2UUAC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uuaC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uuaC02
2CY1A 4X64C 2E8CA 2HJGA 1ZB8A 1VLAA 4GKJC 4AQYC 1N33C 1ML8A 4LF8C 4JI3C 4DR7C 2BJOA 4DV7C 4NXMC 3R9XA 4YY3C 4BSZA 4OX9C 3IEUA 3J7AD 4LF7C 1I94C 4LFAC 4JI8C 1UKKA 4DR1C 4LF6C 4DV6C 4DCSA 1XMQC 5FLXD 1XNQC 2UXBC 4JI7C 2F4VC 2VQFC 1XMOC 1XNRC 4MTNA 4DV2C 1HNWC 5IT9D 5BR8C 4DCTA 1FJGC 1IBLC 3JAMD 2EGTA 4LFBC 3J80D 2E8EA 3J81D 4DV0C 4X66C 4JI0C 1L2FA 2YCBA 4X62C 1MKYA 4B3RC 2ONFA 4NXNC 2PN2A 1NYEA 1N34C 3T1HC 4YHHC 3IEVA 4DV4C 1J5EC 4GKKC 3T1YC 4DUYC 2UU9C 4JI1C 4DR2C 2CXCA 2OPLA 4DV1C 2HHHC 4DCVA 3R9WA 4LF4C 3OTOC 5A2QD 4NOZA 2E7GA 1USPA 3I07A 3AF6A 2E5LC 2ZM6C 2JMPA 1ZB9A 2VQEC 4JYAC 1HNXC 5LMNC 1HH2P 3GKUA 1N2FA 2UUAC 4LF5C 4LFCC 2KZFA 2D7VA 2ASBA 2OPLB 1N32C 1KKGA 1PA4A 4JV5C 2QL8A 4K0KC 4DCUA 4DR5C 1IBMC 2UXCC 5IWAC 4DV5C 4B3TC 4MH4A 3LUSA 1HR0C 4DUZC 5LMUC 4JI2C 2UUCC 2PT7G 1HNZC 4DR6C 4DV3C 4B3SC 4DR4C 2UUBC 4XX2A 2DYJA 1N36C 4X65C 1IBKC 2XR1A 2UXDC 1WH9A 4JI5C 4JI6C 1EGAA 4JI4C 2E8FA 1K0RA 4KHPC 1WF3A 3EERA 4DR3C 4LF9C 1LQLA 4B3MC 1QWIA 3CJEA 2ATWA 1JOSA 1USPB 3AF5A
chains in the Genus database with same CATH superfamily
2E8CA 2HJGA 4GKJC 2DHMA 1AMUA 2BJOA 3R9XA 3IMLA 4OX9C 4LF7C 4LF6C 5FLXD 4JI7C 1XMOC 4MTNA 4RVOA 1UWDA 1FJGC 3ETOA 1BA3A 1IBLC 4LFBC 4PROC 5IFIA 4RM3A 4X66C 3E7XA 4G1IA 5BSWA 2ZZNA 4B3RC 3NYRA 3T1HC 3CQ1A 1MXAA 4PUIA 4BC7A 1J5EC 5A1GA 2MCQA 2HHHC 1TH5A 4G37A 1USPA 3I07A 3AY0A 3FM7A 2OO4A 4LF5C 4LFCC 2OPLB 3GR0A 1KKGA 4ISBA 4DV5C 4B3TC 3UX3A 4MH4A 2P2FA 3NYQA 2WD9A 1HR0C 4DUZC 3KXWA 2D1TA 3DLPX 2Y4OA 4PUHA 5GTDA 5T8TA 4FUTA 1WF3A 2MMAB 4EATA 4LF9C 2YX1A 1O90A 4B3MC 1JOSA 1USPB 4FUQA 5E7QA 3AF5A 1YJ7A 2CY1A 4X64C 1ZB8A 1VLAA 4AQYC 4R0MA 1N33C 4LF8C 3L8CA 5LCIA 4DR7C 4BSZA 4BCAA 1V26A 2E0GA 3J7AD 4L4QA 1UKKA 4DV6C 3A26A 3FCCA 2AYAA 1XNQC 4R1MA 4LE5A 4PUGA 2VQFC 1XNRC 3UOWA 4DV2C 1HNWC 5ADZA 2QVYX 2E8EA 4DV0C 3RG2A 4WV3A 2BH1X 4JI0C 1L2FA 4D57A 1LCIA 2D1RA 4GS5A 2Y4NA 2ONFA 3EQ6A 5A19A 1N34C 2OBVA 3GR1A 4DV4C 4HPVA 4U5YD 2OPLA 2YWBA 3CQ2A 3DHVA 1MDBA 3H2TA 4LF4C 3OTOC 2ZZMA 3LGXA 4NOZA 1MXCA 3AF6A 2E5LC 1YGTA 2ZTBA 2VQEC 4JYAC 4L7IA 1HNXC 1N2FA 2KZFA 4RVNA 1RG9A 3TDEA 3N54B 1PA4A 3A25A 3L95X 5K8FA 4JI2C 4JM1A 2UUCC 2PROA 3K6RA 1PG3A 4XX2A 4R1LA 2DYJA 4DG8A 5CZVA 1PU1A 2QVXX 1WH9A 4JI5C 4JI6C 1EGAA 4BC9A 1K0RA 4RLFA 1ULTA 4DR3C 1LQLA 1QWIA 1QM4A 3UX2A 5BUQA 3FCEA 1M6XA 2P2JA 5T8SA 5AE3A 1ML8A 4JI3C 1IB8A 3B7WA 4DV7C 3N2QA 4NXMC 4YY3C 1PG4A 3DAYA 3IEUA 1O93A 2KZ0A 4GXQA 3C5EA 3GPCA 4DCSA 1MXBA 2JNVA 2UXBC 2F4VC 2VZEA 5A1IA 1M6XC 4RM2A 1V25A 3IPLA 2D27A 4OYCA 5BSMA 5KYTA 3JAMD 3J81D 2YCBA 4X62C 5H9UA 1XS3A 1MKYA 4NXNC 2KDNA 1FUGA 2DPLA 4YHHC 2YWCA 2Y27A 3T1YC 2UU9C 4JI1C 1XDXA 4DR2C 2CXCA 2PG1E 4DCVA 1NY8A 4OXIA 5BSVA 5A2QD 2D1SA 2ZM6C 2JMPA 1ZB9A 2D1QA 1P7LA 3PBKA 1HH2P 3GKUA 5DV9A 3A9UA 2UUAC 4L2ZA 2D7VA 4KTTA 3S82A 1N32C 4RMNA 1O92A 2UXCC 1XHJA 3NI2A 4PZPA 5CZXA 4G36A 5AE2A 2P2BA 3SO4A 1HNZC 4DR6C 4DV3C 4DR4C 2UUBC 1FLOA 2P2MA 4X65C 2XR1A 2UXDC 3E7WA 5BSRA 4TPSB 5JRHA 1WCJA 4KHPC 4RLQA 1P4EA 3NPDA 2ATWA 1T5DX 1V60A 3VNRA 2QVZX 4K0BA 3CW8X 5BUSA 5BURA 2CU6A 3VNSA 4PHTA 4BBYA 2Z51A 3UZ0A 3CW9A 1MDFA 4ODJA 4IZ6A 1I94C 4FTFA 4LFAC 2P02A 5KYVA 4JI8C 4DR1C 4GXRA 1XMQC 3VNQA 1P4EC 4DG9A 1MD9A 3A9VA 5IT9D 3TUFA 2V7BA 5BR8C 5AE1A 4DCTA 2NCLA 3A4IA 2EGTA 3J80D 3G7SA 2VSQA 3CQ3A 4I9FA 2D28C 3LNVA 3UEBA 2PN2A 5BSTA 1NYEA 2MM9A 1RY2A 3IEVA 3R44A 4GKKC 3LAXA 1XRCA 4DUYC 2P2QA 4DV1C 1XRAA 3R9WA 2QW0X 4IR7A 2E7GA 5KEIA 3LNOA 5BSUA 4I9GA 5LMNC 1VEHA 3RV2A 2ASBA 1T5HX 4JV5C 2QL8A 4K0KC 4DCUA 3PROC 4ZJZA 4DR5C 2P20A 5IWAC 1IBMC 5K85A 3ETCA 3O2EA 4NDNA 3LUSA 2WP0C 5LMUC 2PT7G 4D4GA 2M5HA 2M5OA 4B3SC 4D56A 1N36C 1IBKC 1XRBA 3TQIA 4JI4C 4WS9A 2E8FA 3I08A 4KTVA 3TR3A 3EERA 3PESA 1GPMA 4D4IA 1O9TA 4ZLPA 3CJEA
chains in the Genus database with same CATH topology
2E8CA 2HJGA 4GKJC 1AMUA 2BJOA 3R9XA 3IMLA 4OX9C 4LF7C 4LF6C 5FLXD 4JI7C 1XMOC 4MTNA 4RVOA 1FJGC 3ETOA 1BA3A 1IBLC 4LFBC 4PROC 5IFIA 4RM3A 4X66C 3E7XA 4G1IA 5BSWA 4B3RC 3NYRA 3T1HC 1MXAA 4BC7A 1J5EC 5A1GA 2HHHC 4G37A 1USPA 3I07A 2OO4A 4LF5C 4LFCC 2OPLB 3GR0A 1KKGA 4ISBA 4DV5C 4B3TC 4MH4A 2P2FA 3NYQA 2WD9A 1HR0C 4DUZC 3KXWA 2D1TA 3DLPX 2Y4OA 5GTDA 5T8TA 4FUTA 1WF3A 4EATA 4LF9C 1O90A 4B3MC 1JOSA 1USPB 4FUQA 5E7QA 3AF5A 1YJ7A 2CY1A 4X64C 1ZB8A 1VLAA 4AQYC 4R0MA 1N33C 4LF8C 3L8CA 4DR7C 4BSZA 4BCAA 1V26A 2E0GA 3J7AD 4L4QA 1UKKA 4DV6C 3FCCA 2AYAA 1XNQC 4R1MA 4LE5A 2VQFC 1XNRC 3UOWA 4DV2C 1HNWC 5ADZA 2QVYX 2E8EA 4DV0C 3RG2A 4WV3A 2BH1X 4JI0C 1L2FA 4D57A 1LCIA 2D1RA 4GS5A 2Y4NA 2ONFA 3EQ6A 5A19A 1N34C 2OBVA 3GR1A 4DV4C 4HPVA 4U5YD 2OPLA 2YWBA 3DHVA 3H2TA 1MDBA 4LF4C 3OTOC 3LGXA 4NOZA 1MXCA 3AF6A 2E5LC 2VQEC 4JYAC 4L7IA 1HNXC 1N2FA 2KZFA 4RVNA 1RG9A 3TDEA 3N54B 1PA4A 3L95X 5K8FA 4JI2C 4JM1A 2UUCC 2PROA 1PG3A 4XX2A 4R1LA 2DYJA 4DG8A 5CZVA 2QVXX 1WH9A 4JI5C 4JI6C 1EGAA 4BC9A 1K0RA 4RLFA 1ULTA 4DR3C 1LQLA 1QWIA 1QM4A 5BUQA 3FCEA 2P2JA 5T8SA 5AE3A 1ML8A 4JI3C 3B7WA 4DV7C 3N2QA 4NXMC 4YY3C 1PG4A 3DAYA 3IEUA 1O93A 4GXQA 3C5EA 3GPCA 4DCSA 1MXBA 2UXBC 2F4VC 2VZEA 5A1IA 4RM2A 1V25A 3IPLA 2D27A 4OYCA 5BSMA 5KYTA 3JAMD 3J81D 2YCBA 4X62C 5H9UA 1MKYA 4NXNC 1FUGA 2DPLA 4YHHC 2YWCA 2Y27A 3T1YC 2UU9C 4JI1C 4DR2C 2CXCA 4DCVA 4OXIA 5BSVA 5A2QD 2D1SA 2ZM6C 2JMPA 1ZB9A 2D1QA 1P7LA 3PBKA 1HH2P 3GKUA 5DV9A 3A9UA 2UUAC 4L2ZA 2D7VA 4KTTA 3S82A 1N32C 4RMNA 1O92A 2UXCC 3NI2A 4PZPA 5CZXA 4G36A 5AE2A 2P2BA 3SO4A 1HNZC 4DR6C 4DV3C 4DR4C 2UUBC 2P2MA 4X65C 2XR1A 2UXDC 3E7WA 5BSRA 4TPSB 5JRHA 4KHPC 4RLQA 3NPDA 2ATWA 1T5DX 3VNRA 2QVZX 4K0BA 3CW8X 5BUSA 5BURA 4BBYA 3VNSA 4PHTA 3UZ0A 3CW9A 1MDFA 4ODJA 4IZ6A 1I94C 4FTFA 4LFAC 2P02A 5KYVA 4JI8C 4DR1C 4GXRA 1XMQC 3VNQA 4DG9A 1MD9A 3A9VA 5IT9D 3TUFA 2V7BA 5BR8C 5AE1A 4DCTA 3A4IA 2EGTA 3J80D 3G7SA 2VSQA 4I9FA 2D28C 3LNVA 2PN2A 5BSTA 1NYEA 1RY2A 3IEVA 3R44A 4GKKC 3LAXA 1XRCA 4DUYC 2P2QA 4DV1C 1XRAA 3R9WA 2QW0X 4IR7A 2E7GA 5KEIA 5BSUA 4I9GA 5LMNC 3RV2A 2ASBA 1T5HX 4JV5C 2QL8A 4K0KC 4DCUA 3PROC 4ZJZA 4DR5C 2P20A 5IWAC 1IBMC 5K85A 3ETCA 4NDNA 3LUSA 2WP0C 5LMUC 2PT7G 4D4GA 4B3SC 4D56A 1N36C 1IBKC 1XRBA 3TQIA 4JI4C 4WS9A 2E8FA 3I08A 4KTVA 3EERA 3PESA 1GPMA 4D4IA 1O9TA 4ZLPA 3CJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CY1 A;  4X64 C;  2E8C A;  2HJG A;  1ZB8 A;  1VLA A;  4GKJ C;  4AQY C;  1N33 C;  1ML8 A;  4LF8 C;  4JI3 C;  4DR7 C;  2BJO A;  4DV7 C;  4NXM C;  3R9X A;  4YY3 C;  4BSZ A;  4OX9 C;  3IEU A;  3J7A D;  4LF7 C;  1I94 C;  4LFA C;  4JI8 C;  1UKK A;  4DR1 C;  4LF6 C;  4DV6 C;  4DCS A;  1XMQ C;  5FLX D;  1XNQ C;  2UXB C;  4JI7 C;  2F4V C;  2VQF C;  1XMO C;  1XNR C;  4MTN A;  4DV2 C;  1HNW C;  5IT9 D;  5BR8 C;  4DCT A;  1FJG C;  1IBL C;  3JAM D;  2EGT A;  4LFB C;  3J80 D;  2E8E A;  3J81 D;  4DV0 C;  4X66 C;  4JI0 C;  1L2F A;  2YCB A;  4X62 C;  1MKY A;  4B3R C;  2ONF A;  4NXN C;  2PN2 A;  1NYE A;  1N34 C;  3T1H C;  4YHH C;  3IEV A;  4DV4 C;  1J5E C;  4GKK C;  3T1Y C;  4DUY C;  2UU9 C;  4JI1 C;  4DR2 C;  2CXC A;  2OPL A;  4DV1 C;  2HHH C;  4DCV A;  3R9W A;  4LF4 C;  3OTO C;  5A2Q D;  4NOZ A;  2E7G A;  1USP A;  3I07 A;  3AF6 A;  2E5L C;  2ZM6 C;  2JMP A;  1ZB9 A;  2VQE C;  4JYA C;  1HNX C;  5LMN C;  1HH2 P;  3GKU A;  1N2F A;  2UUA C;  4LF5 C;  4LFC C;  2KZF A;  2D7V A;  2ASB A;  2OPL B;  1N32 C;  1KKG A;  1PA4 A;  4JV5 C;  2QL8 A;  4K0K C;  4DCU A;  4DR5 C;  1IBM C;  2UXC C;  5IWA C;  4DV5 C;  4B3T C;  4MH4 A;  3LUS A;  1HR0 C;  4DUZ C;  5LMU C;  4JI2 C;  2UUC C;  2PT7 G;  1HNZ C;  4DR6 C;  4DV3 C;  4B3S C;  4DR4 C;  2UUB C;  4XX2 A;  2DYJ A;  1N36 C;  4X65 C;  1IBK C;  2XR1 A;  2UXD C;  1WH9 A;  4JI5 C;  4JI6 C;  1EGA A;  4JI4 C;  2E8F A;  1K0R A;  4KHP C;  1WF3 A;  3EER A;  4DR3 C;  4LF9 C;  1LQL A;  4B3M C;  1QWI A;  3CJE A;  2ATW A;  1JOS A;  1USP B;  3AF5 A; 
#chains in the Genus database with same CATH topology
 2E8C A;  2HJG A;  4GKJ C;  2DHM A;  1AMU A;  2BJO A;  3R9X A;  3IML A;  4OX9 C;  4LF7 C;  4LF6 C;  5FLX D;  4JI7 C;  1XMO C;  4MTN A;  4RVO A;  1UWD A;  1FJG C;  3ETO A;  1BA3 A;  1IBL C;  4LFB C;  4PRO C;  5IFI A;  4RM3 A;  4X66 C;  3E7X A;  4G1I A;  5BSW A;  2ZZN A;  4B3R C;  3NYR A;  3T1H C;  3CQ1 A;  1MXA A;  4PUI A;  4BC7 A;  1J5E C;  5A1G A;  2MCQ A;  2HHH C;  1TH5 A;  4G37 A;  1USP A;  3I07 A;  3AY0 A;  3FM7 A;  2OO4 A;  4LF5 C;  4LFC C;  2OPL B;  3GR0 A;  1KKG A;  4ISB A;  4DV5 C;  4B3T C;  3UX3 A;  4MH4 A;  2P2F A;  3NYQ A;  2WD9 A;  1HR0 C;  4DUZ C;  3KXW A;  2D1T A;  3DLP X;  2Y4O A;  4PUH A;  5GTD A;  5T8T A;  4FUT A;  1WF3 A;  2MMA B;  4EAT A;  4LF9 C;  2YX1 A;  1O90 A;  4B3M C;  1JOS A;  1USP B;  4FUQ A;  5E7Q A;  3AF5 A;  1YJ7 A;  2CY1 A;  4X64 C;  1ZB8 A;  1VLA A;  4AQY C;  4R0M A;  1N33 C;  4LF8 C;  3L8C A;  5LCI A;  4DR7 C;  4BSZ A;  4BCA A;  1V26 A;  2E0G A;  3J7A D;  4L4Q A;  1UKK A;  4DV6 C;  3A26 A;  3FCC A;  2AYA A;  1XNQ C;  4R1M A;  4LE5 A;  4PUG A;  2VQF C;  1XNR C;  3UOW A;  4DV2 C;  1HNW C;  5ADZ A;  2QVY X;  2E8E A;  4DV0 C;  3RG2 A;  4WV3 A;  2BH1 X;  4JI0 C;  1L2F A;  4D57 A;  1LCI A;  2D1R A;  4GS5 A;  2Y4N A;  2ONF A;  3EQ6 A;  5A19 A;  1N34 C;  2OBV A;  3GR1 A;  4DV4 C;  4HPV A;  4U5Y D;  2OPL A;  2YWB A;  3CQ2 A;  3DHV A;  1MDB A;  3H2T A;  4LF4 C;  3OTO C;  2ZZM A;  3LGX A;  4NOZ A;  1MXC A;  3AF6 A;  2E5L C;  1YGT A;  2ZTB A;  2VQE C;  4JYA C;  4L7I A;  1HNX C;  1N2F A;  2KZF A;  4RVN A;  1RG9 A;  3TDE A;  3N54 B;  1PA4 A;  3A25 A;  3L95 X;  5K8F A;  4JI2 C;  4JM1 A;  2UUC C;  2PRO A;  3K6R A;  1PG3 A;  4XX2 A;  4R1L A;  2DYJ A;  4DG8 A;  5CZV A;  1PU1 A;  2QVX X;  1WH9 A;  4JI5 C;  4JI6 C;  1EGA A;  4BC9 A;  1K0R A;  4RLF A;  1ULT A;  4DR3 C;  1LQL A;  1QWI A;  1QM4 A;  3UX2 A;  5BUQ A;  3FCE A;  1M6X A;  2P2J A;  5T8S A;  5AE3 A;  1ML8 A;  4JI3 C;  1IB8 A;  3B7W A;  4DV7 C;  3N2Q A;  4NXM C;  4YY3 C;  1PG4 A;  3DAY A;  3IEU A;  1O93 A;  2KZ0 A;  4GXQ A;  3C5E A;  3GPC A;  4DCS A;  1MXB A;  2JNV A;  2UXB C;  2F4V C;  2VZE A;  5A1I A;  1M6X C;  4RM2 A;  1V25 A;  3IPL A;  2D27 A;  4OYC A;  5BSM A;  5KYT A;  3JAM D;  3J81 D;  2YCB A;  4X62 C;  5H9U A;  1XS3 A;  1MKY A;  4NXN C;  2KDN A;  1FUG A;  2DPL A;  4YHH C;  2YWC A;  2Y27 A;  3T1Y C;  2UU9 C;  4JI1 C;  1XDX A;  4DR2 C;  2CXC A;  2PG1 E;  4DCV A;  1NY8 A;  4OXI A;  5BSV A;  5A2Q D;  2D1S A;  2ZM6 C;  2JMP A;  1ZB9 A;  2D1Q A;  1P7L A;  3PBK A;  1HH2 P;  3GKU A;  5DV9 A;  3A9U A;  2UUA C;  4L2Z A;  2D7V A;  4KTT A;  3S82 A;  1N32 C;  4RMN A;  1O92 A;  2UXC C;  1XHJ A;  3NI2 A;  4PZP A;  5CZX A;  4G36 A;  5AE2 A;  2P2B A;  3SO4 A;  1HNZ C;  4DR6 C;  4DV3 C;  4DR4 C;  2UUB C;  1FLO A;  2P2M A;  4X65 C;  2XR1 A;  2UXD C;  3E7W A;  5BSR A;  4TPS B;  5JRH A;  1WCJ A;  4KHP C;  4RLQ A;  1P4E A;  3NPD A;  2ATW A;  1T5D X;  1V60 A;  3VNR A;  2QVZ X;  4K0B A;  3CW8 X;  5BUS A;  5BUR A;  2CU6 A;  3VNS A;  4PHT A;  4BBY A;  2Z51 A;  3UZ0 A;  3CW9 A;  1MDF A;  4ODJ A;  4IZ6 A;  1I94 C;  4FTF A;  4LFA C;  2P02 A;  5KYV A;  4JI8 C;  4DR1 C;  4GXR A;  1XMQ C;  3VNQ A;  1P4E C;  4DG9 A;  1MD9 A;  3A9V A;  5IT9 D;  3TUF A;  2V7B A;  5BR8 C;  5AE1 A;  4DCT A;  2NCL A;  3A4I A;  2EGT A;  3J80 D;  3G7S A;  2VSQ A;  3CQ3 A;  4I9F A;  2D28 C;  3LNV A;  3UEB A;  2PN2 A;  5BST A;  1NYE A;  2MM9 A;  1RY2 A;  3IEV A;  3R44 A;  4GKK C;  3LAX A;  1XRC A;  4DUY C;  2P2Q A;  4DV1 C;  1XRA A;  3R9W A;  2QW0 X;  4IR7 A;  2E7G A;  5KEI A;  3LNO A;  5BSU A;  4I9G A;  5LMN C;  1VEH A;  3RV2 A;  2ASB A;  1T5H X;  4JV5 C;  2QL8 A;  4K0K C;  4DCU A;  3PRO C;  4ZJZ A;  4DR5 C;  2P20 A;  5IWA C;  1IBM C;  5K85 A;  3ETC A;  3O2E A;  4NDN A;  3LUS A;  2WP0 C;  5LMU C;  2PT7 G;  4D4G A;  2M5H A;  2M5O A;  4B3S C;  4D56 A;  1N36 C;  1IBK C;  1XRB A;  3TQI A;  4JI4 C;  4WS9 A;  2E8F A;  3I08 A;  4KTV A;  3TR3 A;  3EER A;  3PES A;  1GPM A;  4D4I A;  1O9T A;  4ZLP A;  3CJE A; 
#chains in the Genus database with same CATH homology
 2E8C A;  2HJG A;  4GKJ C;  1AMU A;  2BJO A;  3R9X A;  3IML A;  4OX9 C;  4LF7 C;  4LF6 C;  5FLX D;  4JI7 C;  1XMO C;  4MTN A;  4RVO A;  1FJG C;  3ETO A;  1BA3 A;  1IBL C;  4LFB C;  4PRO C;  5IFI A;  4RM3 A;  4X66 C;  3E7X A;  4G1I A;  5BSW A;  4B3R C;  3NYR A;  3T1H C;  1MXA A;  4BC7 A;  1J5E C;  5A1G A;  2HHH C;  4G37 A;  1USP A;  3I07 A;  2OO4 A;  4LF5 C;  4LFC C;  2OPL B;  3GR0 A;  1KKG A;  4ISB A;  4DV5 C;  4B3T C;  4MH4 A;  2P2F A;  3NYQ A;  2WD9 A;  1HR0 C;  4DUZ C;  3KXW A;  2D1T A;  3DLP X;  2Y4O A;  5GTD A;  5T8T A;  4FUT A;  1WF3 A;  4EAT A;  4LF9 C;  1O90 A;  4B3M C;  1JOS A;  1USP B;  4FUQ A;  5E7Q A;  3AF5 A;  1YJ7 A;  2CY1 A;  4X64 C;  1ZB8 A;  1VLA A;  4AQY C;  4R0M A;  1N33 C;  4LF8 C;  3L8C A;  4DR7 C;  4BSZ A;  4BCA A;  1V26 A;  2E0G A;  3J7A D;  4L4Q A;  1UKK A;  4DV6 C;  3FCC A;  2AYA A;  1XNQ C;  4R1M A;  4LE5 A;  2VQF C;  1XNR C;  3UOW A;  4DV2 C;  1HNW C;  5ADZ A;  2QVY X;  2E8E A;  4DV0 C;  3RG2 A;  4WV3 A;  2BH1 X;  4JI0 C;  1L2F A;  4D57 A;  1LCI A;  2D1R A;  4GS5 A;  2Y4N A;  2ONF A;  3EQ6 A;  5A19 A;  1N34 C;  2OBV A;  3GR1 A;  4DV4 C;  4HPV A;  4U5Y D;  2OPL A;  2YWB A;  3DHV A;  3H2T A;  1MDB A;  4LF4 C;  3OTO C;  3LGX A;  4NOZ A;  1MXC A;  3AF6 A;  2E5L C;  2VQE C;  4JYA C;  4L7I A;  1HNX C;  1N2F A;  2KZF A;  4RVN A;  1RG9 A;  3TDE A;  3N54 B;  1PA4 A;  3L95 X;  5K8F A;  4JI2 C;  4JM1 A;  2UUC C;  2PRO A;  1PG3 A;  4XX2 A;  4R1L A;  2DYJ A;  4DG8 A;  5CZV A;  2QVX X;  1WH9 A;  4JI5 C;  4JI6 C;  1EGA A;  4BC9 A;  1K0R A;  4RLF A;  1ULT A;  4DR3 C;  1LQL A;  1QWI A;  1QM4 A;  5BUQ A;  3FCE A;  2P2J A;  5T8S A;  5AE3 A;  1ML8 A;  4JI3 C;  3B7W A;  4DV7 C;  3N2Q A;  4NXM C;  4YY3 C;  1PG4 A;  3DAY A;  3IEU A;  1O93 A;  4GXQ A;  3C5E A;  3GPC A;  4DCS A;  1MXB A;  2UXB C;  2F4V C;  2VZE A;  5A1I A;  4RM2 A;  1V25 A;  3IPL A;  2D27 A;  4OYC A;  5BSM A;  5KYT A;  3JAM D;  3J81 D;  2YCB A;  4X62 C;  5H9U A;  1MKY A;  4NXN C;  1FUG A;  2DPL A;  4YHH C;  2YWC A;  2Y27 A;  3T1Y C;  2UU9 C;  4JI1 C;  4DR2 C;  2CXC A;  4DCV A;  4OXI A;  5BSV A;  5A2Q D;  2D1S A;  2ZM6 C;  2JMP A;  1ZB9 A;  2D1Q A;  1P7L A;  3PBK A;  1HH2 P;  3GKU A;  5DV9 A;  3A9U A;  2UUA C;  4L2Z A;  2D7V A;  4KTT A;  3S82 A;  1N32 C;  4RMN A;  1O92 A;  2UXC C;  3NI2 A;  4PZP A;  5CZX A;  4G36 A;  5AE2 A;  2P2B A;  3SO4 A;  1HNZ C;  4DR6 C;  4DV3 C;  4DR4 C;  2UUB C;  2P2M A;  4X65 C;  2XR1 A;  2UXD C;  3E7W A;  5BSR A;  4TPS B;  5JRH A;  4KHP C;  4RLQ A;  3NPD A;  2ATW A;  1T5D X;  3VNR A;  2QVZ X;  4K0B A;  3CW8 X;  5BUS A;  5BUR A;  4BBY A;  3VNS A;  4PHT A;  3UZ0 A;  3CW9 A;  1MDF A;  4ODJ A;  4IZ6 A;  1I94 C;  4FTF A;  4LFA C;  2P02 A;  5KYV A;  4JI8 C;  4DR1 C;  4GXR A;  1XMQ C;  3VNQ A;  4DG9 A;  1MD9 A;  3A9V A;  5IT9 D;  3TUF A;  2V7B A;  5BR8 C;  5AE1 A;  4DCT A;  3A4I A;  2EGT A;  3J80 D;  3G7S A;  2VSQ A;  4I9F A;  2D28 C;  3LNV A;  2PN2 A;  5BST A;  1NYE A;  1RY2 A;  3IEV A;  3R44 A;  4GKK C;  3LAX A;  1XRC A;  4DUY C;  2P2Q A;  4DV1 C;  1XRA A;  3R9W A;  2QW0 X;  4IR7 A;  2E7G A;  5KEI A;  5BSU A;  4I9G A;  5LMN C;  3RV2 A;  2ASB A;  1T5H X;  4JV5 C;  2QL8 A;  4K0K C;  4DCU A;  3PRO C;  4ZJZ A;  4DR5 C;  2P20 A;  5IWA C;  1IBM C;  5K85 A;  3ETC A;  4NDN A;  3LUS A;  2WP0 C;  5LMU C;  2PT7 G;  4D4G A;  4B3S C;  4D56 A;  1N36 C;  1IBK C;  1XRB A;  3TQI A;  4JI4 C;  4WS9 A;  2E8F A;  3I08 A;  4KTV A;  3EER A;  3PES A;  1GPM A;  4D4I A;  1O9T A;  4ZLP A;  3CJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...