2UUAC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uuaC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uuaC02
4DCVA 4DV4C 4JV5C 4JI4C 2UUAC 2DYJA 2BJOA 4DV5C 2ZM6C 2PT7G 3EERA 1WH9A 4DUZC 4LF7C 1USPA 1I94C 1ML8A 4JI6C 1KKGA 2ATWA 4NOZA 1N32C 5BR8C 1HNWC 4BSZA 1FJGC 4MH4A 2CY1A 4DR1C 2CXCA 1MKYA 1J5EC 5A2QD 4B3TC 2E7GA 3AF6A 4AQYC 4X62C 1LQLA 4LF5C 1HH2P 4X65C 2XR1A 1IBMC 4LFAC 4JI1C 2VQEC 3R9WA 4GKJC 1HNXC 4B3MC 4DV6C 1N33C 2KZFA 4DR7C 2QL8A 4JYAC 1K0RA 1USPB 1UKKA 2EGTA 2HHHC 4X66C 3CJEA 4DV3C 3IEUA 4DV1C 4DR4C 2UUBC 4JI2C 3OTOC 1EGAA 1N2FA 1QWIA 1WF3A 4DR6C 4DUYC 1XNRC 4DR5C 2E5LC 1XMOC 1HR0C 1IBKC 4JI8C 2PN2A 2UXDC 2UXCC 1ZB9A 1XNQC 2UUCC 2YCBA 4LF9C 4DCSA 2OPLA 4NXNC 4LFCC 3LUSA 4K0KC 2HJGA 2UXBC 4LF4C 1IBLC 2OPLB 4NXMC 3JAMD 3GKUA 1JOSA 5IT9D 2ASBA 3T1HC 3J81D 3T1YC 4JI7C 5LMUC 1N34C 4YHHC 4DR2C 4GKKC 4X64C 3J80D 1NYEA 4LFBC 5IWAC 4DV0C 4DV2C 4DR3C 4B3SC 2E8CA 5LMNC 2D7VA 4LF8C 4B3RC 4JI0C 1N36C 4JI5C 1XMQC 2UU9C 3J7AD 4KHPC 2JMPA 4YY3C 1VLAA 3I07A 1ZB8A 4DV7C 4JI3C 4XX2A 2ONFA 4MTNA 4OX9C 4LF6C 1PA4A 1L2FA 4DCUA 2F4VC 2E8FA 5FLXD 2E8EA 1HNZC 3AF5A 2VQFC 3IEVA 3R9XA 4DCTA
chains in the Genus database with same CATH superfamily
1ULTA 1YJ7A 3N2QA 2JNVA 5AE2A 4DV5C 4LF7C 3GR0A 2E0GA 3FM7A 2ZZNA 4JI6C 3VNRA 3CQ1A 3N54B 2P2QA 3CW9A 5DV9A 4MH4A 2CY1A 4R1MA 5GTDA 4DR1C 4IR7A 4RLFA 1UWDA 1IB8A 4R1LA 4DG8A 4AQYC 3UX2A 3UOWA 1XRBA 1O93A 5AE1A 3B7WA 3G7SA 2P2JA 1IBMC 4JI1C 2VQEC 4PROC 5BSVA 4B3MC 2KZFA 2QL8A 3ETCA 3FCCA 1UKKA 2EGTA 2VSQA 2KDNA 1YGTA 3CJEA 3IEUA 1V26A 5BSUA 3OTOC 2V7BA 3SO4A 3KXWA 2D27A 1XNRC 1IBKC 2PN2A 3NI2A 1RY2A 4ISBA 2OPLA 4U5YD 4D56A 4NXNC 4BC7A 4D4IA 2HJGA 5BSWA 2UXBC 1P4EA 5T8SA 5KYVA 3JAMD 2DPLA 3L8CA 5IFIA 4K0BA 3TDEA 3FCEA 1T5DX 4DR2C 3NPDA 2E8CA 4PUHA 5LMNC 3EQ6A 4JI0C 1N36C 1VLAA 4DV7C 2YWBA 4OX9C 5H9UA 2D1QA 2D1SA 4GS5A 1PA4A 3A26A 4DCUA 2E8FA 1HNZC 3DAYA 5BSMA 4JV5C 4JI4C 2DYJA 2BJOA 2PT7G 4BC9A 3LNOA 2ZTBA 3H2TA 3IPLA 4PZPA 1KKGA 1M6XA 2QVZX 2D1RA 2CXCA 1J5EC 5A2QD 1O90A 4B3TC 5KEIA 4X62C 1MXBA 3UZ0A 2AYAA 1HH2P 3C5EA 3LAXA 3A4IA 2P02A 3R9WA 3R44A 4DV6C 1N33C 2MCQA 4DR7C 1USPB 3A9VA 3CQ2A 2HHHC 3DLPX 1QM4A 2WD9A 1PU1A 4DV3C 3I08A 1TH5A 1EGAA 1N2FA 4DR6C 4DR5C 1HR0C 2VZEA 2UXDC 4G36A 1P4EC 1XNQC 2YCBA 3CQ3A 4K0KC 3GPCA 4LF4C 1IBLC 1FUGA 3E7XA 5K8FA 2Z51A 5LMUC 4YHHC 4RLQA 4X64C 1NYEA 5IWAC 4DR3C 1XHJA 3ETOA 4LF8C 1V25A 5A1GA 4JI5C 2UU9C 3L95X 2JMPA 4YY3C 4WV3A 4XX2A 4MTNA 4ODJA 1GPMA 3GR1A 1XRAA 4RMNA 2OBVA 1MXAA 1VEHA 3AF5A 4PHTA 3VNSA 4BBYA 3IEVA 3R9XA 4I9FA 1O92A 2DHMA 5T8TA 4DCVA 2WP0C 4DV4C 2P2MA 5CZVA 2D28C 4LE5A 1M6XC 3EERA 3E7WA 1WH9A 4BCAA 4FUQA 1USPA 2P2BA 2MM9A 4R0MA 4NOZA 1N32C 5BR8C 1HNWC 4DG9A 1FJGC 1XDXA 2CU6A 1BA3A 2NCLA 5ADZA 2QW0X 2PG1E 4OYCA 4KTVA 3PESA 4HPVA 2ZZMA 2Y4OA 4X65C 2P2FA 4ZLPA 4GKJC 1HNXC 2P20A 4JYAC 4JM1A 1K0RA 5BUQA 2PROA 4ZJZA 1P7LA 4WS9A 2D1TA 3CW8X 4RM2A 2YX1A 2M5HA 4FUTA 3IMLA 2BH1X 1WF3A 1MXCA 5BURA 5K85A 2KZ0A 3LNVA 1XMOC 3LGXA 3TUFA 1ZB9A 2UUCC 4DCSA 2Y4NA 2OO4A 4EATA 4LFCC 3LUSA 2QVYX 3DHVA 2OPLB 4NXMC 3PBKA 5IT9D 2ASBA 4JI7C 3T1YC 4FTFA 5A1IA 1N34C 4GKKC 2M5OA 4L7IA 1V60A 4RVOA 4RVNA 3K6RA 3J7AD 1XMQC 3I07A 1ZB8A 3TR3A 4JI3C 4TPSB 2ONFA 3RV2A 4PUGA 4LF6C 4IZ6A 2VQFC 1MDFA 5LCIA 3UX3A 5A19A 4D57A 2UUAC 2ZM6C 2Y27A 4DUZC 4KTTA 3S82A 1I94C 1ML8A 1PG4A 2ATWA 4L4QA 4BSZA 1MKYA 4G1IA 1NY8A 1AMUA 1PG3A 4PUIA 2E7GA 5JRHA 3AF6A 4D4GA 1FLOA 1LQLA 5BSTA 4LF5C 5BSRA 1O9TA 4L2ZA 2XR1A 4LFAC 2YWCA 5KYTA 3O2EA 3PROC 2QVXX 3NYRA 4X66C 1LCIA 3A25A 3UEBA 4DV1C 4DR4C 2UUBC 1XS3A 4JI2C 1QWIA 3TQIA 4DUYC 5CZXA 2E5LC 4JI8C 1XRCA 2UXCC 3A9UA 5BUSA 1MD9A 4LF9C 4OXIA 1WCJA 3GKUA 3RG2A 1JOSA 4GXRA 3T1HC 3J81D 3J80D 4LFBC 4G37A 4DV0C 4DV2C 4B3SC 3VNQA 2MMAB 1RG9A 5AE3A 2D7VA 4B3RC 4RM3A 4KHPC 3AY0A 1MDBA 4GXQA 1T5HX 1L2FA 2F4VC 5FLXD 2E8EA 3NYQA 5E7QA 4DCTA 4I9GA 4NDNA
chains in the Genus database with same CATH topology
1ULTA 1YJ7A 3N2QA 5AE2A 4DV5C 4LF7C 3GR0A 2E0GA 4JI6C 3VNRA 3N54B 2P2QA 3CW9A 5DV9A 4MH4A 2CY1A 4R1MA 5GTDA 4DR1C 4IR7A 4RLFA 4R1LA 4DG8A 4AQYC 3UOWA 1XRBA 1O93A 5AE1A 3B7WA 3G7SA 2P2JA 1IBMC 4JI1C 2VQEC 4PROC 5BSVA 4B3MC 2KZFA 2QL8A 3ETCA 3FCCA 1UKKA 2EGTA 2VSQA 3CJEA 3IEUA 1V26A 5BSUA 3OTOC 2V7BA 3SO4A 3KXWA 2D27A 1XNRC 1IBKC 2PN2A 3NI2A 1RY2A 4ISBA 2OPLA 4U5YD 4D56A 4NXNC 4BC7A 4D4IA 2HJGA 5BSWA 2UXBC 5T8SA 5KYVA 3JAMD 2DPLA 3L8CA 5IFIA 4K0BA 3TDEA 3FCEA 1T5DX 4DR2C 3NPDA 2E8CA 5LMNC 3EQ6A 4JI0C 1N36C 1VLAA 4DV7C 2YWBA 4OX9C 5H9UA 2D1QA 2D1SA 4GS5A 1PA4A 4DCUA 2E8FA 1HNZC 3DAYA 5BSMA 4JV5C 4JI4C 2DYJA 2BJOA 2PT7G 4BC9A 3H2TA 3IPLA 4PZPA 1KKGA 2QVZX 2D1RA 2CXCA 1J5EC 5A2QD 1O90A 4B3TC 5KEIA 4X62C 1MXBA 3UZ0A 2AYAA 1HH2P 3C5EA 3LAXA 3A4IA 2P02A 3R9WA 3R44A 4DV6C 1N33C 4DR7C 1USPB 3A9VA 2HHHC 3DLPX 1QM4A 2WD9A 4DV3C 3I08A 1EGAA 1N2FA 4DR6C 4DR5C 1HR0C 2VZEA 2UXDC 4G36A 1XNQC 2YCBA 4K0KC 3GPCA 4LF4C 1IBLC 1FUGA 3E7XA 5K8FA 5LMUC 4YHHC 4RLQA 4X64C 1NYEA 5IWAC 4DR3C 3ETOA 4LF8C 1V25A 5A1GA 4JI5C 2UU9C 3L95X 2JMPA 4YY3C 4WV3A 4XX2A 4MTNA 4ODJA 1GPMA 3GR1A 1XRAA 4RMNA 2OBVA 1MXAA 3AF5A 4PHTA 3VNSA 4BBYA 3IEVA 3R9XA 4I9FA 1O92A 5T8TA 4DCVA 2WP0C 4DV4C 2P2MA 5CZVA 2D28C 4LE5A 3EERA 3E7WA 1WH9A 4BCAA 4FUQA 1USPA 2P2BA 4R0MA 4NOZA 1N32C 5BR8C 1HNWC 4DG9A 1FJGC 1BA3A 5ADZA 2QW0X 4OYCA 4KTVA 3PESA 4HPVA 2Y4OA 4X65C 2P2FA 4ZLPA 4GKJC 1HNXC 2P20A 4JYAC 4JM1A 1K0RA 5BUQA 2PROA 4ZJZA 1P7LA 4WS9A 2D1TA 3CW8X 4RM2A 4FUTA 3IMLA 2BH1X 1WF3A 1MXCA 5BURA 5K85A 3LNVA 1XMOC 3LGXA 3TUFA 1ZB9A 2UUCC 4DCSA 2Y4NA 2OO4A 4EATA 4LFCC 3LUSA 2QVYX 3DHVA 2OPLB 4NXMC 3PBKA 5IT9D 2ASBA 4JI7C 3T1YC 4FTFA 5A1IA 1N34C 4GKKC 4L7IA 4RVOA 4RVNA 3J7AD 1XMQC 3I07A 1ZB8A 4JI3C 4TPSB 2ONFA 3RV2A 4LF6C 4IZ6A 2VQFC 1MDFA 5A19A 4D57A 2UUAC 2ZM6C 2Y27A 4DUZC 4KTTA 3S82A 1I94C 1ML8A 1PG4A 2ATWA 4L4QA 4BSZA 1MKYA 4G1IA 1AMUA 1PG3A 2E7GA 5JRHA 3AF6A 4D4GA 1LQLA 5BSTA 4LF5C 5BSRA 1O9TA 4L2ZA 2XR1A 4LFAC 2YWCA 5KYTA 3PROC 2QVXX 3NYRA 4X66C 1LCIA 4DR4C 4DV1C 2UUBC 4JI2C 1QWIA 3TQIA 4DUYC 5CZXA 2E5LC 4JI8C 1XRCA 2UXCC 3A9UA 5BUSA 1MD9A 4LF9C 4OXIA 3GKUA 3RG2A 1JOSA 4GXRA 3T1HC 3J81D 3J80D 4LFBC 4G37A 4DV0C 4DV2C 4B3SC 3VNQA 1RG9A 5AE3A 2D7VA 4B3RC 4RM3A 4KHPC 1MDBA 4GXQA 1T5HX 1L2FA 2F4VC 5FLXD 2E8EA 3NYQA 5E7QA 4DCTA 4I9GA 4NDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DCV A;  4DV4 C;  4JV5 C;  4JI4 C;  2UUA C;  2DYJ A;  2BJO A;  4DV5 C;  2ZM6 C;  2PT7 G;  3EER A;  1WH9 A;  4DUZ C;  4LF7 C;  1USP A;  1I94 C;  1ML8 A;  4JI6 C;  1KKG A;  2ATW A;  4NOZ A;  1N32 C;  5BR8 C;  1HNW C;  4BSZ A;  1FJG C;  4MH4 A;  2CY1 A;  4DR1 C;  2CXC A;  1MKY A;  1J5E C;  5A2Q D;  4B3T C;  2E7G A;  3AF6 A;  4AQY C;  4X62 C;  1LQL A;  4LF5 C;  1HH2 P;  4X65 C;  2XR1 A;  1IBM C;  4LFA C;  4JI1 C;  2VQE C;  3R9W A;  4GKJ C;  1HNX C;  4B3M C;  4DV6 C;  1N33 C;  2KZF A;  4DR7 C;  2QL8 A;  4JYA C;  1K0R A;  1USP B;  1UKK A;  2EGT A;  2HHH C;  4X66 C;  3CJE A;  4DV3 C;  3IEU A;  4DV1 C;  4DR4 C;  2UUB C;  4JI2 C;  3OTO C;  1EGA A;  1N2F A;  1QWI A;  1WF3 A;  4DR6 C;  4DUY C;  1XNR C;  4DR5 C;  2E5L C;  1XMO C;  1HR0 C;  1IBK C;  4JI8 C;  2PN2 A;  2UXD C;  2UXC C;  1ZB9 A;  1XNQ C;  2UUC C;  2YCB A;  4LF9 C;  4DCS A;  2OPL A;  4NXN C;  4LFC C;  3LUS A;  4K0K C;  2HJG A;  2UXB C;  4LF4 C;  1IBL C;  2OPL B;  4NXM C;  3JAM D;  3GKU A;  1JOS A;  5IT9 D;  2ASB A;  3T1H C;  3J81 D;  3T1Y C;  4JI7 C;  5LMU C;  1N34 C;  4YHH C;  4DR2 C;  4GKK C;  4X64 C;  3J80 D;  1NYE A;  4LFB C;  5IWA C;  4DV0 C;  4DV2 C;  4DR3 C;  4B3S C;  2E8C A;  5LMN C;  2D7V A;  4LF8 C;  4B3R C;  4JI0 C;  1N36 C;  4JI5 C;  1XMQ C;  2UU9 C;  3J7A D;  4KHP C;  2JMP A;  4YY3 C;  1VLA A;  3I07 A;  1ZB8 A;  4DV7 C;  4JI3 C;  4XX2 A;  2ONF A;  4MTN A;  4OX9 C;  4LF6 C;  1PA4 A;  1L2F A;  4DCU A;  2F4V C;  2E8F A;  5FLX D;  2E8E A;  1HNZ C;  3AF5 A;  2VQF C;  3IEV A;  3R9X A;  4DCT A; 
#chains in the Genus database with same CATH topology
 1ULT A;  1YJ7 A;  3N2Q A;  2JNV A;  5AE2 A;  4DV5 C;  4LF7 C;  3GR0 A;  2E0G A;  3FM7 A;  2ZZN A;  4JI6 C;  3VNR A;  3CQ1 A;  3N54 B;  2P2Q A;  3CW9 A;  5DV9 A;  4MH4 A;  2CY1 A;  4R1M A;  5GTD A;  4DR1 C;  4IR7 A;  4RLF A;  1UWD A;  1IB8 A;  4R1L A;  4DG8 A;  4AQY C;  3UX2 A;  3UOW A;  1XRB A;  1O93 A;  5AE1 A;  3B7W A;  3G7S A;  2P2J A;  1IBM C;  4JI1 C;  2VQE C;  4PRO C;  5BSV A;  4B3M C;  2KZF A;  2QL8 A;  3ETC A;  3FCC A;  1UKK A;  2EGT A;  2VSQ A;  2KDN A;  1YGT A;  3CJE A;  3IEU A;  1V26 A;  5BSU A;  3OTO C;  2V7B A;  3SO4 A;  3KXW A;  2D27 A;  1XNR C;  1IBK C;  2PN2 A;  3NI2 A;  1RY2 A;  4ISB A;  2OPL A;  4U5Y D;  4D56 A;  4NXN C;  4BC7 A;  4D4I A;  2HJG A;  5BSW A;  2UXB C;  1P4E A;  5T8S A;  5KYV A;  3JAM D;  2DPL A;  3L8C A;  5IFI A;  4K0B A;  3TDE A;  3FCE A;  1T5D X;  4DR2 C;  3NPD A;  2E8C A;  4PUH A;  5LMN C;  3EQ6 A;  4JI0 C;  1N36 C;  1VLA A;  4DV7 C;  2YWB A;  4OX9 C;  5H9U A;  2D1Q A;  2D1S A;  4GS5 A;  1PA4 A;  3A26 A;  4DCU A;  2E8F A;  1HNZ C;  3DAY A;  5BSM A;  4JV5 C;  4JI4 C;  2DYJ A;  2BJO A;  2PT7 G;  4BC9 A;  3LNO A;  2ZTB A;  3H2T A;  3IPL A;  4PZP A;  1KKG A;  1M6X A;  2QVZ X;  2D1R A;  2CXC A;  1J5E C;  5A2Q D;  1O90 A;  4B3T C;  5KEI A;  4X62 C;  1MXB A;  3UZ0 A;  2AYA A;  1HH2 P;  3C5E A;  3LAX A;  3A4I A;  2P02 A;  3R9W A;  3R44 A;  4DV6 C;  1N33 C;  2MCQ A;  4DR7 C;  1USP B;  3A9V A;  3CQ2 A;  2HHH C;  3DLP X;  1QM4 A;  2WD9 A;  1PU1 A;  4DV3 C;  3I08 A;  1TH5 A;  1EGA A;  1N2F A;  4DR6 C;  4DR5 C;  1HR0 C;  2VZE A;  2UXD C;  4G36 A;  1P4E C;  1XNQ C;  2YCB A;  3CQ3 A;  4K0K C;  3GPC A;  4LF4 C;  1IBL C;  1FUG A;  3E7X A;  5K8F A;  2Z51 A;  5LMU C;  4YHH C;  4RLQ A;  4X64 C;  1NYE A;  5IWA C;  4DR3 C;  1XHJ A;  3ETO A;  4LF8 C;  1V25 A;  5A1G A;  4JI5 C;  2UU9 C;  3L95 X;  2JMP A;  4YY3 C;  4WV3 A;  4XX2 A;  4MTN A;  4ODJ A;  1GPM A;  3GR1 A;  1XRA A;  4RMN A;  2OBV A;  1MXA A;  1VEH A;  3AF5 A;  4PHT A;  3VNS A;  4BBY A;  3IEV A;  3R9X A;  4I9F A;  1O92 A;  2DHM A;  5T8T A;  4DCV A;  2WP0 C;  4DV4 C;  2P2M A;  5CZV A;  2D28 C;  4LE5 A;  1M6X C;  3EER A;  3E7W A;  1WH9 A;  4BCA A;  4FUQ A;  1USP A;  2P2B A;  2MM9 A;  4R0M A;  4NOZ A;  1N32 C;  5BR8 C;  1HNW C;  4DG9 A;  1FJG C;  1XDX A;  2CU6 A;  1BA3 A;  2NCL A;  5ADZ A;  2QW0 X;  2PG1 E;  4OYC A;  4KTV A;  3PES A;  4HPV A;  2ZZM A;  2Y4O A;  4X65 C;  2P2F A;  4ZLP A;  4GKJ C;  1HNX C;  2P20 A;  4JYA C;  4JM1 A;  1K0R A;  5BUQ A;  2PRO A;  4ZJZ A;  1P7L A;  4WS9 A;  2D1T A;  3CW8 X;  4RM2 A;  2YX1 A;  2M5H A;  4FUT A;  3IML A;  2BH1 X;  1WF3 A;  1MXC A;  5BUR A;  5K85 A;  2KZ0 A;  3LNV A;  1XMO C;  3LGX A;  3TUF A;  1ZB9 A;  2UUC C;  4DCS A;  2Y4N A;  2OO4 A;  4EAT A;  4LFC C;  3LUS A;  2QVY X;  3DHV A;  2OPL B;  4NXM C;  3PBK A;  5IT9 D;  2ASB A;  4JI7 C;  3T1Y C;  4FTF A;  5A1I A;  1N34 C;  4GKK C;  2M5O A;  4L7I A;  1V60 A;  4RVO A;  4RVN A;  3K6R A;  3J7A D;  1XMQ C;  3I07 A;  1ZB8 A;  3TR3 A;  4JI3 C;  4TPS B;  2ONF A;  3RV2 A;  4PUG A;  4LF6 C;  4IZ6 A;  2VQF C;  1MDF A;  5LCI A;  3UX3 A;  5A19 A;  4D57 A;  2UUA C;  2ZM6 C;  2Y27 A;  4DUZ C;  4KTT A;  3S82 A;  1I94 C;  1ML8 A;  1PG4 A;  2ATW A;  4L4Q A;  4BSZ A;  1MKY A;  4G1I A;  1NY8 A;  1AMU A;  1PG3 A;  4PUI A;  2E7G A;  5JRH A;  3AF6 A;  4D4G A;  1FLO A;  1LQL A;  5BST A;  4LF5 C;  5BSR A;  1O9T A;  4L2Z A;  2XR1 A;  4LFA C;  2YWC A;  5KYT A;  3O2E A;  3PRO C;  2QVX X;  3NYR A;  4X66 C;  1LCI A;  3A25 A;  3UEB A;  4DV1 C;  4DR4 C;  2UUB C;  1XS3 A;  4JI2 C;  1QWI A;  3TQI A;  4DUY C;  5CZX A;  2E5L C;  4JI8 C;  1XRC A;  2UXC C;  3A9U A;  5BUS A;  1MD9 A;  4LF9 C;  4OXI A;  1WCJ A;  3GKU A;  3RG2 A;  1JOS A;  4GXR A;  3T1H C;  3J81 D;  3J80 D;  4LFB C;  4G37 A;  4DV0 C;  4DV2 C;  4B3S C;  3VNQ A;  2MMA B;  1RG9 A;  5AE3 A;  2D7V A;  4B3R C;  4RM3 A;  4KHP C;  3AY0 A;  1MDB A;  4GXQ A;  1T5H X;  1L2F A;  2F4V C;  5FLX D;  2E8E A;  3NYQ A;  5E7Q A;  4DCT A;  4I9G A;  4NDN A; 
#chains in the Genus database with same CATH homology
 1ULT A;  1YJ7 A;  3N2Q A;  5AE2 A;  4DV5 C;  4LF7 C;  3GR0 A;  2E0G A;  4JI6 C;  3VNR A;  3N54 B;  2P2Q A;  3CW9 A;  5DV9 A;  4MH4 A;  2CY1 A;  4R1M A;  5GTD A;  4DR1 C;  4IR7 A;  4RLF A;  4R1L A;  4DG8 A;  4AQY C;  3UOW A;  1XRB A;  1O93 A;  5AE1 A;  3B7W A;  3G7S A;  2P2J A;  1IBM C;  4JI1 C;  2VQE C;  4PRO C;  5BSV A;  4B3M C;  2KZF A;  2QL8 A;  3ETC A;  3FCC A;  1UKK A;  2EGT A;  2VSQ A;  3CJE A;  3IEU A;  1V26 A;  5BSU A;  3OTO C;  2V7B A;  3SO4 A;  3KXW A;  2D27 A;  1XNR C;  1IBK C;  2PN2 A;  3NI2 A;  1RY2 A;  4ISB A;  2OPL A;  4U5Y D;  4D56 A;  4NXN C;  4BC7 A;  4D4I A;  2HJG A;  5BSW A;  2UXB C;  5T8S A;  5KYV A;  3JAM D;  2DPL A;  3L8C A;  5IFI A;  4K0B A;  3TDE A;  3FCE A;  1T5D X;  4DR2 C;  3NPD A;  2E8C A;  5LMN C;  3EQ6 A;  4JI0 C;  1N36 C;  1VLA A;  4DV7 C;  2YWB A;  4OX9 C;  5H9U A;  2D1Q A;  2D1S A;  4GS5 A;  1PA4 A;  4DCU A;  2E8F A;  1HNZ C;  3DAY A;  5BSM A;  4JV5 C;  4JI4 C;  2DYJ A;  2BJO A;  2PT7 G;  4BC9 A;  3H2T A;  3IPL A;  4PZP A;  1KKG A;  2QVZ X;  2D1R A;  2CXC A;  1J5E C;  5A2Q D;  1O90 A;  4B3T C;  5KEI A;  4X62 C;  1MXB A;  3UZ0 A;  2AYA A;  1HH2 P;  3C5E A;  3LAX A;  3A4I A;  2P02 A;  3R9W A;  3R44 A;  4DV6 C;  1N33 C;  4DR7 C;  1USP B;  3A9V A;  2HHH C;  3DLP X;  1QM4 A;  2WD9 A;  4DV3 C;  3I08 A;  1EGA A;  1N2F A;  4DR6 C;  4DR5 C;  1HR0 C;  2VZE A;  2UXD C;  4G36 A;  1XNQ C;  2YCB A;  4K0K C;  3GPC A;  4LF4 C;  1IBL C;  1FUG A;  3E7X A;  5K8F A;  5LMU C;  4YHH C;  4RLQ A;  4X64 C;  1NYE A;  5IWA C;  4DR3 C;  3ETO A;  4LF8 C;  1V25 A;  5A1G A;  4JI5 C;  2UU9 C;  3L95 X;  2JMP A;  4YY3 C;  4WV3 A;  4XX2 A;  4MTN A;  4ODJ A;  1GPM A;  3GR1 A;  1XRA A;  4RMN A;  2OBV A;  1MXA A;  3AF5 A;  4PHT A;  3VNS A;  4BBY A;  3IEV A;  3R9X A;  4I9F A;  1O92 A;  5T8T A;  4DCV A;  2WP0 C;  4DV4 C;  2P2M A;  5CZV A;  2D28 C;  4LE5 A;  3EER A;  3E7W A;  1WH9 A;  4BCA A;  4FUQ A;  1USP A;  2P2B A;  4R0M A;  4NOZ A;  1N32 C;  5BR8 C;  1HNW C;  4DG9 A;  1FJG C;  1BA3 A;  5ADZ A;  2QW0 X;  4OYC A;  4KTV A;  3PES A;  4HPV A;  2Y4O A;  4X65 C;  2P2F A;  4ZLP A;  4GKJ C;  1HNX C;  2P20 A;  4JYA C;  4JM1 A;  1K0R A;  5BUQ A;  2PRO A;  4ZJZ A;  1P7L A;  4WS9 A;  2D1T A;  3CW8 X;  4RM2 A;  4FUT A;  3IML A;  2BH1 X;  1WF3 A;  1MXC A;  5BUR A;  5K85 A;  3LNV A;  1XMO C;  3LGX A;  3TUF A;  1ZB9 A;  2UUC C;  4DCS A;  2Y4N A;  2OO4 A;  4EAT A;  4LFC C;  3LUS A;  2QVY X;  3DHV A;  2OPL B;  4NXM C;  3PBK A;  5IT9 D;  2ASB A;  4JI7 C;  3T1Y C;  4FTF A;  5A1I A;  1N34 C;  4GKK C;  4L7I A;  4RVO A;  4RVN A;  3J7A D;  1XMQ C;  3I07 A;  1ZB8 A;  4JI3 C;  4TPS B;  2ONF A;  3RV2 A;  4LF6 C;  4IZ6 A;  2VQF C;  1MDF A;  5A19 A;  4D57 A;  2UUA C;  2ZM6 C;  2Y27 A;  4DUZ C;  4KTT A;  3S82 A;  1I94 C;  1ML8 A;  1PG4 A;  2ATW A;  4L4Q A;  4BSZ A;  1MKY A;  4G1I A;  1AMU A;  1PG3 A;  2E7G A;  5JRH A;  3AF6 A;  4D4G A;  1LQL A;  5BST A;  4LF5 C;  5BSR A;  1O9T A;  4L2Z A;  2XR1 A;  4LFA C;  2YWC A;  5KYT A;  3PRO C;  2QVX X;  3NYR A;  4X66 C;  1LCI A;  4DR4 C;  4DV1 C;  2UUB C;  4JI2 C;  1QWI A;  3TQI A;  4DUY C;  5CZX A;  2E5L C;  4JI8 C;  1XRC A;  2UXC C;  3A9U A;  5BUS A;  1MD9 A;  4LF9 C;  4OXI A;  3GKU A;  3RG2 A;  1JOS A;  4GXR A;  3T1H C;  3J81 D;  3J80 D;  4LFB C;  4G37 A;  4DV0 C;  4DV2 C;  4B3S C;  3VNQ A;  1RG9 A;  5AE3 A;  2D7V A;  4B3R C;  4RM3 A;  4KHP C;  1MDB A;  4GXQ A;  1T5H X;  1L2F A;  2F4V C;  5FLX D;  2E8E A;  3NYQ A;  5E7Q A;  4DCT A;  4I9G A;  4NDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...