2UUAC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uuaC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uuaC02
2F4VC 4DCUA 2UUBC 2YCBA 1L2FA 1HNWC 4GKJC 1XMQC 3AF5A 1HR0C 1N36C 1EGAA 4NOZA 2UXDC 1N2FA 5IWAC 1ZB8A 1IBLC 1XMOC 2CY1A 3R9XA 2E8EA 1WF3A 1HNZC 2JMPA 5LMUC 4JI2C 4DV5C 2E5LC 5A2QD 4DR3C 4DR6C 2HJGA 3CJEA 2OPLA 4KHPC 2QL8A 1USPB 4B3MC 1HH2P 1UKKA 1XNRC 4JV5C 4JI3C 4MTNA 1VLAA 3LUSA 1PA4A 4DR1C 3J80D 2E7GA 1N32C 2ZM6C 3J7AD 1ML8A 2OPLB 4DV3C 1WH9A 3IEVA 4B3TC 4NXNC 3IEUA 4DV2C 1ZB9A 1USPA 4OX9C 1QWIA 4X62C 2BJOA 4NXMC 1XNQC 3R9WA 4LF6C 3OTOC 4BSZA 4JI5C 2ASBA 3EERA 3T1YC 2UXCC 1N33C 5FLXD 4JI0C 4DV0C 4X66C 4B3RC 1KKGA 1J5EC 2VQFC 4DCTA 1NYEA 2PN2A 2ATWA 1HNXC 2E8CA 3GKUA 1MKYA 4DR7C 4DR5C 4K0KC 2HHHC 4DR2C 2E8FA 4GKKC 4XX2A 4DV6C 5IT9D 4YHHC 5LMNC 3I07A 1K0RA 4JI8C 4AQYC 1JOSA 4DV4C 2KZFA 1IBKC 1N34C 4LFCC 4LF8C 5BR8C 1FJGC 4X65C 1LQLA 2ONFA 4YY3C 2EGTA 4JI1C 2DYJA 4DUZC 2UUAC 4DV7C 2PT7G 4JYAC 4JI4C 2VQEC 4DCVA 2CXCA 2UUCC 4LFAC 4MH4A 4LF4C 1I94C 2D7VA 4LFBC 3AF6A 4JI7C 4LF5C 2UXBC 3JAMD 1IBMC 4DR4C 4DV1C 3J81D 4X64C 4B3SC 4JI6C 4LF9C 2UU9C 4DCSA 4DUYC 4LF7C 2XR1A 3T1HC
chains in the Genus database with same CATH superfamily
1T5HX 1V26A 4GKJC 3B7WA 1RG9A 4NOZA 2QVXX 5IWAC 2CY1A 4IR7A 4BC9A 2E5LC 4DR3C 4WV3A 3CJEA 5BSMA 1O93A 5KYVA 4B3MC 3E7WA 3TR3A 4I9GA 1PA4A 2JNVA 2P2QA 3CW9A 1NY8A 1N32C 3AY0A 2P2MA 4DV3C 1WH9A 5BSUA 4FUTA 3ETOA 4K0BA 3OTOC 3EERA 2D1RA 2QW0X 4BCAA 4B3RC 4EATA 4DG9A 2ATWA 3DLPX 1O92A 5BSVA 1MKYA 4PROC 4DR7C 2E0GA 4XX2A 4DV6C 3G7SA 4RLQA 1MXCA 1AMUA 3LGXA 4PUGA 1K0RA 4JI8C 3DHVA 3UOWA 2Y27A 4X65C 2P2JA 5A19A 4YY3C 1PG3A 4DV7C 2PT7G 4JI4C 2UUCC 4LFAC 4R1LA 4LF4C 1I94C 2D7VA 2UXBC 1LCIA 5ADZA 2WD9A 3FM7A 3O2EA 1XRBA 4KTTA 5BURA 3CQ3A 1FLOA 2F4VC 2KZ0A 4I9FA 5A1GA 4KTVA 5K85A 3VNQA 3A9UA 3A9VA 1N36C 1T5DX 1IBLC 4RMNA 2P2FA 5JRHA 3GPCA 5H9UA 4DV5C 4DR6C 4D56A 1UWDA 2HJGA 4KHPC 1P7LA 1HH2P 4FTFA 4JV5C 4OYCA 1MXBA 2OBVA 3NYQA 1XRCA 2AYAA 3K6RA 4GXRA 2OPLB 1BA3A 3IEVA 1M6XA 1XS3A 4RVOA 4NXNC 3IMLA 1YJ7A 1USPA 1QWIA 4NXMC 4PZPA 3A4IA 3T1YC 1MD9A 1N33C 5KEIA 5FLXD 2VZEA 2ZZMA 4JI0C 4DV0C 4PUIA 4X66C 2Y4OA 1KKGA 1J5EC 2VQFC 1NYEA 2PN2A 3RV2A 1HNXC 4DR5C 3L8CA 5IT9D 4YHHC 4WS9A 1P4EA 1IBKC 2NCLA 4LFCC 4LF8C 5BR8C 1FJGC 3CQ2A 2ONFA 2Y4NA 2DYJA 3NI2A 3IPLA 2UUAC 1GPMA 2VQEC 5BSRA 4BC7A 2M5OA 1ULTA 1IB8A 1QM4A 1V25A 2DHMA 4DV1C 3C5EA 5LCIA 3EQ6A 3FCCA 4JI6C 2YX1A 3ETCA 4ODJA 4LF9C 2UU9C 4ISBA 4DCSA 5AE1A 2P20A 2UUBC 1HNWC 3UZ0A 1XMQC 4G36A 1HR0C 4PHTA 1N2FA 1WCJA 2P02A 3S82A 1HNZC 2JMPA 5LMUC 1YGTA 3SO4A 3GR0A 3N2QA 2QL8A 3NPDA 1USPB 1XNRC 2MMAB 4JI3C 1VLAA 4ZLPA 3UEBA 4DR1C 2E7GA 3TUFA 2Z51A 1ML8A 4RM2A 4JM1A 3LAXA 4DV2C 3VNRA 4DG8A 4OX9C 4X62C 4LE5A 2BJOA 1XNQC 3R9WA 3E7XA 4BSZA 2ASBA 3I08A 5CZXA 3PBKA 5BUQA 2OO4A 3UX2A 1RY2A 2D27A 2QVYX 3H2TA 4DCTA 5BSWA 2M5HA 2E8CA 2YWBA 3A25A 4K0KC 2HHHC 1FUGA 5LMNC 3I07A 4AQYC 3TQIA 3NYRA 2KZFA 2ZTBA 2ZZNA 1XHJA 4FUQA 4L2ZA 4JI1C 5A1IA 4GXQA 3A26A 2CXCA 4MH4A 2MM9A 4JI7C 4LF5C 4IZ6A 4BBYA 4RM3A 3UX3A 3LNOA 3J81D 4X64C 4ZJZA 4B3SC 2WP0C 4R0MA 3R44A 2MCQA 2D1QA 4G1IA 1O90A 2XR1A 3T1HC 4LF7C 4DCUA 2YCBA 5DV9A 1MDFA 1L2FA 1O9TA 5CZVA 3AF5A 1EGAA 2UXDC 4PUHA 1ZB8A 5BUSA 5KYTA 1XMOC 2DPLA 3FCEA 5BSTA 2YWCA 2E8EA 3R9XA 1WF3A 4JI2C 4D4IA 2PG1E 4D4GA 5A2QD 2D1SA 1M6XC 3N54B 5T8SA 2OPLA 4G37A 1PU1A 2KDNA 1V60A 1UKKA 4L7IA 4MTNA 3LUSA 2BH1X 3J80D 4RLFA 4NDNA 5K8FA 2ZM6C 3J7AD 3CW8X 1MXAA 4B3TC 5E7QA 3IEUA 4RVNA 1ZB9A 2D28C 4LF6C 1XDXA 4JI5C 2UXCC 5GTDA 5AE2A 2P2BA 3TDEA 5AE3A 2V7BA 1P4EC 2D1TA 3GKUA 3L95X 3VNSA 3RG2A 4GS5A 4DR2C 2E8FA 4L4QA 4GKKC 2VSQA 4TPSB 1JOSA 4HPVA 1MDBA 1VEHA 4DV4C 1N34C 3CQ1A 1LQLA 1PG4A 2EGTA 4DUZC 4JYAC 4DCVA 3GR1A 5T8TA 4OXIA 4LFBC 3AF6A 3DAYA 3JAMD 4R1MA 4U5YD 1IBMC 3PROC 4DR4C 3LNVA 3KXWA 5IFIA 2PROA 2QVZX 4D57A 2CU6A 3PESA 4DUYC 1TH5A 1XRAA
chains in the Genus database with same CATH topology
1T5HX 1V26A 4GKJC 3B7WA 1RG9A 4NOZA 2QVXX 5IWAC 2CY1A 4IR7A 4BC9A 2E5LC 4DR3C 4WV3A 3CJEA 5BSMA 1O93A 5KYVA 4B3MC 3E7WA 4I9GA 1PA4A 2P2QA 3CW9A 1N32C 2P2MA 4DV3C 1WH9A 5BSUA 4FUTA 3ETOA 4K0BA 3OTOC 3EERA 2D1RA 2QW0X 4BCAA 4B3RC 4EATA 4DG9A 2ATWA 3DLPX 1O92A 5BSVA 1MKYA 4PROC 4DR7C 2E0GA 4XX2A 4DV6C 3G7SA 4RLQA 1MXCA 1AMUA 3LGXA 1K0RA 4JI8C 3DHVA 3UOWA 2Y27A 4X65C 2P2JA 5A19A 4YY3C 1PG3A 4DV7C 2PT7G 4JI4C 2UUCC 4LFAC 4R1LA 4LF4C 1I94C 2D7VA 2UXBC 1LCIA 5ADZA 2WD9A 1XRBA 4KTTA 5BURA 2F4VC 4I9FA 5A1GA 4KTVA 5K85A 3VNQA 3A9UA 3A9VA 1N36C 1T5DX 1IBLC 4RMNA 2P2FA 5JRHA 3GPCA 5H9UA 4DV5C 4DR6C 4D56A 2HJGA 4KHPC 1P7LA 1HH2P 4FTFA 4JV5C 4OYCA 1MXBA 2OBVA 3NYQA 1XRCA 2AYAA 4GXRA 2OPLB 1BA3A 3IEVA 4RVOA 4NXNC 3IMLA 1YJ7A 1USPA 1QWIA 4NXMC 4PZPA 3A4IA 3T1YC 1MD9A 1N33C 5KEIA 5FLXD 2VZEA 4JI0C 4DV0C 4X66C 2Y4OA 1KKGA 1J5EC 2VQFC 1NYEA 2PN2A 3RV2A 1HNXC 4DR5C 3L8CA 5IT9D 4YHHC 4WS9A 1IBKC 4LFCC 4LF8C 5BR8C 1FJGC 2ONFA 2Y4NA 2DYJA 3NI2A 3IPLA 2UUAC 1GPMA 2VQEC 5BSRA 4BC7A 1ULTA 1QM4A 1V25A 4DV1C 3C5EA 3EQ6A 3FCCA 4JI6C 3ETCA 4ODJA 4LF9C 2UU9C 4ISBA 4DCSA 5AE1A 2P20A 2UUBC 1HNWC 3UZ0A 1XMQC 4G36A 1HR0C 4PHTA 1N2FA 2P02A 3S82A 1HNZC 2JMPA 5LMUC 3SO4A 3GR0A 3N2QA 2QL8A 3NPDA 1USPB 1XNRC 4JI3C 1VLAA 4ZLPA 4DR1C 2E7GA 3TUFA 1ML8A 4RM2A 4JM1A 3LAXA 4DV2C 3VNRA 4DG8A 4OX9C 4X62C 4LE5A 2BJOA 1XNQC 3R9WA 3E7XA 4BSZA 2ASBA 3I08A 5CZXA 3PBKA 5BUQA 2OO4A 1RY2A 2D27A 2QVYX 3H2TA 4DCTA 5BSWA 2E8CA 2YWBA 4K0KC 2HHHC 1FUGA 5LMNC 3I07A 4AQYC 3TQIA 3NYRA 2KZFA 4FUQA 4L2ZA 4JI1C 5A1IA 4GXQA 2CXCA 4MH4A 4JI7C 4LF5C 4IZ6A 4BBYA 4RM3A 3J81D 4X64C 4ZJZA 4B3SC 2WP0C 4R0MA 3R44A 2D1QA 4G1IA 1O90A 2XR1A 3T1HC 4LF7C 4DCUA 2YCBA 5DV9A 1MDFA 1L2FA 1O9TA 5CZVA 3AF5A 1EGAA 2UXDC 1ZB8A 5BUSA 5KYTA 1XMOC 2DPLA 3FCEA 5BSTA 2YWCA 2E8EA 3R9XA 1WF3A 4JI2C 4D4IA 4D4GA 5A2QD 2D1SA 3N54B 5T8SA 2OPLA 4G37A 1UKKA 4L7IA 4MTNA 3LUSA 2BH1X 3J80D 4RLFA 4NDNA 5K8FA 2ZM6C 3J7AD 3CW8X 1MXAA 4B3TC 5E7QA 3IEUA 4RVNA 1ZB9A 2D28C 4LF6C 4JI5C 2UXCC 5GTDA 5AE2A 2P2BA 3TDEA 5AE3A 2V7BA 2D1TA 3GKUA 3L95X 3VNSA 3RG2A 4GS5A 4DR2C 2E8FA 4L4QA 4GKKC 2VSQA 4TPSB 1JOSA 4HPVA 1MDBA 4DV4C 1N34C 1LQLA 1PG4A 2EGTA 4DUZC 4JYAC 4DCVA 3GR1A 5T8TA 4OXIA 4LFBC 3AF6A 3DAYA 3JAMD 4R1MA 4U5YD 1IBMC 3PROC 4DR4C 3LNVA 3KXWA 5IFIA 2PROA 2QVZX 4D57A 3PESA 4DUYC 1XRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V C;  4DCU A;  2UUB C;  2YCB A;  1L2F A;  1HNW C;  4GKJ C;  1XMQ C;  3AF5 A;  1HR0 C;  1N36 C;  1EGA A;  4NOZ A;  2UXD C;  1N2F A;  5IWA C;  1ZB8 A;  1IBL C;  1XMO C;  2CY1 A;  3R9X A;  2E8E A;  1WF3 A;  1HNZ C;  2JMP A;  5LMU C;  4JI2 C;  4DV5 C;  2E5L C;  5A2Q D;  4DR3 C;  4DR6 C;  2HJG A;  3CJE A;  2OPL A;  4KHP C;  2QL8 A;  1USP B;  4B3M C;  1HH2 P;  1UKK A;  1XNR C;  4JV5 C;  4JI3 C;  4MTN A;  1VLA A;  3LUS A;  1PA4 A;  4DR1 C;  3J80 D;  2E7G A;  1N32 C;  2ZM6 C;  3J7A D;  1ML8 A;  2OPL B;  4DV3 C;  1WH9 A;  3IEV A;  4B3T C;  4NXN C;  3IEU A;  4DV2 C;  1ZB9 A;  1USP A;  4OX9 C;  1QWI A;  4X62 C;  2BJO A;  4NXM C;  1XNQ C;  3R9W A;  4LF6 C;  3OTO C;  4BSZ A;  4JI5 C;  2ASB A;  3EER A;  3T1Y C;  2UXC C;  1N33 C;  5FLX D;  4JI0 C;  4DV0 C;  4X66 C;  4B3R C;  1KKG A;  1J5E C;  2VQF C;  4DCT A;  1NYE A;  2PN2 A;  2ATW A;  1HNX C;  2E8C A;  3GKU A;  1MKY A;  4DR7 C;  4DR5 C;  4K0K C;  2HHH C;  4DR2 C;  2E8F A;  4GKK C;  4XX2 A;  4DV6 C;  5IT9 D;  4YHH C;  5LMN C;  3I07 A;  1K0R A;  4JI8 C;  4AQY C;  1JOS A;  4DV4 C;  2KZF A;  1IBK C;  1N34 C;  4LFC C;  4LF8 C;  5BR8 C;  1FJG C;  4X65 C;  1LQL A;  2ONF A;  4YY3 C;  2EGT A;  4JI1 C;  2DYJ A;  4DUZ C;  2UUA C;  4DV7 C;  2PT7 G;  4JYA C;  4JI4 C;  2VQE C;  4DCV A;  2CXC A;  2UUC C;  4LFA C;  4MH4 A;  4LF4 C;  1I94 C;  2D7V A;  4LFB C;  3AF6 A;  4JI7 C;  4LF5 C;  2UXB C;  3JAM D;  1IBM C;  4DR4 C;  4DV1 C;  3J81 D;  4X64 C;  4B3S C;  4JI6 C;  4LF9 C;  2UU9 C;  4DCS A;  4DUY C;  4LF7 C;  2XR1 A;  3T1H C; 
#chains in the Genus database with same CATH topology
 1T5H X;  1V26 A;  4GKJ C;  3B7W A;  1RG9 A;  4NOZ A;  2QVX X;  5IWA C;  2CY1 A;  4IR7 A;  4BC9 A;  2E5L C;  4DR3 C;  4WV3 A;  3CJE A;  5BSM A;  1O93 A;  5KYV A;  4B3M C;  3E7W A;  3TR3 A;  4I9G A;  1PA4 A;  2JNV A;  2P2Q A;  3CW9 A;  1NY8 A;  1N32 C;  3AY0 A;  2P2M A;  4DV3 C;  1WH9 A;  5BSU A;  4FUT A;  3ETO A;  4K0B A;  3OTO C;  3EER A;  2D1R A;  2QW0 X;  4BCA A;  4B3R C;  4EAT A;  4DG9 A;  2ATW A;  3DLP X;  1O92 A;  5BSV A;  1MKY A;  4PRO C;  4DR7 C;  2E0G A;  4XX2 A;  4DV6 C;  3G7S A;  4RLQ A;  1MXC A;  1AMU A;  3LGX A;  4PUG A;  1K0R A;  4JI8 C;  3DHV A;  3UOW A;  2Y27 A;  4X65 C;  2P2J A;  5A19 A;  4YY3 C;  1PG3 A;  4DV7 C;  2PT7 G;  4JI4 C;  2UUC C;  4LFA C;  4R1L A;  4LF4 C;  1I94 C;  2D7V A;  2UXB C;  1LCI A;  5ADZ A;  2WD9 A;  3FM7 A;  3O2E A;  1XRB A;  4KTT A;  5BUR A;  3CQ3 A;  1FLO A;  2F4V C;  2KZ0 A;  4I9F A;  5A1G A;  4KTV A;  5K85 A;  3VNQ A;  3A9U A;  3A9V A;  1N36 C;  1T5D X;  1IBL C;  4RMN A;  2P2F A;  5JRH A;  3GPC A;  5H9U A;  4DV5 C;  4DR6 C;  4D56 A;  1UWD A;  2HJG A;  4KHP C;  1P7L A;  1HH2 P;  4FTF A;  4JV5 C;  4OYC A;  1MXB A;  2OBV A;  3NYQ A;  1XRC A;  2AYA A;  3K6R A;  4GXR A;  2OPL B;  1BA3 A;  3IEV A;  1M6X A;  1XS3 A;  4RVO A;  4NXN C;  3IML A;  1YJ7 A;  1USP A;  1QWI A;  4NXM C;  4PZP A;  3A4I A;  3T1Y C;  1MD9 A;  1N33 C;  5KEI A;  5FLX D;  2VZE A;  2ZZM A;  4JI0 C;  4DV0 C;  4PUI A;  4X66 C;  2Y4O A;  1KKG A;  1J5E C;  2VQF C;  1NYE A;  2PN2 A;  3RV2 A;  1HNX C;  4DR5 C;  3L8C A;  5IT9 D;  4YHH C;  4WS9 A;  1P4E A;  1IBK C;  2NCL A;  4LFC C;  4LF8 C;  5BR8 C;  1FJG C;  3CQ2 A;  2ONF A;  2Y4N A;  2DYJ A;  3NI2 A;  3IPL A;  2UUA C;  1GPM A;  2VQE C;  5BSR A;  4BC7 A;  2M5O A;  1ULT A;  1IB8 A;  1QM4 A;  1V25 A;  2DHM A;  4DV1 C;  3C5E A;  5LCI A;  3EQ6 A;  3FCC A;  4JI6 C;  2YX1 A;  3ETC A;  4ODJ A;  4LF9 C;  2UU9 C;  4ISB A;  4DCS A;  5AE1 A;  2P20 A;  2UUB C;  1HNW C;  3UZ0 A;  1XMQ C;  4G36 A;  1HR0 C;  4PHT A;  1N2F A;  1WCJ A;  2P02 A;  3S82 A;  1HNZ C;  2JMP A;  5LMU C;  1YGT A;  3SO4 A;  3GR0 A;  3N2Q A;  2QL8 A;  3NPD A;  1USP B;  1XNR C;  2MMA B;  4JI3 C;  1VLA A;  4ZLP A;  3UEB A;  4DR1 C;  2E7G A;  3TUF A;  2Z51 A;  1ML8 A;  4RM2 A;  4JM1 A;  3LAX A;  4DV2 C;  3VNR A;  4DG8 A;  4OX9 C;  4X62 C;  4LE5 A;  2BJO A;  1XNQ C;  3R9W A;  3E7X A;  4BSZ A;  2ASB A;  3I08 A;  5CZX A;  3PBK A;  5BUQ A;  2OO4 A;  3UX2 A;  1RY2 A;  2D27 A;  2QVY X;  3H2T A;  4DCT A;  5BSW A;  2M5H A;  2E8C A;  2YWB A;  3A25 A;  4K0K C;  2HHH C;  1FUG A;  5LMN C;  3I07 A;  4AQY C;  3TQI A;  3NYR A;  2KZF A;  2ZTB A;  2ZZN A;  1XHJ A;  4FUQ A;  4L2Z A;  4JI1 C;  5A1I A;  4GXQ A;  3A26 A;  2CXC A;  4MH4 A;  2MM9 A;  4JI7 C;  4LF5 C;  4IZ6 A;  4BBY A;  4RM3 A;  3UX3 A;  3LNO A;  3J81 D;  4X64 C;  4ZJZ A;  4B3S C;  2WP0 C;  4R0M A;  3R44 A;  2MCQ A;  2D1Q A;  4G1I A;  1O90 A;  2XR1 A;  3T1H C;  4LF7 C;  4DCU A;  2YCB A;  5DV9 A;  1MDF A;  1L2F A;  1O9T A;  5CZV A;  3AF5 A;  1EGA A;  2UXD C;  4PUH A;  1ZB8 A;  5BUS A;  5KYT A;  1XMO C;  2DPL A;  3FCE A;  5BST A;  2YWC A;  2E8E A;  3R9X A;  1WF3 A;  4JI2 C;  4D4I A;  2PG1 E;  4D4G A;  5A2Q D;  2D1S A;  1M6X C;  3N54 B;  5T8S A;  2OPL A;  4G37 A;  1PU1 A;  2KDN A;  1V60 A;  1UKK A;  4L7I A;  4MTN A;  3LUS A;  2BH1 X;  3J80 D;  4RLF A;  4NDN A;  5K8F A;  2ZM6 C;  3J7A D;  3CW8 X;  1MXA A;  4B3T C;  5E7Q A;  3IEU A;  4RVN A;  1ZB9 A;  2D28 C;  4LF6 C;  1XDX A;  4JI5 C;  2UXC C;  5GTD A;  5AE2 A;  2P2B A;  3TDE A;  5AE3 A;  2V7B A;  1P4E C;  2D1T A;  3GKU A;  3L95 X;  3VNS A;  3RG2 A;  4GS5 A;  4DR2 C;  2E8F A;  4L4Q A;  4GKK C;  2VSQ A;  4TPS B;  1JOS A;  4HPV A;  1MDB A;  1VEH A;  4DV4 C;  1N34 C;  3CQ1 A;  1LQL A;  1PG4 A;  2EGT A;  4DUZ C;  4JYA C;  4DCV A;  3GR1 A;  5T8T A;  4OXI A;  4LFB C;  3AF6 A;  3DAY A;  3JAM D;  4R1M A;  4U5Y D;  1IBM C;  3PRO C;  4DR4 C;  3LNV A;  3KXW A;  5IFI A;  2PRO A;  2QVZ X;  4D57 A;  2CU6 A;  3PES A;  4DUY C;  1TH5 A;  1XRA A; 
#chains in the Genus database with same CATH homology
 1T5H X;  1V26 A;  4GKJ C;  3B7W A;  1RG9 A;  4NOZ A;  2QVX X;  5IWA C;  2CY1 A;  4IR7 A;  4BC9 A;  2E5L C;  4DR3 C;  4WV3 A;  3CJE A;  5BSM A;  1O93 A;  5KYV A;  4B3M C;  3E7W A;  4I9G A;  1PA4 A;  2P2Q A;  3CW9 A;  1N32 C;  2P2M A;  4DV3 C;  1WH9 A;  5BSU A;  4FUT A;  3ETO A;  4K0B A;  3OTO C;  3EER A;  2D1R A;  2QW0 X;  4BCA A;  4B3R C;  4EAT A;  4DG9 A;  2ATW A;  3DLP X;  1O92 A;  5BSV A;  1MKY A;  4PRO C;  4DR7 C;  2E0G A;  4XX2 A;  4DV6 C;  3G7S A;  4RLQ A;  1MXC A;  1AMU A;  3LGX A;  1K0R A;  4JI8 C;  3DHV A;  3UOW A;  2Y27 A;  4X65 C;  2P2J A;  5A19 A;  4YY3 C;  1PG3 A;  4DV7 C;  2PT7 G;  4JI4 C;  2UUC C;  4LFA C;  4R1L A;  4LF4 C;  1I94 C;  2D7V A;  2UXB C;  1LCI A;  5ADZ A;  2WD9 A;  1XRB A;  4KTT A;  5BUR A;  2F4V C;  4I9F A;  5A1G A;  4KTV A;  5K85 A;  3VNQ A;  3A9U A;  3A9V A;  1N36 C;  1T5D X;  1IBL C;  4RMN A;  2P2F A;  5JRH A;  3GPC A;  5H9U A;  4DV5 C;  4DR6 C;  4D56 A;  2HJG A;  4KHP C;  1P7L A;  1HH2 P;  4FTF A;  4JV5 C;  4OYC A;  1MXB A;  2OBV A;  3NYQ A;  1XRC A;  2AYA A;  4GXR A;  2OPL B;  1BA3 A;  3IEV A;  4RVO A;  4NXN C;  3IML A;  1YJ7 A;  1USP A;  1QWI A;  4NXM C;  4PZP A;  3A4I A;  3T1Y C;  1MD9 A;  1N33 C;  5KEI A;  5FLX D;  2VZE A;  4JI0 C;  4DV0 C;  4X66 C;  2Y4O A;  1KKG A;  1J5E C;  2VQF C;  1NYE A;  2PN2 A;  3RV2 A;  1HNX C;  4DR5 C;  3L8C A;  5IT9 D;  4YHH C;  4WS9 A;  1IBK C;  4LFC C;  4LF8 C;  5BR8 C;  1FJG C;  2ONF A;  2Y4N A;  2DYJ A;  3NI2 A;  3IPL A;  2UUA C;  1GPM A;  2VQE C;  5BSR A;  4BC7 A;  1ULT A;  1QM4 A;  1V25 A;  4DV1 C;  3C5E A;  3EQ6 A;  3FCC A;  4JI6 C;  3ETC A;  4ODJ A;  4LF9 C;  2UU9 C;  4ISB A;  4DCS A;  5AE1 A;  2P20 A;  2UUB C;  1HNW C;  3UZ0 A;  1XMQ C;  4G36 A;  1HR0 C;  4PHT A;  1N2F A;  2P02 A;  3S82 A;  1HNZ C;  2JMP A;  5LMU C;  3SO4 A;  3GR0 A;  3N2Q A;  2QL8 A;  3NPD A;  1USP B;  1XNR C;  4JI3 C;  1VLA A;  4ZLP A;  4DR1 C;  2E7G A;  3TUF A;  1ML8 A;  4RM2 A;  4JM1 A;  3LAX A;  4DV2 C;  3VNR A;  4DG8 A;  4OX9 C;  4X62 C;  4LE5 A;  2BJO A;  1XNQ C;  3R9W A;  3E7X A;  4BSZ A;  2ASB A;  3I08 A;  5CZX A;  3PBK A;  5BUQ A;  2OO4 A;  1RY2 A;  2D27 A;  2QVY X;  3H2T A;  4DCT A;  5BSW A;  2E8C A;  2YWB A;  4K0K C;  2HHH C;  1FUG A;  5LMN C;  3I07 A;  4AQY C;  3TQI A;  3NYR A;  2KZF A;  4FUQ A;  4L2Z A;  4JI1 C;  5A1I A;  4GXQ A;  2CXC A;  4MH4 A;  4JI7 C;  4LF5 C;  4IZ6 A;  4BBY A;  4RM3 A;  3J81 D;  4X64 C;  4ZJZ A;  4B3S C;  2WP0 C;  4R0M A;  3R44 A;  2D1Q A;  4G1I A;  1O90 A;  2XR1 A;  3T1H C;  4LF7 C;  4DCU A;  2YCB A;  5DV9 A;  1MDF A;  1L2F A;  1O9T A;  5CZV A;  3AF5 A;  1EGA A;  2UXD C;  1ZB8 A;  5BUS A;  5KYT A;  1XMO C;  2DPL A;  3FCE A;  5BST A;  2YWC A;  2E8E A;  3R9X A;  1WF3 A;  4JI2 C;  4D4I A;  4D4G A;  5A2Q D;  2D1S A;  3N54 B;  5T8S A;  2OPL A;  4G37 A;  1UKK A;  4L7I A;  4MTN A;  3LUS A;  2BH1 X;  3J80 D;  4RLF A;  4NDN A;  5K8F A;  2ZM6 C;  3J7A D;  3CW8 X;  1MXA A;  4B3T C;  5E7Q A;  3IEU A;  4RVN A;  1ZB9 A;  2D28 C;  4LF6 C;  4JI5 C;  2UXC C;  5GTD A;  5AE2 A;  2P2B A;  3TDE A;  5AE3 A;  2V7B A;  2D1T A;  3GKU A;  3L95 X;  3VNS A;  3RG2 A;  4GS5 A;  4DR2 C;  2E8F A;  4L4Q A;  4GKK C;  2VSQ A;  4TPS B;  1JOS A;  4HPV A;  1MDB A;  4DV4 C;  1N34 C;  1LQL A;  1PG4 A;  2EGT A;  4DUZ C;  4JYA C;  4DCV A;  3GR1 A;  5T8T A;  4OXI A;  4LFB C;  3AF6 A;  3DAY A;  3JAM D;  4R1M A;  4U5Y D;  1IBM C;  3PRO C;  4DR4 C;  3LNV A;  3KXW A;  5IFI A;  2PRO A;  2QVZ X;  4D57 A;  3PES A;  4DUY C;  1XRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...