4X62C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4x62C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4x62C02
4DV1C 2HHHC 1HNXC 2ONFA 2E8EA 2CXCA 1IBMC 1ZB9A 4DV3C 4DR3C 2ZM6C 4JI1C 4OX9C 1UKKA 3IEVA 4X64C 1MKYA 5LMNC 1EGAA 2OPLB 2UUCC 4LF5C 4DR4C 4B3TC 1N32C 1K0RA 4NXNC 1USPB 5A2QD 4JYAC 1WF3A 1QWIA 2PT7G 1HNWC 4LFAC 2OPLA 5IWAC 4LF6C 1HNZC 2UXBC 1IBLC 4LF4C 3GKUA 1WH9A 2E8FA 4DR5C 4LF8C 4DV4C 2DYJA 4X62C 4B3SC 3EERA 4JI5C 4DUZC 1JOSA 2E8CA 3LUSA 1FJGC 4X66C 4JV5C 3J81D 4BSZA 4DR1C 3R9XA 2YCBA 2UU9C 4K0KC 2UXCC 4B3MC 5BR8C 4B3RC 4LFCC 2BJOA 2HJGA 4DV7C 2E5LC 1N33C 4YY3C 1IBKC 1ML8A 4JI4C 3CJEA 1L2FA 2ATWA 1ZB8A 1I94C 4DV5C 4DR2C 4JI6C 1XMQC 4MH4A 3OTOC 4LF9C 1HH2P 1USPA 4AQYC 2VQEC 1HR0C 3IEUA 2JMPA 4NXMC 3J7AD 2UUBC 4DCSA 4JI0C 3T1HC 4NOZA 2F4VC 2UXDC 4DCTA 3JAMD 4JI2C 5LMUC 1J5EC 3R9WA 2CY1A 1XMOC 1VLAA 2XR1A 2VQFC 1N2FA 4MTNA 5FLXD 4DV6C 4YHHC 2QL8A 4DR6C 1LQLA 4GKKC 2E7GA 4JI3C 4DCUA 1KKGA 4X65C 3I07A 4DUYC 4JI8C 1XNQC 3AF5A 1PA4A 4DV0C 1N34C 2EGTA 4LFBC 3J80D 2KZFA 1NYEA 2ASBA 4DR7C 4DCVA 5IT9D 1N36C 4JI7C 2PN2A 4DV2C 4XX2A 3AF6A 3T1YC 1XNRC 4GKJC 4LF7C 4KHPC 2UUAC 2D7VA
chains in the Genus database with same CATH superfamily
2Y4OA 1HNXC 2E8EA 2CXCA 4BC9A 4I9GA 1ZB9A 4DR3C 4FTFA 5LMNC 1PU1A 4LF5C 3TR3A 4B3TC 2YWBA 1P4EA 1USPB 2DPLA 4JYAC 2WD9A 1GPMA 2P02A 2OPLA 3TQIA 5BSWA 1IBLC 3GKUA 1WH9A 2E8FA 4DR5C 2MMAB 4LF8C 3A9UA 2E0GA 4KTTA 3H2TA 2VSQA 1XS3A 1AMUA 3R9XA 2UU9C 4K0KC 2P2MA 1O92A 3N2QA 5KEIA 4ISBA 4LFCC 2HJGA 3GR0A 3LNVA 1ML8A 3NPDA 5CZVA 3DHVA 4IZ6A 4U5YD 2D28C 4HPVA 3FM7A 2KDNA 4MH4A 1HH2P 5AE2A 4D4IA 4TPSB 5LCIA 3J7AD 2UUBC 1MDFA 4DCSA 3K6RA 3T1HC 1V25A 3KXWA 2F4VC 4GXRA 3SO4A 4JI2C 4GS5A 2MM9A 1XMOC 3N54B 1VLAA 2QVZX 3GR1A 1N2FA 1UWDA 4RLQA 2D1QA 1PG4A 4GKKC 2D1SA 4RVNA 4DUYC 4JI8C 1XNQC 1PA4A 4DV0C 4ZJZA 4PZPA 4PROC 2ZZMA 2ZZNA 4DR7C 4DCVA 5IT9D 2OO4A 4LE5A 1XHJA 4ZLPA 2ONFA 1FUGA 1WCJA 3LGXA 3C5EA 2MCQA 4JM1A 1IBMC 2P2BA 4G36A 4L2ZA 1QM4A 1XRCA 2Y27A 4D57A 4JI1C 2UUCC 4IR7A 1N32C 3G7SA 3RG2A 5A2QD 3A26A 1WF3A 1HNWC 4KTVA 1VEHA 4ODJA 3PROC 4LF6C 3UX3A 2QW0X 2QVXX 1FLOA 4RMNA 4JI5C 2E8CA 1FJGC 4X66C 1YGTA 1RG9A 4WS9A 4EATA 5KYVA 2JNVA 4B3RC 2BJOA 4DV7C 2E5LC 1N33C 4FUTA 1BA3A 2ATWA 3S82A 1ZB8A 1NY8A 4R0MA 4DV5C 4DR2C 4PUGA 3OTOC 4LF9C 1HR0C 2P2FA 3IEUA 2JMPA 4NXMC 3DLPX 1P4EC 4JI0C 2ZTBA 3FCEA 2BH1X 5BSVA 2CY1A 2AYAA 4DV6C 4I9FA 5AE3A 3FCCA 1XRAA 4JI3C 3TDEA 4DCUA 4PUIA 5BSRA 3UX2A 5H9UA 4LFBC 3J80D 2P2JA 1NYEA 3IMLA 2ASBA 4BC7A 1N36C 1XRBA 4JI7C 4DV2C 3B7WA 4GKJC 2YWCA 2HHHC 2M5HA 5A1IA 4BCAA 2PG1E 3NI2A 4DV3C 4NDNA 2ZM6C 4G37A 3EQ6A 1P7LA 1UKKA 3IEVA 4X64C 1EGAA 2OPLB 5ADZA 4NXNC 4PUHA 1YJ7A 3AY0A 3DAYA 5E7QA 1QWIA 5DV9A 2PT7G 1M6XA 4LFAC 1HNZC 3GPCA 3LNOA 2UXBC 4LF4C 1RY2A 1TH5A 2DYJA 4X62C 3EERA 4DUZC 1JOSA 1MXBA 3E7WA 4BSZA 4DR1C 4R1MA 2UXCC 4B3MC 2P2QA 4RVOA 5GTDA 3CW8X 3CW9A 1XDXA 4YY3C 4JI4C 1O93A 5T8TA 3CJEA 1I94C 4D56A 3PESA 2PROA 2OBVA 4AQYC 3UEBA 5K8FA 2UXDC 1LCIA 1V60A 4DG9A 2P20A 3ETCA 3R9WA 2D1RA 5KYTA 2VQFC 4MTNA 4DR6C 2QL8A 1LQLA 5CZXA 2E7GA 3NYQA 3VNQA 3AF5A 2D1TA 1T5HX 3LAXA 5BUSA 5AE1A 1O9TA 5JRHA 2PN2A 1T5DX 4RM3A 5A1GA 2QVYX 3T1YC 1XNRC 4LF7C 1ULTA 4KHPC 1MXAA 2Y4NA 2M5OA 4DV1C 4BBYA 4WV3A 3CQ2A 4OXIA 2NCLA 3UZ0A 4OX9C 1MKYA 4RM2A 3IPLA 3I08A 4DR4C 3RV2A 2D27A 1K0RA 1V26A 3E7XA 5K85A 3UOWA 5IWAC 4RLFA 3PBKA 3ETOA 4PHTA 4DV4C 3TUFA 4OYCA 2V7BA 4B3SC 4G1IA 4L4QA 3LUSA 1PG3A 4JV5C 3J81D 2YCBA 2DHMA 3CQ3A 5BR8C 2YX1A 3NYRA 1IB8A 4L7IA 4DG8A 1IBKC 2CU6A 1L2FA 3VNRA 3L95X 5IFIA 3R44A 4JI6C 1XMQC 5BUQA 2KZ0A 1USPA 4GXQA 4D4GA 2VQEC 3A25A 5A19A 2Z51A 1O90A 3A4IA 1MDBA 4NOZA 4DCTA 3JAMD 2WP0C 3A9VA 1M6XC 3L8CA 5BSMA 5LMUC 1J5EC 3CQ1A 5BSTA 2XR1A 5FLXD 4YHHC 3O2EA 2VZEA 5T8SA 1KKGA 4X65C 3I07A 1MXCA 5BSUA 1N34C 3VNSA 2EGTA 5BURA 4K0BA 1MD9A 2KZFA 4R1LA 4XX2A 3AF6A 4FUQA 2UUAC 2D7VA
chains in the Genus database with same CATH topology
2Y4OA 1HNXC 2E8EA 2CXCA 4BC9A 4I9GA 1ZB9A 4DR3C 4FTFA 5LMNC 4LF5C 4B3TC 2YWBA 1USPB 2DPLA 4JYAC 2WD9A 1GPMA 2P02A 2OPLA 3TQIA 5BSWA 1IBLC 3GKUA 1WH9A 2E8FA 4DR5C 4LF8C 3A9UA 2E0GA 4KTTA 3H2TA 2VSQA 1AMUA 3R9XA 2UU9C 4K0KC 2P2MA 1O92A 3N2QA 5KEIA 4ISBA 4LFCC 2HJGA 3GR0A 3LNVA 1ML8A 3NPDA 5CZVA 3DHVA 4IZ6A 4U5YD 2D28C 4HPVA 4MH4A 1HH2P 5AE2A 4D4IA 4TPSB 3J7AD 2UUBC 1MDFA 4DCSA 3T1HC 1V25A 3KXWA 2F4VC 4GXRA 3SO4A 4JI2C 4GS5A 1XMOC 3N54B 1VLAA 2QVZX 3GR1A 1N2FA 4RLQA 2D1QA 1PG4A 4GKKC 2D1SA 4RVNA 4DUYC 4JI8C 1XNQC 1PA4A 4DV0C 4ZJZA 4PZPA 4PROC 4DR7C 4DCVA 5IT9D 2OO4A 4LE5A 4ZLPA 2ONFA 1FUGA 3LGXA 3C5EA 4JM1A 1IBMC 2P2BA 4G36A 4L2ZA 1QM4A 1XRCA 2Y27A 4D57A 4JI1C 2UUCC 4IR7A 1N32C 3G7SA 3RG2A 5A2QD 1WF3A 1HNWC 4KTVA 4ODJA 3PROC 4LF6C 2QW0X 2QVXX 4RMNA 4JI5C 2E8CA 1FJGC 4X66C 1RG9A 4WS9A 4EATA 5KYVA 4B3RC 2BJOA 4DV7C 2E5LC 1N33C 4FUTA 1BA3A 2ATWA 3S82A 1ZB8A 4R0MA 4DV5C 4DR2C 3OTOC 4LF9C 1HR0C 2P2FA 3IEUA 2JMPA 4NXMC 3DLPX 4JI0C 3FCEA 2BH1X 5BSVA 2CY1A 2AYAA 4DV6C 4I9FA 5AE3A 3FCCA 1XRAA 4JI3C 3TDEA 4DCUA 5BSRA 5H9UA 4LFBC 3J80D 2P2JA 1NYEA 3IMLA 2ASBA 4BC7A 1N36C 1XRBA 4JI7C 4DV2C 3B7WA 4GKJC 2YWCA 2HHHC 5A1IA 4BCAA 3NI2A 4DV3C 4NDNA 2ZM6C 4G37A 3EQ6A 1P7LA 1UKKA 3IEVA 4X64C 1EGAA 2OPLB 5ADZA 4NXNC 1YJ7A 3DAYA 5E7QA 1QWIA 5DV9A 2PT7G 4LFAC 1HNZC 3GPCA 2UXBC 4LF4C 1RY2A 2DYJA 4X62C 3EERA 4DUZC 1JOSA 1MXBA 3E7WA 4BSZA 4DR1C 4R1MA 2UXCC 4B3MC 2P2QA 4RVOA 5GTDA 3CW8X 3CW9A 4YY3C 4JI4C 1O93A 5T8TA 3CJEA 1I94C 4D56A 3PESA 2PROA 2OBVA 4AQYC 5K8FA 2UXDC 1LCIA 4DG9A 2P20A 3ETCA 3R9WA 2D1RA 5KYTA 2VQFC 4MTNA 4DR6C 2QL8A 1LQLA 5CZXA 2E7GA 3NYQA 3VNQA 3AF5A 2D1TA 1T5HX 3LAXA 5BUSA 5AE1A 1O9TA 5JRHA 2PN2A 1T5DX 4RM3A 3T1YC 2QVYX 5A1GA 1XNRC 4LF7C 1ULTA 4KHPC 1MXAA 2Y4NA 4DV1C 4BBYA 4WV3A 4OXIA 3UZ0A 4OX9C 1MKYA 4RM2A 3IPLA 3I08A 4DR4C 3RV2A 2D27A 1K0RA 1V26A 3E7XA 5K85A 3UOWA 5IWAC 4RLFA 3PBKA 3ETOA 4PHTA 4DV4C 3TUFA 4OYCA 2V7BA 4B3SC 4G1IA 4L4QA 3LUSA 1PG3A 4JV5C 3J81D 2YCBA 5BR8C 3NYRA 4L7IA 4DG8A 1IBKC 1L2FA 3VNRA 3L95X 5IFIA 3R44A 4JI6C 1XMQC 5BUQA 1USPA 4GXQA 4D4GA 2VQEC 5A19A 1O90A 3A4IA 1MDBA 4NOZA 4DCTA 3JAMD 2WP0C 3A9VA 3L8CA 5BSMA 5LMUC 1J5EC 5BSTA 2XR1A 5FLXD 4YHHC 2VZEA 5T8SA 1KKGA 4X65C 3I07A 1MXCA 5BSUA 1N34C 3VNSA 2EGTA 5BURA 4K0BA 1MD9A 2KZFA 4R1LA 4XX2A 3AF6A 4FUQA 2UUAC 2D7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 C;  2HHH C;  1HNX C;  2ONF A;  2E8E A;  2CXC A;  1IBM C;  1ZB9 A;  4DV3 C;  4DR3 C;  2ZM6 C;  4JI1 C;  4OX9 C;  1UKK A;  3IEV A;  4X64 C;  1MKY A;  5LMN C;  1EGA A;  2OPL B;  2UUC C;  4LF5 C;  4DR4 C;  4B3T C;  1N32 C;  1K0R A;  4NXN C;  1USP B;  5A2Q D;  4JYA C;  1WF3 A;  1QWI A;  2PT7 G;  1HNW C;  4LFA C;  2OPL A;  5IWA C;  4LF6 C;  1HNZ C;  2UXB C;  1IBL C;  4LF4 C;  3GKU A;  1WH9 A;  2E8F A;  4DR5 C;  4LF8 C;  4DV4 C;  2DYJ A;  4X62 C;  4B3S C;  3EER A;  4JI5 C;  4DUZ C;  1JOS A;  2E8C A;  3LUS A;  1FJG C;  4X66 C;  4JV5 C;  3J81 D;  4BSZ A;  4DR1 C;  3R9X A;  2YCB A;  2UU9 C;  4K0K C;  2UXC C;  4B3M C;  5BR8 C;  4B3R C;  4LFC C;  2BJO A;  2HJG A;  4DV7 C;  2E5L C;  1N33 C;  4YY3 C;  1IBK C;  1ML8 A;  4JI4 C;  3CJE A;  1L2F A;  2ATW A;  1ZB8 A;  1I94 C;  4DV5 C;  4DR2 C;  4JI6 C;  1XMQ C;  4MH4 A;  3OTO C;  4LF9 C;  1HH2 P;  1USP A;  4AQY C;  2VQE C;  1HR0 C;  3IEU A;  2JMP A;  4NXM C;  3J7A D;  2UUB C;  4DCS A;  4JI0 C;  3T1H C;  4NOZ A;  2F4V C;  2UXD C;  4DCT A;  3JAM D;  4JI2 C;  5LMU C;  1J5E C;  3R9W A;  2CY1 A;  1XMO C;  1VLA A;  2XR1 A;  2VQF C;  1N2F A;  4MTN A;  5FLX D;  4DV6 C;  4YHH C;  2QL8 A;  4DR6 C;  1LQL A;  4GKK C;  2E7G A;  4JI3 C;  4DCU A;  1KKG A;  4X65 C;  3I07 A;  4DUY C;  4JI8 C;  1XNQ C;  3AF5 A;  1PA4 A;  4DV0 C;  1N34 C;  2EGT A;  4LFB C;  3J80 D;  2KZF A;  1NYE A;  2ASB A;  4DR7 C;  4DCV A;  5IT9 D;  1N36 C;  4JI7 C;  2PN2 A;  4DV2 C;  4XX2 A;  3AF6 A;  3T1Y C;  1XNR C;  4GKJ C;  4LF7 C;  4KHP C;  2UUA C;  2D7V A; 
#chains in the Genus database with same CATH topology
 2Y4O A;  1HNX C;  2E8E A;  2CXC A;  4BC9 A;  4I9G A;  1ZB9 A;  4DR3 C;  4FTF A;  5LMN C;  1PU1 A;  4LF5 C;  3TR3 A;  4B3T C;  2YWB A;  1P4E A;  1USP B;  2DPL A;  4JYA C;  2WD9 A;  1GPM A;  2P02 A;  2OPL A;  3TQI A;  5BSW A;  1IBL C;  3GKU A;  1WH9 A;  2E8F A;  4DR5 C;  2MMA B;  4LF8 C;  3A9U A;  2E0G A;  4KTT A;  3H2T A;  2VSQ A;  1XS3 A;  1AMU A;  3R9X A;  2UU9 C;  4K0K C;  2P2M A;  1O92 A;  3N2Q A;  5KEI A;  4ISB A;  4LFC C;  2HJG A;  3GR0 A;  3LNV A;  1ML8 A;  3NPD A;  5CZV A;  3DHV A;  4IZ6 A;  4U5Y D;  2D28 C;  4HPV A;  3FM7 A;  2KDN A;  4MH4 A;  1HH2 P;  5AE2 A;  4D4I A;  4TPS B;  5LCI A;  3J7A D;  2UUB C;  1MDF A;  4DCS A;  3K6R A;  3T1H C;  1V25 A;  3KXW A;  2F4V C;  4GXR A;  3SO4 A;  4JI2 C;  4GS5 A;  2MM9 A;  1XMO C;  3N54 B;  1VLA A;  2QVZ X;  3GR1 A;  1N2F A;  1UWD A;  4RLQ A;  2D1Q A;  1PG4 A;  4GKK C;  2D1S A;  4RVN A;  4DUY C;  4JI8 C;  1XNQ C;  1PA4 A;  4DV0 C;  4ZJZ A;  4PZP A;  4PRO C;  2ZZM A;  2ZZN A;  4DR7 C;  4DCV A;  5IT9 D;  2OO4 A;  4LE5 A;  1XHJ A;  4ZLP A;  2ONF A;  1FUG A;  1WCJ A;  3LGX A;  3C5E A;  2MCQ A;  4JM1 A;  1IBM C;  2P2B A;  4G36 A;  4L2Z A;  1QM4 A;  1XRC A;  2Y27 A;  4D57 A;  4JI1 C;  2UUC C;  4IR7 A;  1N32 C;  3G7S A;  3RG2 A;  5A2Q D;  3A26 A;  1WF3 A;  1HNW C;  4KTV A;  1VEH A;  4ODJ A;  3PRO C;  4LF6 C;  3UX3 A;  2QW0 X;  2QVX X;  1FLO A;  4RMN A;  4JI5 C;  2E8C A;  1FJG C;  4X66 C;  1YGT A;  1RG9 A;  4WS9 A;  4EAT A;  5KYV A;  2JNV A;  4B3R C;  2BJO A;  4DV7 C;  2E5L C;  1N33 C;  4FUT A;  1BA3 A;  2ATW A;  3S82 A;  1ZB8 A;  1NY8 A;  4R0M A;  4DV5 C;  4DR2 C;  4PUG A;  3OTO C;  4LF9 C;  1HR0 C;  2P2F A;  3IEU A;  2JMP A;  4NXM C;  3DLP X;  1P4E C;  4JI0 C;  2ZTB A;  3FCE A;  2BH1 X;  5BSV A;  2CY1 A;  2AYA A;  4DV6 C;  4I9F A;  5AE3 A;  3FCC A;  1XRA A;  4JI3 C;  3TDE A;  4DCU A;  4PUI A;  5BSR A;  3UX2 A;  5H9U A;  4LFB C;  3J80 D;  2P2J A;  1NYE A;  3IML A;  2ASB A;  4BC7 A;  1N36 C;  1XRB A;  4JI7 C;  4DV2 C;  3B7W A;  4GKJ C;  2YWC A;  2HHH C;  2M5H A;  5A1I A;  4BCA A;  2PG1 E;  3NI2 A;  4DV3 C;  4NDN A;  2ZM6 C;  4G37 A;  3EQ6 A;  1P7L A;  1UKK A;  3IEV A;  4X64 C;  1EGA A;  2OPL B;  5ADZ A;  4NXN C;  4PUH A;  1YJ7 A;  3AY0 A;  3DAY A;  5E7Q A;  1QWI A;  5DV9 A;  2PT7 G;  1M6X A;  4LFA C;  1HNZ C;  3GPC A;  3LNO A;  2UXB C;  4LF4 C;  1RY2 A;  1TH5 A;  2DYJ A;  4X62 C;  3EER A;  4DUZ C;  1JOS A;  1MXB A;  3E7W A;  4BSZ A;  4DR1 C;  4R1M A;  2UXC C;  4B3M C;  2P2Q A;  4RVO A;  5GTD A;  3CW8 X;  3CW9 A;  1XDX A;  4YY3 C;  4JI4 C;  1O93 A;  5T8T A;  3CJE A;  1I94 C;  4D56 A;  3PES A;  2PRO A;  2OBV A;  4AQY C;  3UEB A;  5K8F A;  2UXD C;  1LCI A;  1V60 A;  4DG9 A;  2P20 A;  3ETC A;  3R9W A;  2D1R A;  5KYT A;  2VQF C;  4MTN A;  4DR6 C;  2QL8 A;  1LQL A;  5CZX A;  2E7G A;  3NYQ A;  3VNQ A;  3AF5 A;  2D1T A;  1T5H X;  3LAX A;  5BUS A;  5AE1 A;  1O9T A;  5JRH A;  2PN2 A;  1T5D X;  4RM3 A;  5A1G A;  2QVY X;  3T1Y C;  1XNR C;  4LF7 C;  1ULT A;  4KHP C;  1MXA A;  2Y4N A;  2M5O A;  4DV1 C;  4BBY A;  4WV3 A;  3CQ2 A;  4OXI A;  2NCL A;  3UZ0 A;  4OX9 C;  1MKY A;  4RM2 A;  3IPL A;  3I08 A;  4DR4 C;  3RV2 A;  2D27 A;  1K0R A;  1V26 A;  3E7X A;  5K85 A;  3UOW A;  5IWA C;  4RLF A;  3PBK A;  3ETO A;  4PHT A;  4DV4 C;  3TUF A;  4OYC A;  2V7B A;  4B3S C;  4G1I A;  4L4Q A;  3LUS A;  1PG3 A;  4JV5 C;  3J81 D;  2YCB A;  2DHM A;  3CQ3 A;  5BR8 C;  2YX1 A;  3NYR A;  1IB8 A;  4L7I A;  4DG8 A;  1IBK C;  2CU6 A;  1L2F A;  3VNR A;  3L95 X;  5IFI A;  3R44 A;  4JI6 C;  1XMQ C;  5BUQ A;  2KZ0 A;  1USP A;  4GXQ A;  4D4G A;  2VQE C;  3A25 A;  5A19 A;  2Z51 A;  1O90 A;  3A4I A;  1MDB A;  4NOZ A;  4DCT A;  3JAM D;  2WP0 C;  3A9V A;  1M6X C;  3L8C A;  5BSM A;  5LMU C;  1J5E C;  3CQ1 A;  5BST A;  2XR1 A;  5FLX D;  4YHH C;  3O2E A;  2VZE A;  5T8S A;  1KKG A;  4X65 C;  3I07 A;  1MXC A;  5BSU A;  1N34 C;  3VNS A;  2EGT A;  5BUR A;  4K0B A;  1MD9 A;  2KZF A;  4R1L A;  4XX2 A;  3AF6 A;  4FUQ A;  2UUA C;  2D7V A; 
#chains in the Genus database with same CATH homology
 2Y4O A;  1HNX C;  2E8E A;  2CXC A;  4BC9 A;  4I9G A;  1ZB9 A;  4DR3 C;  4FTF A;  5LMN C;  4LF5 C;  4B3T C;  2YWB A;  1USP B;  2DPL A;  4JYA C;  2WD9 A;  1GPM A;  2P02 A;  2OPL A;  3TQI A;  5BSW A;  1IBL C;  3GKU A;  1WH9 A;  2E8F A;  4DR5 C;  4LF8 C;  3A9U A;  2E0G A;  4KTT A;  3H2T A;  2VSQ A;  1AMU A;  3R9X A;  2UU9 C;  4K0K C;  2P2M A;  1O92 A;  3N2Q A;  5KEI A;  4ISB A;  4LFC C;  2HJG A;  3GR0 A;  3LNV A;  1ML8 A;  3NPD A;  5CZV A;  3DHV A;  4IZ6 A;  4U5Y D;  2D28 C;  4HPV A;  4MH4 A;  1HH2 P;  5AE2 A;  4D4I A;  4TPS B;  3J7A D;  2UUB C;  1MDF A;  4DCS A;  3T1H C;  1V25 A;  3KXW A;  2F4V C;  4GXR A;  3SO4 A;  4JI2 C;  4GS5 A;  1XMO C;  3N54 B;  1VLA A;  2QVZ X;  3GR1 A;  1N2F A;  4RLQ A;  2D1Q A;  1PG4 A;  4GKK C;  2D1S A;  4RVN A;  4DUY C;  4JI8 C;  1XNQ C;  1PA4 A;  4DV0 C;  4ZJZ A;  4PZP A;  4PRO C;  4DR7 C;  4DCV A;  5IT9 D;  2OO4 A;  4LE5 A;  4ZLP A;  2ONF A;  1FUG A;  3LGX A;  3C5E A;  4JM1 A;  1IBM C;  2P2B A;  4G36 A;  4L2Z A;  1QM4 A;  1XRC A;  2Y27 A;  4D57 A;  4JI1 C;  2UUC C;  4IR7 A;  1N32 C;  3G7S A;  3RG2 A;  5A2Q D;  1WF3 A;  1HNW C;  4KTV A;  4ODJ A;  3PRO C;  4LF6 C;  2QW0 X;  2QVX X;  4RMN A;  4JI5 C;  2E8C A;  1FJG C;  4X66 C;  1RG9 A;  4WS9 A;  4EAT A;  5KYV A;  4B3R C;  2BJO A;  4DV7 C;  2E5L C;  1N33 C;  4FUT A;  1BA3 A;  2ATW A;  3S82 A;  1ZB8 A;  4R0M A;  4DV5 C;  4DR2 C;  3OTO C;  4LF9 C;  1HR0 C;  2P2F A;  3IEU A;  2JMP A;  4NXM C;  3DLP X;  4JI0 C;  3FCE A;  2BH1 X;  5BSV A;  2CY1 A;  2AYA A;  4DV6 C;  4I9F A;  5AE3 A;  3FCC A;  1XRA A;  4JI3 C;  3TDE A;  4DCU A;  5BSR A;  5H9U A;  4LFB C;  3J80 D;  2P2J A;  1NYE A;  3IML A;  2ASB A;  4BC7 A;  1N36 C;  1XRB A;  4JI7 C;  4DV2 C;  3B7W A;  4GKJ C;  2YWC A;  2HHH C;  5A1I A;  4BCA A;  3NI2 A;  4DV3 C;  4NDN A;  2ZM6 C;  4G37 A;  3EQ6 A;  1P7L A;  1UKK A;  3IEV A;  4X64 C;  1EGA A;  2OPL B;  5ADZ A;  4NXN C;  1YJ7 A;  3DAY A;  5E7Q A;  1QWI A;  5DV9 A;  2PT7 G;  4LFA C;  1HNZ C;  3GPC A;  2UXB C;  4LF4 C;  1RY2 A;  2DYJ A;  4X62 C;  3EER A;  4DUZ C;  1JOS A;  1MXB A;  3E7W A;  4BSZ A;  4DR1 C;  4R1M A;  2UXC C;  4B3M C;  2P2Q A;  4RVO A;  5GTD A;  3CW8 X;  3CW9 A;  4YY3 C;  4JI4 C;  1O93 A;  5T8T A;  3CJE A;  1I94 C;  4D56 A;  3PES A;  2PRO A;  2OBV A;  4AQY C;  5K8F A;  2UXD C;  1LCI A;  4DG9 A;  2P20 A;  3ETC A;  3R9W A;  2D1R A;  5KYT A;  2VQF C;  4MTN A;  4DR6 C;  2QL8 A;  1LQL A;  5CZX A;  2E7G A;  3NYQ A;  3VNQ A;  3AF5 A;  2D1T A;  1T5H X;  3LAX A;  5BUS A;  5AE1 A;  1O9T A;  5JRH A;  2PN2 A;  1T5D X;  4RM3 A;  3T1Y C;  2QVY X;  5A1G A;  1XNR C;  4LF7 C;  1ULT A;  4KHP C;  1MXA A;  2Y4N A;  4DV1 C;  4BBY A;  4WV3 A;  4OXI A;  3UZ0 A;  4OX9 C;  1MKY A;  4RM2 A;  3IPL A;  3I08 A;  4DR4 C;  3RV2 A;  2D27 A;  1K0R A;  1V26 A;  3E7X A;  5K85 A;  3UOW A;  5IWA C;  4RLF A;  3PBK A;  3ETO A;  4PHT A;  4DV4 C;  3TUF A;  4OYC A;  2V7B A;  4B3S C;  4G1I A;  4L4Q A;  3LUS A;  1PG3 A;  4JV5 C;  3J81 D;  2YCB A;  5BR8 C;  3NYR A;  4L7I A;  4DG8 A;  1IBK C;  1L2F A;  3VNR A;  3L95 X;  5IFI A;  3R44 A;  4JI6 C;  1XMQ C;  5BUQ A;  1USP A;  4GXQ A;  4D4G A;  2VQE C;  5A19 A;  1O90 A;  3A4I A;  1MDB A;  4NOZ A;  4DCT A;  3JAM D;  2WP0 C;  3A9V A;  3L8C A;  5BSM A;  5LMU C;  1J5E C;  5BST A;  2XR1 A;  5FLX D;  4YHH C;  2VZE A;  5T8S A;  1KKG A;  4X65 C;  3I07 A;  1MXC A;  5BSU A;  1N34 C;  3VNS A;  2EGT A;  5BUR A;  4K0B A;  1MD9 A;  2KZF A;  4R1L A;  4XX2 A;  3AF6 A;  4FUQ A;  2UUA C;  2D7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...