWA C;  1ML8 A;  1NYE A;  1ZB9 A;  1XNR C;  3OTO C;  1VLA A;  2D7V A;  4MH4 A;  4YY3 C;  4NXM C;  2VQE C;  1XMQ C;  4LF5 C;  1IBK C;  3R9X A;  1MKY A;  1N34 C;  2PT7 G;  4DV1 C;  2E7G A;  4X62 C;  3T1H C;  2UU9 C;  2UUB C;  4JI3 C;  4OX9 C;  2UXC C;  3AF5 A;  2UXB C;  3J7A D;  5BR8 C;  1WH9 A;  1ZB8 A;  1N36 C;  3GKU A;  4NOZ A;  4JI6 C;  4LF7 C;  1HNZ C;  1HNX C;  2KZF A;  4DCT A;  4GKJ C;  5LMN C;  4DCV A;  2HJG A;  1FJG C;  1KKG A;  1UKK A;  5LMU C;  1N33 C;  4JI4 C;  2UUC C;  1JOS A;  1K0R A;  2ZM6 C;  2E5L C;  4XX2 A;  3LUS A;  3R9W A;  2ASB A;  4LF4 C;  1PA4 A;  4LF6 C;  4DR6 C;  1IBM C;  4YHH C;  1IBL C;  4LFC C;  4X66 C;  5FLX D;  3J81 D;  2E8E A;  4DV3 C;  4B3R C;  2CY1 A;  1XMO C;  4B3T C;  4DV6 C;  4LF9 C;  1USP A;  4MTN A; 
#chains in the Genus database with same CATH topology
 3KXW A;  2JMP A;  4ISB A;  5H9U A;  3JAM D;  3J80 D;  1XNQ C;  3K6R A;  1QWI A;  3IEU A;  4JI0 C;  3IEV A;  1FLO A;  1FUG A;  4DV7 C;  5CZV A;  1O9T A;  1N32 C;  4DR5 C;  1HNW C;  2DYJ A;  1MXA A;  3GR1 A;  4I9F A;  4JI1 C;  2ATW A;  4DR4 C;  1XHJ A;  4LFA C;  3L95 X;  3G7S A;  4DV4 C;  4I9G A;  3AF6 A;  1XS3 A;  4TPS B;  3I07 A;  2VSQ A;  2KDN A;  5KEI A;  1WF3 A;  2QL8 A;  2P2Q A;  2CXC A;  4DR7 C;  4GKK C;  4BCA A;  2P20 A;  1ML8 A;  1NYE A;  2D27 A;  1XNR C;  2CU6 A;  1VLA A;  2D7V A;  1LCI A;  2YWB A;  4LF5 C;  3CW8 X;  3ETO A;  1IBK C;  3R9X A;  4G37 A;  2PT7 G;  2E7G A;  4PZP A;  5K85 A;  2UXC C;  1T5D X;  1O92 A;  3DLP X;  3J7A D;  3NYR A;  5BSM A;  2D1R A;  4HPV A;  4LF7 C;  3FCE A;  4G36 A;  4RM2 A;  4DCT A;  4GKJ C;  4RLF A;  4PUG A;  5T8T A;  4DCV A;  2OBV A;  5AE2 A;  1UKK A;  5LMU C;  1N33 C;  3L8C A;  4FUT A;  2ZM6 C;  2E5L C;  2DHM A;  2VZE A;  4XX2 A;  3IPL A;  2PG1 E;  5LCI A;  1PA4 A;  4ZLP A;  4DR6 C;  1V60 A;  4X66 C;  5BSR A;  4DV3 C;  4B3T C;  4DV6 C;  1P4E A;  5BST A;  4KTV A;  5DV9 A;  1XRB A;  2OPL A;  1MDB A;  4JYA C;  1M6X A;  4RMN A;  3DAY A;  2Y4O A;  2F4V C;  2Y4N A;  4LF8 C;  2PN2 A;  4DV2 C;  5BSV A;  3EER A;  4DG9 A;  1P7L A;  4ODJ A;  4L2Z A;  5KYT A;  2ONF A;  2NCL A;  3UX3 A;  4DR3 C;  3CJE A;  4BBY A;  3T1Y C;  1L2F A;  4GS5 A;  4RVO A;  4D56 A;  3TDE A;  2P2B A;  3GR0 A;  5E7Q A;  3A25 A;  5BUR A;  2E8C A;  4RM3 A;  1USP B;  4K0B A;  2D1T A;  1N2F A;  4GXR A;  4ZJZ A;  4PUI A;  4R0M A;  3A4I A;  1WCJ A;  2MMA B;  1PU1 A;  2D1Q A;  1N34 C;  4L4Q A;  5K8F A;  4DV1 C;  2UU9 C;  4JI3 C;  4OX9 C;  2BH1 X;  5BR8 C;  3CQ1 A;  1O90 A;  1N36 C;  4JI6 C;  1YGT A;  4D4I A;  1O93 A;  1AMU A;  1QM4 A;  4IR7 A;  1FJG C;  4JI4 C;  3AY0 A;  4FTF A;  1JOS A;  1K0R A;  5CZX A;  3LGX A;  3O2E A;  3R9W A;  4LF4 C;  4LF6 C;  2D28 C;  4LFC C;  3DHV A;  5FLX D;  5AE1 A;  1USP A;  2JNV A;  3A9U A;  3B7W A;  4X64 C;  1EGA A;  3RV2 A;  4DCU A;  3PBK A;  2BJO A;  4D57 A;  2EGT A;  3E7W A;  3UZ0 A;  4DCS A;  5A19 A;  1XDX A;  4JI7 C;  2P2M A;  2DPL A;  2M5O A;  4JM1 A;  2KZ0 A;  1UWD A;  4X65 C;  4DUY C;  4DR2 C;  2YCB A;  1MXC A;  4D4G A;  1PG3 A;  3NI2 A;  5JRH A;  3PES A;  2QVZ X;  1MDF A;  4AQY C;  2UUA C;  3IML A;  4WS9 A;  2QW0 X;  4B3S C;  4KHP C;  4G1I A;  4JI8 C;  3UEB A;  3CW9 A;  2OPL B;  2D1S A;  2QVY X;  2HHH C;  4DV0 C;  4BC9 A;  2E8F A;  1BA3 A;  5IWA C;  5GTD A;  5A1G A;  4YY3 C;  4NXM C;  3NPD A;  1XMQ C;  3UOW A;  1MD9 A;  5T8S A;  2YWC A;  3S82 A;  1P4E C;  3T1H C;  3N2Q A;  4IZ6 A;  3GKU A;  1VEH A;  1XRC A;  2KZF A;  1T5H X;  3R44 A;  2MCQ A;  3EQ6 A;  3I08 A;  3LNV A;  5LMN C;  3VNS A;  2E0G A;  4KTT A;  2UUC C;  4LE5 A;  4PHT A;  4RVN A;  2ASB A;  1IB8 A;  4L7I A;  2P02 A;  1ULT A;  4FUQ A;  1GPM A;  4YHH C;  4R1M A;  1IBL C;  3J81 D;  2E8E A;  1XMO C;  4LF9 C;  4MTN A;  5AE3 A;  5BUQ A;  4JI2 C;  2ZTB A;  4JV5 C;  1J5E C;  1V26 A;  3FM7 A;  3A26 A;  2AYA A;  5BSW A;  3C5E A;  2P2F A;  2ZZM A;  2Y27 A;  2PRO A;  4NXN C;  4DV5 C;  4BC7 A;  4BSZ A;  2Z51 A;  2XR1 A;  4B3M C;  1YJ7 A;  4JI5 C;  1LQL A;  2ZZN A;  1MXB A;  3ETC A;  5A2Q D;  5IT9 D;  4K0K C;  4DUZ C;  4NDN A;  2YX1 A;  1HH2 P;  2VQF C;  4DR1 C;  3A9V A;  4LFB C;  3RG2 A;  3UX2 A;  3NYQ A;  1M6X C;  4RLQ A;  2UXD C;  1HR0 C;  4EAT A;  1I94 C;  3TQI A;  3LAX A;  2WP0 C;  3VNQ A;  4OXI A;  3H2T A;  1ZB9 A;  3OTO C;  1XRA A;  3E7X A;  4MH4 A;  2VQE C;  4OYC A;  4U5Y D;  1MKY A;  2M5H A;  3CQ2 A;  1RG9 A;  4X62 C;  2UUB C;  5KYV A;  1PG4 A;  5BUS A;  3AF5 A;  2V7B A;  2UXB C;  3N54 B;  1WH9 A;  1ZB8 A;  4GXQ A;  4NOZ A;  3GPC A;  3PRO C;  3FCC A;  1HNZ C;  1HNX C;  4PRO C;  1RY2 A;  1TH5 A;  2HJG A;  3CQ3 A;  1KKG A;  4R1L A;  2WD9 A;  5A1I A;  4WV3 A;  3LNO A;  3LUS A;  4DG8 A;  3TUF A;  5BSU A;  2P2J A;  3VNR A;  5IFI A;  1IBM C;  3TR3 A;  1NY8 A;  2QVX X;  2OO4 A;  4B3R C;  1V25 A;  2CY1 A;  4PUH A;  5ADZ A;  3SO4 A;  2MM9 A; 
#chains in the Genus database with same CATH homology
 3KXW A;  2JMP A;  4ISB A;  5H9U A;  3JAM D;  3J80 D;  1XNQ C;  1QWI A;  3IEU A;  4JI0 C;  3IEV A;  1FUG A;  4DV7 C;  5CZV A;  1O9T A;  1N32 C;  4DR5 C;  1HNW C;  2DYJ A;  1MXA A;  3GR1 A;  4I9F A;  4JI1 C;  2ATW A;  4DR4 C;  4LFA C;  3L95 X;  3G7S A;  4DV4 C;  4I9G A;  3AF6 A;  4TPS B;  3I07 A;  2VSQ A;  5KEI A;  1WF3 A;  2QL8 A;  2P2Q A;  2CXC A;  4DR7 C;  4GKK C;  4BCA A;  2P20 A;  1ML8 A;  1NYE A;  2D27 A;  1XNR C;  1VLA A;  2D7V A;  1LCI A;  2YWB A;  4LF5 C;  3CW8 X;  3ETO A;  1IBK C;  3R9X A;  4G37 A;  2PT7 G;  2E7G A;  4PZP A;  5K85 A;  2UXC C;  1T5D X;  1O92 A;  3DLP X;  3J7A D;  3NYR A;  5BSM A;  2D1R A;  4HPV A;  4LF7 C;  3FCE A;  4G36 A;  4RM2 A;  4DCT A;  4GKJ C;  4RLF A;  5T8T A;  4DCV A;  2OBV A;  5AE2 A;  1UKK A;  5LMU C;  1N33 C;  3L8C A;  4FUT A;  2ZM6 C;  2E5L C;  2VZE A;  4XX2 A;  3IPL A;  1PA4 A;  4ZLP A;  4DR6 C;  4X66 C;  5BSR A;  4DV3 C;  4B3T C;  4DV6 C;  5BST A;  4KTV A;  5DV9 A;  1XRB A;  2OPL A;  1MDB A;  4JYA C;  4RMN A;  3DAY A;  2Y4O A;  2F4V C;  2Y4N A;  4LF8 C;  2PN2 A;  4DV2 C;  5BSV A;  3EER A;  4DG9 A;  1P7L A;  4ODJ A;  4L2Z A;  5KYT A;  2ONF A;  4DR3 C;  3CJE A;  4BBY A;  3T1Y C;  1L2F A;  4GS5 A;  4RVO A;  4D56 A;  3TDE A;  2P2B A;  3GR0 A;  5E7Q A;  5BUR A;  2E8C A;  4RM3 A;  1USP B;  4K0B A;  2D1T A;  1N2F A;  4GXR A;  4ZJZ A;  4R0M A;  3A4I A;  2D1Q A;  1N34 C;  4L4Q A;  5K8F A;  4DV1 C;  2UU9 C;  4JI3 C;  4OX9 C;  2BH1 X;  5BR8 C;  1O90 A;  1N36 C;  4JI6 C;  4D4I A;  1O93 A;  1AMU A;  1QM4 A;  4IR7 A;  1FJG C;  4JI4 C;  4FTF A;  1JOS A;  1K0R A;  5CZX A;  3LGX A;  3R9W A;  4LF4 C;  4LF6 C;  2D28 C;  4LFC C;  3DHV A;  5FLX D;  5AE1 A;  1USP A;  3A9U A;  3B7W A;  4X64 C;  1EGA A;  3RV2 A;  4DCU A;  3PBK A;  2BJO A;  4D57 A;  2EGT A;  3E7W A;  3UZ0 A;  4DCS A;  5A19 A;  4JI7 C;  2P2M A;  2DPL A;  4JM1 A;  4X65 C;  4DUY C;  4DR2 C;  2YCB A;  1MXC A;  4D4G A;  1PG3 A;  3NI2 A;  5JRH A;  3PES A;  2QVZ X;  1MDF A;  4AQY C;  2UUA C;  3IML A;  4WS9 A;  2QW0 X;  4B3S C;  4KHP C;  4G1I A;  4JI8 C;  3CW9 A;  2OPL B;  2D1S A;  2QVY X;  2HHH C;  4DV0 C;  4BC9 A;  2E8F A;  1BA3 A;  5IWA C;  5GTD A;  5A1G A;  4YY3 C;  4NXM C;  3NPD A;  1XMQ C;  3UOW A;  1MD9 A;  5T8S A;  2YWC A;  3S82 A;  3T1H C;  3N2Q A;  4IZ6 A;  3GKU A;  1XRC A;  2KZF A;  1T5H X;  3R44 A;  3EQ6 A;  3I08 A;  3LNV A;  5LMN C;  3VNS A;  2E0G A;  4KTT A;  2UUC C;  4LE5 A;  4PHT A;  4RVN A;  2ASB A;  4L7I A;  2P02 A;  1ULT A;  4FUQ A;  1GPM A;  4YHH C;  4R1M A;  1IBL C;  3J81 D;  2E8E A;  1XMO C;  4LF9 C;  4MTN A;  5AE3 A;  5BUQ A;  4JI2 C;  4JV5 C;  1J5E C;  1V26 A;  2AYA A;  5BSW A;  3C5E A;  2P2F A;  2Y27 A;  2PRO A;  4NXN C;  4DV5 C;  4BC7 A;  4BSZ A;  2XR1 A;  4B3M C;  1YJ7 A;  4JI5 C;  1LQL A;  1MXB A;  3ETC A;  5A2Q D;  5IT9 D;  4K0K C;  4DUZ C;  4NDN A;  1HH2 P;  2VQF C;  4DR1 C;  3A9V A;  4LFB C;  3RG2 A;  3NYQ A;  4RLQ A;  2UXD C;  1HR0 C;  4EAT A;  1I94 C;  3TQI A;  3LAX A;  2WP0 C;  3VNQ A;  4OXI A;  3H2T A;  1ZB9 A;  3OTO C;  1XRA A;  3E7X A;  4MH4 A;  2VQE C;  4OYC A;  4U5Y D;  1MKY A;  1RG9 A;  4X62 C;  2UUB C;  5KYV A;  1PG4 A;  5BUS A;  3AF5 A;  2V7B A;  2UXB C;  3N54 B;  1WH9 A;  1ZB8 A;  4GXQ A;  4NOZ A;  3GPC A;  3PRO C;  3FCC A;  1HNZ C;  1HNX C;  4PRO C;  1RY2 A;  2HJG A;  1KKG A;  4R1L A;  2WD9 A;  5A1I A;  4WV3 A;  3LUS A;  4DG8 A;  3TUF A;  5BSU A;  2P2J A;  3VNR A;  5IFI A;  1IBM C;  2QVX X;  2OO4 A;  4B3R C;  1V25 A;  2CY1 A;  5ADZ A;  3SO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...