4X62C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4x62C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4x62C02
4DCVA 4DCSA 2E7GA 4X64C 4DV0C 2CY1A 5LMUC 4DR6C 1KKGA 4DUZC 1IBLC 4JI8C 1J5EC 4YHHC 2HHHC 4YY3C 1HR0C 4DR2C 4GKJC 4DV2C 4LF5C 5A2QD 5LMNC 4JI5C 4XX2A 4K0KC 3IEVA 4B3RC 2EGTA 4DR7C 1HNZC 2ASBA 3GKUA 4JV5C 2HJGA 5FLXD 4GKKC 3IEUA 4DCUA 2E8EA 1XNRC 4JI0C 3R9XA 1XMQC 4DV1C 2ONFA 3OTOC 4NOZA 2E8FA 1MKYA 4BSZA 1VLAA 3J80D 1HNXC 1UKKA 4LF9C 1N32C 3T1HC 3J7AD 2F4VC 4LFBC 4AQYC 2UUCC 4B3TC 2OPLB 4LF4C 1I94C 1NYEA 3CJEA 2ZM6C 2XR1A 1QWIA 4LFCC 1N33C 4JI2C 5IT9D 4LF6C 5BR8C 2D7VA 4LF7C 2UXBC 1N2FA 4NXMC 2DYJA 4DCTA 4DR5C 4DR4C 3I07A 2E5LC 4LF8C 2QL8A 2VQFC 1USPB 4DV3C 2CXCA 1WF3A 2BJOA 4JI3C 4DV4C 4DR3C 1JOSA 2OPLA 3T1YC 4DR1C 2UUAC 1LQLA 4MTNA 3AF5A 4X62C 5IWAC 3JAMD 1XNQC 4B3SC 1IBKC 1N36C 4MH4A 4DV7C 2E8CA 1EGAA 2KZFA 3LUSA 4JI7C 4DV5C 2JMPA 1XMOC 4OX9C 2UXCC 1WH9A 2UU9C 4JI1C 1USPA 1FJGC 1ZB8A 4X65C 4DV6C 1PA4A 1N34C 2ATWA 1K0RA 2PT7G 1HNWC 4X66C 2VQEC 4JI4C 1IBMC 4LFAC 4NXNC 4DUYC 2PN2A 3AF6A 3J81D 2UXDC 1L2FA 4KHPC 3R9WA 2YCBA 2UUBC 4B3MC 1ZB9A 4JYAC 3EERA 1HH2P 4JI6C 1ML8A
chains in the Genus database with same CATH superfamily
1M6XC 2NCLA 1O90A 4G1IA 4YY3C 3N2QA 1LCIA 4DV2C 4RMNA 1NY8A 3RV2A 4DG8A 3IEVA 5BURA 3A25A 1FLOA 1HNZC 4JV5C 1MDBA 2VZEA 3EQ6A 2E8EA 2YWBA 2ONFA 2QVYX 3KXWA 3OTOC 1WCJA 1TH5A 2D28C 2E8FA 1PU1A 1MXCA 1XS3A 4LF9C 1N32C 3FCEA 4WS9A 5ADZA 4G36A 1V60A 4PHTA 4LF4C 1O93A 1AMUA 2ZM6C 4JI2C 3L8CA 5DV9A 5BR8C 2D7VA 1P4EC 2UXBC 2P2MA 1N2FA 4NXMC 3CW9A 4DR5C 3I07A 2ZZMA 2D1QA 3K6RA 1XRAA 4KTTA 1PG3A 4PUIA 2VQFC 1USPB 5T8SA 1WF3A 2BJOA 4RVOA 3AF5A 2PROA 1XNQC 3VNQA 1YGTA 3GR0A 3UOWA 3LUSA 2Y27A 3CQ3A 1YJ7A 1XMOC 4OYCA 4FUQA 3B7WA 1USPA 4X65C 4DG9A 3DLPX 4JI4C 5JRHA 4EATA 5K85A 2UXDC 2M5HA 4KHPC 2OO4A 1ZB9A 3NYQA 3EERA 4OXIA 4DCVA 1UWDA 2OBVA 4DV0C 2CY1A 5KYTA 4DR6C 1KKGA 4DUZC 2ZZNA 2CU6A 4JI8C 3H2TA 2ZTBA 3PBKA 3IMLA 5BSTA 2WP0C 2EGTA 5AE3A 4LE5A 4PUHA 5BSMA 4GKKC 4JI0C 5IFIA 1XMQC 1V26A 2MCQA 1MKYA 3J80D 1HNXC 5KEIA 2P20A 3T1HC 1M6XA 2F4VC 4LFBC 2QVZX 2OPLB 4GS5A 5BSWA 2P2FA 3CJEA 4HPVA 2XR1A 1QWIA 1N33C 3ETOA 4PROC 1XDXA 4L4QA 2JNVA 3A4IA 3A26A 3E7WA 4R1MA 3FM7A 1XHJA 3TUFA 4ODJA 2DHMA 4D4IA 2QW0X 4KTVA 4NDNA 4DV3C 1P7LA 1JOSA 2D1RA 2OPLA 5A1IA 2UUAC 2P02A 1O92A 4D56A 5BSRA 1BA3A 5E7QA 2YX1A 4MH4A 4DV7C 1EGAA 4PUGA 4IZ6A 2PG1E 4L2ZA 4JI7C 3NYRA 4FUTA 2JMPA 4D4GA 1FJGC 1ZB8A 5LCIA 1PG4A 2PT7G 1HNWC 2M5OA 1QM4A 3AY0A 3LNVA 4FTFA 1IBMC 3C5EA 4NXNC 3AF6A 3J81D 4G37A 5CZXA 3R9WA 1HH2P 5BSUA 4I9GA 4DCSA 4X64C 2E7GA 3FCCA 3A9VA 5LMUC 3L95X 4RVNA 1IBLC 4YHHC 2HHHC 1HR0C 4GKJC 4GXRA 4LF5C 5A2QD 5LMNC 4XX2A 4B3RC 1IB8A 4TPSB 4I9FA 2WD9A 4BC9A 2HJGA 3IEUA 3RG2A 1XNRC 3DAYA 3R9XA 1ULTA 2V7BA 4D57A 2E0GA 5A19A 3LAXA 4NOZA 4BSZA 2KZ0A 3G7SA 1GPMA 5BSVA 4GXQA 3J7AD 4ZLPA 2VSQA 2UUCC 4B3TC 1I94C 3GPCA 5IT9D 2Z51A 4LF6C 2Y4NA 4LF7C 3UZ0A 4DR4C 2E5LC 4R0MA 4WV3A 1XRCA 5AE2A 4K0BA 3E7XA 4DV4C 4JI3C 5A1GA 4DR1C 3PESA 1LQLA 4R1LA 1VEHA 3TQIA 5IWAC 1IBKC 2BH1X 2KZFA 3UX3A 1MDFA 4DV5C 3LGXA 4JI1C 5T8TA 3NI2A 4JM1A 1K0RA 2ATWA 4X66C 4RLFA 4RM3A 2MMAB 4LFAC 5BUSA 4BC7A 2AYAA 1L2FA 2P2JA 1O9TA 1T5DX 2YCBA 4JYAC 4B3MC 5CZVA 4IR7A 3S82A 1V25A 1J5EC 3IPLA 1P4EA 2DPLA 4DR2C 4JI5C 4L7IA 4K0KC 3VNRA 3NPDA 4DR7C 5K8FA 2ASBA 1T5HX 4PZPA 3CQ2A 3GKUA 3SO4A 5FLXD 5BUQA 4DCUA 1RY2A 2KDNA 4DV1C 2MM9A 2D27A 3I08A 1VLAA 2YWCA 1UKKA 3CQ1A 3PROC 2D1SA 3UX2A 4AQYC 1NYEA 4ZJZA 4LFCC 2DYJA 2D1TA 4DCTA 4RM2A 5GTDA 4LF8C 2QL8A 2Y4OA 2CXCA 4DR3C 3T1YC 1MXBA 4MTNA 4X62C 3N54B 3JAMD 3R44A 4B3SC 4BBYA 3TDEA 1FUGA 3VNSA 1N36C 2E8CA 3ETCA 5AE1A 4U5YD 2P2QA 2UXCC 4OX9C 1WH9A 3TR3A 2UU9C 4BCAA 4DV6C 3UEBA 1PA4A 3CW8X 1N34C 1MD9A 2VQEC 1XRBA 3O2EA 5H9UA 4ISBA 4DUYC 2PN2A 3GR1A 3A9UA 1MXAA 2QVXX 3LNOA 4RLQA 2P2BA 2UUBC 3DHVA 1RG9A 5KYVA 4JI6C 1ML8A
chains in the Genus database with same CATH topology
1O90A 4G1IA 4YY3C 3N2QA 1LCIA 4DV2C 4RMNA 3RV2A 4DG8A 3IEVA 5BURA 1HNZC 4JV5C 1MDBA 2VZEA 3EQ6A 2E8EA 2YWBA 2ONFA 2QVYX 3KXWA 3OTOC 2D28C 2E8FA 1MXCA 4LF9C 1N32C 3FCEA 4WS9A 5ADZA 4G36A 4PHTA 4LF4C 1O93A 1AMUA 2ZM6C 4JI2C 3L8CA 5DV9A 5BR8C 2D7VA 2UXBC 2P2MA 1N2FA 4NXMC 3CW9A 4DR5C 3I07A 2D1QA 1XRAA 4KTTA 1PG3A 2VQFC 1USPB 5T8SA 1WF3A 2BJOA 4RVOA 3AF5A 2PROA 1XNQC 3VNQA 3GR0A 3UOWA 3LUSA 2Y27A 1YJ7A 1XMOC 4OYCA 4FUQA 3B7WA 1USPA 4X65C 4DG9A 3DLPX 4JI4C 5JRHA 4EATA 5K85A 2UXDC 4KHPC 2OO4A 1ZB9A 3NYQA 3EERA 4OXIA 4DCVA 2OBVA 4DV0C 2CY1A 5KYTA 4DR6C 1KKGA 4DUZC 4JI8C 3H2TA 3PBKA 3IMLA 5BSTA 2WP0C 2EGTA 5AE3A 4LE5A 5BSMA 4GKKC 4JI0C 5IFIA 1XMQC 1V26A 1MKYA 3J80D 1HNXC 5KEIA 2P20A 3T1HC 2F4VC 4LFBC 2QVZX 2OPLB 4GS5A 5BSWA 2P2FA 3CJEA 4HPVA 2XR1A 1QWIA 1N33C 3ETOA 4PROC 4L4QA 3A4IA 4R1MA 3E7WA 3TUFA 4ODJA 4D4IA 2QW0X 4KTVA 4NDNA 4DV3C 1P7LA 1JOSA 2D1RA 2OPLA 5A1IA 2UUAC 2P02A 1O92A 4D56A 5BSRA 1BA3A 5E7QA 4MH4A 4DV7C 1EGAA 4IZ6A 4L2ZA 4JI7C 3NYRA 4FUTA 2JMPA 4D4GA 1FJGC 1ZB8A 1PG4A 2PT7G 1HNWC 1QM4A 3LNVA 4FTFA 1IBMC 3C5EA 4NXNC 3AF6A 3J81D 4G37A 5CZXA 3R9WA 1HH2P 5BSUA 4I9GA 4DCSA 4X64C 2E7GA 3FCCA 3A9VA 5LMUC 3L95X 4RVNA 1IBLC 4YHHC 2HHHC 1HR0C 4GKJC 4GXRA 4LF5C 5A2QD 5LMNC 4XX2A 4B3RC 4TPSB 4I9FA 2WD9A 4BC9A 2HJGA 3IEUA 3RG2A 1XNRC 3DAYA 3R9XA 1ULTA 2V7BA 4D57A 2E0GA 5A19A 3LAXA 4NOZA 4BSZA 3G7SA 1GPMA 5BSVA 4GXQA 3J7AD 4ZLPA 2VSQA 2UUCC 4B3TC 1I94C 3GPCA 5IT9D 4LF6C 2Y4NA 4LF7C 3UZ0A 4DR4C 2E5LC 4R0MA 4WV3A 1XRCA 5AE2A 4K0BA 3E7XA 4DV4C 4JI3C 5A1GA 4DR1C 3PESA 1LQLA 4R1LA 3TQIA 5IWAC 1IBKC 2BH1X 2KZFA 1MDFA 4DV5C 3LGXA 4JI1C 5T8TA 3NI2A 4JM1A 1K0RA 2ATWA 4X66C 4RLFA 4RM3A 4LFAC 5BUSA 4BC7A 2AYAA 1L2FA 2P2JA 1O9TA 1T5DX 2YCBA 4JYAC 4B3MC 5CZVA 4IR7A 3S82A 1V25A 1J5EC 3IPLA 2DPLA 4DR2C 4JI5C 4L7IA 4K0KC 3VNRA 3NPDA 4DR7C 5K8FA 2ASBA 1T5HX 4PZPA 3GKUA 3SO4A 5FLXD 5BUQA 4DCUA 1RY2A 4DV1C 2D27A 3I08A 1VLAA 2YWCA 1UKKA 3PROC 2D1SA 4AQYC 1NYEA 4ZJZA 4LFCC 2DYJA 2D1TA 4DCTA 4RM2A 5GTDA 4LF8C 2QL8A 2Y4OA 2CXCA 4DR3C 3T1YC 1MXBA 4MTNA 4X62C 3N54B 3JAMD 3R44A 4B3SC 4BBYA 3TDEA 1FUGA 3VNSA 1N36C 2E8CA 3ETCA 5AE1A 4U5YD 2P2QA 2UXCC 4OX9C 1WH9A 2UU9C 4BCAA 4DV6C 1PA4A 3CW8X 1N34C 1MD9A 2VQEC 1XRBA 5H9UA 4ISBA 4DUYC 2PN2A 3GR1A 3A9UA 1MXAA 2QVXX 4RLQA 2P2BA 2UUBC 3DHVA 1RG9A 5KYVA 4JI6C 1ML8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DCV A;  4DCS A;  2E7G A;  4X64 C;  4DV0 C;  2CY1 A;  5LMU C;  4DR6 C;  1KKG A;  4DUZ C;  1IBL C;  4JI8 C;  1J5E C;  4YHH C;  2HHH C;  4YY3 C;  1HR0 C;  4DR2 C;  4GKJ C;  4DV2 C;  4LF5 C;  5A2Q D;  5LMN C;  4JI5 C;  4XX2 A;  4K0K C;  3IEV A;  4B3R C;  2EGT A;  4DR7 C;  1HNZ C;  2ASB A;  3GKU A;  4JV5 C;  2HJG A;  5FLX D;  4GKK C;  3IEU A;  4DCU A;  2E8E A;  1XNR C;  4JI0 C;  3R9X A;  1XMQ C;  4DV1 C;  2ONF A;  3OTO C;  4NOZ A;  2E8F A;  1MKY A;  4BSZ A;  1VLA A;  3J80 D;  1HNX C;  1UKK A;  4LF9 C;  1N32 C;  3T1H C;  3J7A D;  2F4V C;  4LFB C;  4AQY C;  2UUC C;  4B3T C;  2OPL B;  4LF4 C;  1I94 C;  1NYE A;  3CJE A;  2ZM6 C;  2XR1 A;  1QWI A;  4LFC C;  1N33 C;  4JI2 C;  5IT9 D;  4LF6 C;  5BR8 C;  2D7V A;  4LF7 C;  2UXB C;  1N2F A;  4NXM C;  2DYJ A;  4DCT A;  4DR5 C;  4DR4 C;  3I07 A;  2E5L C;  4LF8 C;  2QL8 A;  2VQF C;  1USP B;  4DV3 C;  2CXC A;  1WF3 A;  2BJO A;  4JI3 C;  4DV4 C;  4DR3 C;  1JOS A;  2OPL A;  3T1Y C;  4DR1 C;  2UUA C;  1LQL A;  4MTN A;  3AF5 A;  4X62 C;  5IWA C;  3JAM D;  1XNQ C;  4B3S C;  1IBK C;  1N36 C;  4MH4 A;  4DV7 C;  2E8C A;  1EGA A;  2KZF A;  3LUS A;  4JI7 C;  4DV5 C;  2JMP A;  1XMO C;  4OX9 C;  2UXC C;  1WH9 A;  2UU9 C;  4JI1 C;  1USP A;  1FJG C;  1ZB8 A;  4X65 C;  4DV6 C;  1PA4 A;  1N34 C;  2ATW A;  1K0R A;  2PT7 G;  1HNW C;  4X66 C;  2VQE C;  4JI4 C;  1IBM C;  4LFA C;  4NXN C;  4DUY C;  2PN2 A;  3AF6 A;  3J81 D;  2UXD C;  1L2F A;  4KHP C;  3R9W A;  2YCB A;  2UUB C;  4B3M C;  1ZB9 A;  4JYA C;  3EER A;  1HH2 P;  4JI6 C;  1ML8 A; 
#chains in the Genus database with same CATH topology
 1M6X C;  2NCL A;  1O90 A;  4G1I A;  4YY3 C;  3N2Q A;  1LCI A;  4DV2 C;  4RMN A;  1NY8 A;  3RV2 A;  4DG8 A;  3IEV A;  5BUR A;  3A25 A;  1FLO A;  1HNZ C;  4JV5 C;  1MDB A;  2VZE A;  3EQ6 A;  2E8E A;  2YWB A;  2ONF A;  2QVY X;  3KXW A;  3OTO C;  1WCJ A;  1TH5 A;  2D28 C;  2E8F A;  1PU1 A;  1MXC A;  1XS3 A;  4LF9 C;  1N32 C;  3FCE A;  4WS9 A;  5ADZ A;  4G36 A;  1V60 A;  4PHT A;  4LF4 C;  1O93 A;  1AMU A;  2ZM6 C;  4JI2 C;  3L8C A;  5DV9 A;  5BR8 C;  2D7V A;  1P4E C;  2UXB C;  2P2M A;  1N2F A;  4NXM C;  3CW9 A;  4DR5 C;  3I07 A;  2ZZM A;  2D1Q A;  3K6R A;  1XRA A;  4KTT A;  1PG3 A;  4PUI A;  2VQF C;  1USP B;  5T8S A;  1WF3 A;  2BJO A;  4RVO A;  3AF5 A;  2PRO A;  1XNQ C;  3VNQ A;  1YGT A;  3GR0 A;  3UOW A;  3LUS A;  2Y27 A;  3CQ3 A;  1YJ7 A;  1XMO C;  4OYC A;  4FUQ A;  3B7W A;  1USP A;  4X65 C;  4DG9 A;  3DLP X;  4JI4 C;  5JRH A;  4EAT A;  5K85 A;  2UXD C;  2M5H A;  4KHP C;  2OO4 A;  1ZB9 A;  3NYQ A;  3EER A;  4OXI A;  4DCV A;  1UWD A;  2OBV A;  4DV0 C;  2CY1 A;  5KYT A;  4DR6 C;  1KKG A;  4DUZ C;  2ZZN A;  2CU6 A;  4JI8 C;  3H2T A;  2ZTB A;  3PBK A;  3IML A;  5BST A;  2WP0 C;  2EGT A;  5AE3 A;  4LE5 A;  4PUH A;  5BSM A;  4GKK C;  4JI0 C;  5IFI A;  1XMQ C;  1V26 A;  2MCQ A;  1MKY A;  3J80 D;  1HNX C;  5KEI A;  2P20 A;  3T1H C;  1M6X A;  2F4V C;  4LFB C;  2QVZ X;  2OPL B;  4GS5 A;  5BSW A;  2P2F A;  3CJE A;  4HPV A;  2XR1 A;  1QWI A;  1N33 C;  3ETO A;  4PRO C;  1XDX A;  4L4Q A;  2JNV A;  3A4I A;  3A26 A;  3E7W A;  4R1M A;  3FM7 A;  1XHJ A;  3TUF A;  4ODJ A;  2DHM A;  4D4I A;  2QW0 X;  4KTV A;  4NDN A;  4DV3 C;  1P7L A;  1JOS A;  2D1R A;  2OPL A;  5A1I A;  2UUA C;  2P02 A;  1O92 A;  4D56 A;  5BSR A;  1BA3 A;  5E7Q A;  2YX1 A;  4MH4 A;  4DV7 C;  1EGA A;  4PUG A;  4IZ6 A;  2PG1 E;  4L2Z A;  4JI7 C;  3NYR A;  4FUT A;  2JMP A;  4D4G A;  1FJG C;  1ZB8 A;  5LCI A;  1PG4 A;  2PT7 G;  1HNW C;  2M5O A;  1QM4 A;  3AY0 A;  3LNV A;  4FTF A;  1IBM C;  3C5E A;  4NXN C;  3AF6 A;  3J81 D;  4G37 A;  5CZX A;  3R9W A;  1HH2 P;  5BSU A;  4I9G A;  4DCS A;  4X64 C;  2E7G A;  3FCC A;  3A9V A;  5LMU C;  3L95 X;  4RVN A;  1IBL C;  4YHH C;  2HHH C;  1HR0 C;  4GKJ C;  4GXR A;  4LF5 C;  5A2Q D;  5LMN C;  4XX2 A;  4B3R C;  1IB8 A;  4TPS B;  4I9F A;  2WD9 A;  4BC9 A;  2HJG A;  3IEU A;  3RG2 A;  1XNR C;  3DAY A;  3R9X A;  1ULT A;  2V7B A;  4D57 A;  2E0G A;  5A19 A;  3LAX A;  4NOZ A;  4BSZ A;  2KZ0 A;  3G7S A;  1GPM A;  5BSV A;  4GXQ A;  3J7A D;  4ZLP A;  2VSQ A;  2UUC C;  4B3T C;  1I94 C;  3GPC A;  5IT9 D;  2Z51 A;  4LF6 C;  2Y4N A;  4LF7 C;  3UZ0 A;  4DR4 C;  2E5L C;  4R0M A;  4WV3 A;  1XRC A;  5AE2 A;  4K0B A;  3E7X A;  4DV4 C;  4JI3 C;  5A1G A;  4DR1 C;  3PES A;  1LQL A;  4R1L A;  1VEH A;  3TQI A;  5IWA C;  1IBK C;  2BH1 X;  2KZF A;  3UX3 A;  1MDF A;  4DV5 C;  3LGX A;  4JI1 C;  5T8T A;  3NI2 A;  4JM1 A;  1K0R A;  2ATW A;  4X66 C;  4RLF A;  4RM3 A;  2MMA B;  4LFA C;  5BUS A;  4BC7 A;  2AYA A;  1L2F A;  2P2J A;  1O9T A;  1T5D X;  2YCB A;  4JYA C;  4B3M C;  5CZV A;  4IR7 A;  3S82 A;  1V25 A;  1J5E C;  3IPL A;  1P4E A;  2DPL A;  4DR2 C;  4JI5 C;  4L7I A;  4K0K C;  3VNR A;  3NPD A;  4DR7 C;  5K8F A;  2ASB A;  1T5H X;  4PZP A;  3CQ2 A;  3GKU A;  3SO4 A;  5FLX D;  5BUQ A;  4DCU A;  1RY2 A;  2KDN A;  4DV1 C;  2MM9 A;  2D27 A;  3I08 A;  1VLA A;  2YWC A;  1UKK A;  3CQ1 A;  3PRO C;  2D1S A;  3UX2 A;  4AQY C;  1NYE A;  4ZJZ A;  4LFC C;  2DYJ A;  2D1T A;  4DCT A;  4RM2 A;  5GTD A;  4LF8 C;  2QL8 A;  2Y4O A;  2CXC A;  4DR3 C;  3T1Y C;  1MXB A;  4MTN A;  4X62 C;  3N54 B;  3JAM D;  3R44 A;  4B3S C;  4BBY A;  3TDE A;  1FUG A;  3VNS A;  1N36 C;  2E8C A;  3ETC A;  5AE1 A;  4U5Y D;  2P2Q A;  2UXC C;  4OX9 C;  1WH9 A;  3TR3 A;  2UU9 C;  4BCA A;  4DV6 C;  3UEB A;  1PA4 A;  3CW8 X;  1N34 C;  1MD9 A;  2VQE C;  1XRB A;  3O2E A;  5H9U A;  4ISB A;  4DUY C;  2PN2 A;  3GR1 A;  3A9U A;  1MXA A;  2QVX X;  3LNO A;  4RLQ A;  2P2B A;  2UUB C;  3DHV A;  1RG9 A;  5KYV A;  4JI6 C;  1ML8 A; 
#chains in the Genus database with same CATH homology
 1O90 A;  4G1I A;  4YY3 C;  3N2Q A;  1LCI A;  4DV2 C;  4RMN A;  3RV2 A;  4DG8 A;  3IEV A;  5BUR A;  1HNZ C;  4JV5 C;  1MDB A;  2VZE A;  3EQ6 A;  2E8E A;  2YWB A;  2ONF A;  2QVY X;  3KXW A;  3OTO C;  2D28 C;  2E8F A;  1MXC A;  4LF9 C;  1N32 C;  3FCE A;  4WS9 A;  5ADZ A;  4G36 A;  4PHT A;  4LF4 C;  1O93 A;  1AMU A;  2ZM6 C;  4JI2 C;  3L8C A;  5DV9 A;  5BR8 C;  2D7V A;  2UXB C;  2P2M A;  1N2F A;  4NXM C;  3CW9 A;  4DR5 C;  3I07 A;  2D1Q A;  1XRA A;  4KTT A;  1PG3 A;  2VQF C;  1USP B;  5T8S A;  1WF3 A;  2BJO A;  4RVO A;  3AF5 A;  2PRO A;  1XNQ C;  3VNQ A;  3GR0 A;  3UOW A;  3LUS A;  2Y27 A;  1YJ7 A;  1XMO C;  4OYC A;  4FUQ A;  3B7W A;  1USP A;  4X65 C;  4DG9 A;  3DLP X;  4JI4 C;  5JRH A;  4EAT A;  5K85 A;  2UXD C;  4KHP C;  2OO4 A;  1ZB9 A;  3NYQ A;  3EER A;  4OXI A;  4DCV A;  2OBV A;  4DV0 C;  2CY1 A;  5KYT A;  4DR6 C;  1KKG A;  4DUZ C;  4JI8 C;  3H2T A;  3PBK A;  3IML A;  5BST A;  2WP0 C;  2EGT A;  5AE3 A;  4LE5 A;  5BSM A;  4GKK C;  4JI0 C;  5IFI A;  1XMQ C;  1V26 A;  1MKY A;  3J80 D;  1HNX C;  5KEI A;  2P20 A;  3T1H C;  2F4V C;  4LFB C;  2QVZ X;  2OPL B;  4GS5 A;  5BSW A;  2P2F A;  3CJE A;  4HPV A;  2XR1 A;  1QWI A;  1N33 C;  3ETO A;  4PRO C;  4L4Q A;  3A4I A;  4R1M A;  3E7W A;  3TUF A;  4ODJ A;  4D4I A;  2QW0 X;  4KTV A;  4NDN A;  4DV3 C;  1P7L A;  1JOS A;  2D1R A;  2OPL A;  5A1I A;  2UUA C;  2P02 A;  1O92 A;  4D56 A;  5BSR A;  1BA3 A;  5E7Q A;  4MH4 A;  4DV7 C;  1EGA A;  4IZ6 A;  4L2Z A;  4JI7 C;  3NYR A;  4FUT A;  2JMP A;  4D4G A;  1FJG C;  1ZB8 A;  1PG4 A;  2PT7 G;  1HNW C;  1QM4 A;  3LNV A;  4FTF A;  1IBM C;  3C5E A;  4NXN C;  3AF6 A;  3J81 D;  4G37 A;  5CZX A;  3R9W A;  1HH2 P;  5BSU A;  4I9G A;  4DCS A;  4X64 C;  2E7G A;  3FCC A;  3A9V A;  5LMU C;  3L95 X;  4RVN A;  1IBL C;  4YHH C;  2HHH C;  1HR0 C;  4GKJ C;  4GXR A;  4LF5 C;  5A2Q D;  5LMN C;  4XX2 A;  4B3R C;  4TPS B;  4I9F A;  2WD9 A;  4BC9 A;  2HJG A;  3IEU A;  3RG2 A;  1XNR C;  3DAY A;  3R9X A;  1ULT A;  2V7B A;  4D57 A;  2E0G A;  5A19 A;  3LAX A;  4NOZ A;  4BSZ A;  3G7S A;  1GPM A;  5BSV A;  4GXQ A;  3J7A D;  4ZLP A;  2VSQ A;  2UUC C;  4B3T C;  1I94 C;  3GPC A;  5IT9 D;  4LF6 C;  2Y4N A;  4LF7 C;  3UZ0 A;  4DR4 C;  2E5L C;  4R0M A;  4WV3 A;  1XRC A;  5AE2 A;  4K0B A;  3E7X A;  4DV4 C;  4JI3 C;  5A1G A;  4DR1 C;  3PES A;  1LQL A;  4R1L A;  3TQI A;  5IWA C;  1IBK C;  2BH1 X;  2KZF A;  1MDF A;  4DV5 C;  3LGX A;  4JI1 C;  5T8T A;  3NI2 A;  4JM1 A;  1K0R A;  2ATW A;  4X66 C;  4RLF A;  4RM3 A;  4LFA C;  5BUS A;  4BC7 A;  2AYA A;  1L2F A;  2P2J A;  1O9T A;  1T5D X;  2YCB A;  4JYA C;  4B3M C;  5CZV A;  4IR7 A;  3S82 A;  1V25 A;  1J5E C;  3IPL A;  2DPL A;  4DR2 C;  4JI5 C;  4L7I A;  4K0K C;  3VNR A;  3NPD A;  4DR7 C;  5K8F A;  2ASB A;  1T5H X;  4PZP A;  3GKU A;  3SO4 A;  5FLX D;  5BUQ A;  4DCU A;  1RY2 A;  4DV1 C;  2D27 A;  3I08 A;  1VLA A;  2YWC A;  1UKK A;  3PRO C;  2D1S A;  4AQY C;  1NYE A;  4ZJZ A;  4LFC C;  2DYJ A;  2D1T A;  4DCT A;  4RM2 A;  5GTD A;  4LF8 C;  2QL8 A;  2Y4O A;  2CXC A;  4DR3 C;  3T1Y C;  1MXB A;  4MTN A;  4X62 C;  3N54 B;  3JAM D;  3R44 A;  4B3S C;  4BBY A;  3TDE A;  1FUG A;  3VNS A;  1N36 C;  2E8C A;  3ETC A;  5AE1 A;  4U5Y D;  2P2Q A;  2UXC C;  4OX9 C;  1WH9 A;  2UU9 C;  4BCA A;  4DV6 C;  1PA4 A;  3CW8 X;  1N34 C;  1MD9 A;  2VQE C;  1XRB A;  5H9U A;  4ISB A;  4DUY C;  2PN2 A;  3GR1 A;  3A9U A;  1MXA A;  2QVX X;  4RLQ A;  2P2B A;  2UUB C;  3DHV A;  1RG9 A;  5KYV A;  4JI6 C;  1ML8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...