4X62C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4x62C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4x62C02
3T1HC 2UXDC 1ZB8A 1XMQC 4LFCC 4AQYC 2OPLB 2ASBA 2UUCC 4X62C 4DV3C 4BSZA 1NYEA 1IBKC 4JI5C 4NOZA 1XNRC 1J5EC 3LUSA 4DV1C 4DUZC 4JI6C 1IBMC 1XMOC 3EERA 4MTNA 2OPLA 4LF9C 1WH9A 3J7AD 2DYJA 1ML8A 4DR4C 1I94C 4JI8C 5FLXD 2VQFC 5LMUC 4JV5C 3OTOC 2YCBA 1HNXC 4X64C 4B3TC 2ATWA 3AF6A 4K0KC 3T1YC 1QWIA 1N36C 4DR6C 2E8EA 2BJOA 4DV2C 1WF3A 1N34C 3R9WA 5IWAC 1KKGA 4JI2C 1JOSA 2E8FA 4JI0C 1XNQC 1HR0C 4X65C 2CXCA 2UUAC 5IT9D 1ZB9A 2ONFA 2E8CA 4JYAC 4DV5C 4DR1C 2XR1A 4DR2C 3JAMD 4DV0C 4DR5C 1HNZC 4DV4C 3IEUA 4DR7C 4LF8C 4X66C 2VQEC 2JMPA 2UUBC 5BR8C 3IEVA 1FJGC 1HH2P 2PN2A 4XX2A 2E5LC 2HJGA 2QL8A 2E7GA 1IBLC 2HHHC 2KZFA 2UXCC 1N32C 1PA4A 4JI7C 1EGAA 4LF7C 3J81D 4NXNC 4YHHC 1USPB 4MH4A 4OX9C 4DCVA 3J80D 1VLAA 4GKKC 2PT7G 2ZM6C 3AF5A 4DCSA 5A2QD 2EGTA 1MKYA 4DV7C 2F4VC 5LMNC 1K0RA 4GKJC 4NXMC 1L2FA 1USPA 4DV6C 4LFBC 4JI1C 4DUYC 1HNWC 4YY3C 4B3MC 3CJEA 4B3RC 4KHPC 1N33C 4LF4C 3R9XA 1LQLA 3GKUA 4LF6C 2D7VA 2CY1A 4DCUA 4DR3C 4JI3C 3I07A 1N2FA 4B3SC 2UU9C 4LFAC 1UKKA 4DCTA 4LF5C 4JI4C 2UXBC
chains in the Genus database with same CATH superfamily
2UXDC 3B7WA 1XMQC 4OXIA 5BUQA 4U5YD 4DV3C 4BSZA 2NCLA 1IBKC 3UX2A 4D4GA 5BURA 1P4EA 4LF9C 4RVNA 2DYJA 1MXAA 2P2QA 3A9VA 5AE2A 2Y4NA 5BSRA 2OO4A 4B3TC 3AF6A 4OYCA 1N36C 2P20A 4ZLPA 4RM3A 1JOSA 3VNSA 2ZTBA 1FUGA 4GXQA 4DG9A 3LNVA 4G37A 5KEIA 1BA3A 2XR1A 4BBYA 4DV0C 3PROC 5BUSA 1V26A 4L7IA 2WP0C 4DV4C 1XRCA 4WS9A 2E5LC 2QL8A 4IZ6A 1IBLC 5CZXA 4PUHA 3J81D 2V7BA 4YHHC 1GPMA 1USPB 2Z51A 4TPSB 4DCVA 4DCSA 2D1SA 4DV7C 4K0BA 4G1IA 2D1RA 4BC7A 4GXRA 3FCCA 4LF4C 4ZJZA 1MXCA 2D7VA 2KDNA 3RV2A 1MD9A 3I07A 1N2FA 4B3SC 2UU9C 2MM9A 4DCTA 4LF5C 4PHTA 3T1HC 2OPLB 2UUCC 2ZZMA 4JI5C 3O2EA 4DV1C 1ULTA 1FLOA 5CZVA 3EERA 5JRHA 2MCQA 2BH1X 4D57A 1I94C 4JI8C 4D4IA 4X64C 3NPDA 5KYTA 2VZEA 3TUFA 3A4IA 1AMUA 4DR6C 2E8EA 4KTVA 4RLQA 1N34C 2YWCA 3R9WA 5IWAC 3CQ2A 4JI0C 1HR0C 3I08A 2UUAC 5IT9D 3NYQA 1ZB9A 2ONFA 2E8CA 3IMLA 3IPLA 3S82A 3KXWA 4RVOA 3JAMD 4D56A 3A26A 4X66C 2VQEC 2JMPA 2UUBC 3C5EA 5IFIA 2Y27A 2PN2A 4XX2A 4NDNA 3TDEA 3SO4A 2HHHC 3CW8X 1MDBA 3NYRA 1O92A 2JNVA 4RM2A 1VLAA 2PT7G 1NY8A 4PROC 5A2QD 5AE3A 3NI2A 2F4VC 4PZPA 1K0RA 2QVYX 4NXMC 3UOWA 3TR3A 3VNRA 1YJ7A 4DUYC 5K8FA 3CJEA 3EQ6A 2D28C 2P2FA 3R9XA 4L2ZA 1MDFA 4BCAA 1LQLA 2D1TA 2PROA 3K6RA 4R0MA 5LCIA 4DCUA 5T8TA 1PG3A 3RG2A 2M5OA 5AE1A 1IB8A 4LFAC 4GS5A 5BSWA 4KTTA 4WV3A 1T5HX 3GR1A 4LFCC 1V60A 4PUGA 1NYEA 1XNRC 4NOZA 1J5EC 3LUSA 4DUZC 3N2QA 4L4QA 2MMAB 4DR4C 1LCIA 5FLXD 5LMUC 5H9UA 3A9UA 2QW0X 2YCBA 4R1LA 4JV5C 3L95X 3T1YC 1QWIA 2M5HA 1O90A 3LGXA 2PG1E 1XS3A 1KKGA 5KYVA 2E8FA 3UEBA 3TQIA 4DR1C 4EATA 5BSMA 3ETOA 4DR2C 4DR5C 4FTFA 1HNZC 3IEUA 4DR7C 4LF8C 2YX1A 3PESA 5BR8C 4I9GA 3IEVA 1FJGC 3CW9A 3LNOA 2VSQA 2HJGA 2E7GA 1PG4A 1N32C 4JI7C 1EGAA 2WD9A 2YWBA 4LF7C 3ETCA 3L8CA 3DLPX 3J80D 3UZ0A 2ZM6C 4RMNA 2DHMA 3E7XA 4IR7A 4HPVA 3E7WA 1USPA 2OBVA 4DV6C 1HNWC 4RLFA 4KHPC 4LF6C 1XDXA 1YGTA 2D1QA 4JI3C 2P2JA 5E7QA 4BC9A 4JI4C 5DV9A 2UXBC 3H2TA 1ZB8A 3FCEA 1VEHA 1TH5A 1P4EC 4AQYC 2ASBA 4ISBA 4PUIA 4X62C 4JI6C 2P2MA 1MXBA 1XHJA 3DHVA 1IBMC 1XMOC 3VNQA 2D27A 4MTNA 1RG9A 5ADZA 2OPLA 1WH9A 3J7AD 3FM7A 1ML8A 2ZZNA 1T5DX 2VQFC 3OTOC 1HNXC 4FUQA 2ATWA 4K0KC 3CQ3A 5A1GA 3N54B 5BSTA 3G7SA 2BJOA 4DV2C 1WF3A 4JI2C 5BSVA 1XNQC 4X65C 2CXCA 4JYAC 4DV5C 5A19A 1RY2A 2AYAA 1PU1A 4R1MA 2P02A 1HH2P 3GPCA 2KZFA 3AY0A 5GTDA 2UXCC 2P2BA 1PA4A 2QVXX 4JM1A 1V25A 1O93A 2QVZX 1P7LA 4NXNC 5T8SA 4MH4A 3GR0A 4LE5A 4OX9C 1M6XA 2DPLA 4GKKC 3CQ1A 1O9TA 1XRAA 3AF5A 3PBKA 2Y4OA 2KZ0A 4I9FA 4DG8A 3UX3A 2EGTA 1MKYA 5K85A 1QM4A 5LMNC 4GKJC 5A1IA 1L2FA 3DAYA 5BSUA 1WCJA 4JI1C 4LFBC 4YY3C 4B3MC 2CU6A 3A25A 1M6XC 4B3RC 1N33C 4G36A 2E0GA 4FUTA 1UWDA 3GKUA 2CY1A 4ODJA 4DR3C 3R44A 1XRBA 1UKKA 3LAXA
chains in the Genus database with same CATH topology
2UXDC 3B7WA 1XMQC 4OXIA 5BUQA 4U5YD 4DV3C 4BSZA 1IBKC 4D4GA 5BURA 4LF9C 4RVNA 2DYJA 1MXAA 2P2QA 3A9VA 5AE2A 2Y4NA 5BSRA 2OO4A 4B3TC 3AF6A 4OYCA 1N36C 2P20A 4ZLPA 4RM3A 1JOSA 3VNSA 1FUGA 4GXQA 4DG9A 3LNVA 4G37A 5KEIA 1BA3A 2XR1A 4BBYA 4DV0C 3PROC 5BUSA 1V26A 4L7IA 2WP0C 4DV4C 1XRCA 4WS9A 2E5LC 2QL8A 4IZ6A 1IBLC 5CZXA 3J81D 2V7BA 4YHHC 1GPMA 1USPB 4TPSB 4DCVA 4DCSA 2D1SA 4DV7C 4K0BA 4G1IA 2D1RA 4BC7A 4GXRA 3FCCA 4LF4C 4ZJZA 1MXCA 2D7VA 3RV2A 1MD9A 3I07A 1N2FA 4B3SC 2UU9C 4DCTA 4LF5C 4PHTA 3T1HC 2OPLB 2UUCC 4JI5C 4DV1C 1ULTA 5CZVA 3EERA 5JRHA 2BH1X 4D57A 1I94C 4JI8C 4D4IA 4X64C 3NPDA 5KYTA 2VZEA 3TUFA 3A4IA 1AMUA 4DR6C 2E8EA 4KTVA 4RLQA 1N34C 2YWCA 3R9WA 5IWAC 4JI0C 1HR0C 3I08A 2UUAC 5IT9D 3NYQA 1ZB9A 2ONFA 2E8CA 3IMLA 3IPLA 3S82A 3KXWA 4RVOA 3JAMD 4D56A 4X66C 2VQEC 2JMPA 2UUBC 3C5EA 5IFIA 2Y27A 2PN2A 4XX2A 4NDNA 3TDEA 3SO4A 2HHHC 3CW8X 1MDBA 3NYRA 1O92A 4RM2A 1VLAA 2PT7G 4PROC 5A2QD 5AE3A 3NI2A 2F4VC 4PZPA 1K0RA 2QVYX 4NXMC 3UOWA 4DUYC 3VNRA 1YJ7A 5K8FA 3CJEA 3EQ6A 2D28C 2P2FA 3R9XA 4L2ZA 1MDFA 4BCAA 1LQLA 2D1TA 2PROA 4R0MA 4DCUA 5T8TA 1PG3A 3RG2A 5AE1A 4LFAC 4GS5A 5BSWA 4KTTA 4WV3A 1T5HX 3GR1A 4LFCC 1NYEA 1XNRC 4NOZA 1J5EC 3LUSA 4DUZC 3N2QA 4L4QA 4DR4C 1LCIA 5LMUC 5FLXD 5H9UA 3A9UA 2QW0X 2YCBA 4R1LA 4JV5C 3L95X 3T1YC 1QWIA 1O90A 3LGXA 1KKGA 5KYVA 2E8FA 3TQIA 4DR1C 4EATA 5BSMA 3ETOA 4DR2C 4DR5C 4FTFA 1HNZC 3IEUA 4DR7C 4LF8C 3PESA 5BR8C 4I9GA 3IEVA 1FJGC 3CW9A 2VSQA 2HJGA 2E7GA 1PG4A 1N32C 4JI7C 1EGAA 2WD9A 2YWBA 4LF7C 3ETCA 3L8CA 3DLPX 3J80D 3UZ0A 2ZM6C 4RMNA 3E7XA 4IR7A 4HPVA 3E7WA 1USPA 2OBVA 4DV6C 1HNWC 4RLFA 4KHPC 4LF6C 2D1QA 4JI3C 2P2JA 5E7QA 4BC9A 4JI4C 5DV9A 2UXBC 3H2TA 1ZB8A 3FCEA 4AQYC 2ASBA 4ISBA 4X62C 4JI6C 2P2MA 1MXBA 3DHVA 1IBMC 1XMOC 3VNQA 2D27A 4MTNA 1RG9A 5ADZA 2OPLA 1WH9A 3J7AD 1ML8A 1T5DX 2VQFC 3OTOC 1HNXC 4FUQA 2ATWA 4K0KC 5A1GA 3N54B 5BSTA 3G7SA 2BJOA 4DV2C 1WF3A 4JI2C 5BSVA 1XNQC 4X65C 2CXCA 4JYAC 4DV5C 5A19A 1RY2A 2AYAA 4R1MA 2P02A 1HH2P 3GPCA 2KZFA 5GTDA 2UXCC 2P2BA 1PA4A 2QVXX 4JM1A 1V25A 1O93A 2QVZX 1P7LA 4NXNC 5T8SA 4MH4A 3GR0A 4LE5A 4OX9C 2DPLA 4GKKC 1O9TA 1XRAA 3AF5A 3PBKA 2Y4OA 4I9FA 4DG8A 2EGTA 1MKYA 5K85A 1QM4A 5LMNC 4GKJC 5A1IA 1L2FA 3DAYA 5BSUA 4LFBC 4JI1C 4YY3C 4B3MC 4B3RC 1N33C 4G36A 2E0GA 4FUTA 3GKUA 2CY1A 4ODJA 4DR3C 3R44A 1XRBA 1UKKA 3LAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H C;  2UXD C;  1ZB8 A;  1XMQ C;  4LFC C;  4AQY C;  2OPL B;  2ASB A;  2UUC C;  4X62 C;  4DV3 C;  4BSZ A;  1NYE A;  1IBK C;  4JI5 C;  4NOZ A;  1XNR C;  1J5E C;  3LUS A;  4DV1 C;  4DUZ C;  4JI6 C;  1IBM C;  1XMO C;  3EER A;  4MTN A;  2OPL A;  4LF9 C;  1WH9 A;  3J7A D;  2DYJ A;  1ML8 A;  4DR4 C;  1I94 C;  4JI8 C;  5FLX D;  2VQF C;  5LMU C;  4JV5 C;  3OTO C;  2YCB A;  1HNX C;  4X64 C;  4B3T C;  2ATW A;  3AF6 A;  4K0K C;  3T1Y C;  1QWI A;  1N36 C;  4DR6 C;  2E8E A;  2BJO A;  4DV2 C;  1WF3 A;  1N34 C;  3R9W A;  5IWA C;  1KKG A;  4JI2 C;  1JOS A;  2E8F A;  4JI0 C;  1XNQ C;  1HR0 C;  4X65 C;  2CXC A;  2UUA C;  5IT9 D;  1ZB9 A;  2ONF A;  2E8C A;  4JYA C;  4DV5 C;  4DR1 C;  2XR1 A;  4DR2 C;  3JAM D;  4DV0 C;  4DR5 C;  1HNZ C;  4DV4 C;  3IEU A;  4DR7 C;  4LF8 C;  4X66 C;  2VQE C;  2JMP A;  2UUB C;  5BR8 C;  3IEV A;  1FJG C;  1HH2 P;  2PN2 A;  4XX2 A;  2E5L C;  2HJG A;  2QL8 A;  2E7G A;  1IBL C;  2HHH C;  2KZF A;  2UXC C;  1N32 C;  1PA4 A;  4JI7 C;  1EGA A;  4LF7 C;  3J81 D;  4NXN C;  4YHH C;  1USP B;  4MH4 A;  4OX9 C;  4DCV A;  3J80 D;  1VLA A;  4GKK C;  2PT7 G;  2ZM6 C;  3AF5 A;  4DCS A;  5A2Q D;  2EGT A;  1MKY A;  4DV7 C;  2F4V C;  5LMN C;  1K0R A;  4GKJ C;  4NXM C;  1L2F A;  1USP A;  4DV6 C;  4LFB C;  4JI1 C;  4DUY C;  1HNW C;  4YY3 C;  4B3M C;  3CJE A;  4B3R C;  4KHP C;  1N33 C;  4LF4 C;  3R9X A;  1LQL A;  3GKU A;  4LF6 C;  2D7V A;  2CY1 A;  4DCU A;  4DR3 C;  4JI3 C;  3I07 A;  1N2F A;  4B3S C;  2UU9 C;  4LFA C;  1UKK A;  4DCT A;  4LF5 C;  4JI4 C;  2UXB C; 
#chains in the Genus database with same CATH topology
 2UXD C;  3B7W A;  1XMQ C;  4OXI A;  5BUQ A;  4U5Y D;  4DV3 C;  4BSZ A;  2NCL A;  1IBK C;  3UX2 A;  4D4G A;  5BUR A;  1P4E A;  4LF9 C;  4RVN A;  2DYJ A;  1MXA A;  2P2Q A;  3A9V A;  5AE2 A;  2Y4N A;  5BSR A;  2OO4 A;  4B3T C;  3AF6 A;  4OYC A;  1N36 C;  2P20 A;  4ZLP A;  4RM3 A;  1JOS A;  3VNS A;  2ZTB A;  1FUG A;  4GXQ A;  4DG9 A;  3LNV A;  4G37 A;  5KEI A;  1BA3 A;  2XR1 A;  4BBY A;  4DV0 C;  3PRO C;  5BUS A;  1V26 A;  4L7I A;  2WP0 C;  4DV4 C;  1XRC A;  4WS9 A;  2E5L C;  2QL8 A;  4IZ6 A;  1IBL C;  5CZX A;  4PUH A;  3J81 D;  2V7B A;  4YHH C;  1GPM A;  1USP B;  2Z51 A;  4TPS B;  4DCV A;  4DCS A;  2D1S A;  4DV7 C;  4K0B A;  4G1I A;  2D1R A;  4BC7 A;  4GXR A;  3FCC A;  4LF4 C;  4ZJZ A;  1MXC A;  2D7V A;  2KDN A;  3RV2 A;  1MD9 A;  3I07 A;  1N2F A;  4B3S C;  2UU9 C;  2MM9 A;  4DCT A;  4LF5 C;  4PHT A;  3T1H C;  2OPL B;  2UUC C;  2ZZM A;  4JI5 C;  3O2E A;  4DV1 C;  1ULT A;  1FLO A;  5CZV A;  3EER A;  5JRH A;  2MCQ A;  2BH1 X;  4D57 A;  1I94 C;  4JI8 C;  4D4I A;  4X64 C;  3NPD A;  5KYT A;  2VZE A;  3TUF A;  3A4I A;  1AMU A;  4DR6 C;  2E8E A;  4KTV A;  4RLQ A;  1N34 C;  2YWC A;  3R9W A;  5IWA C;  3CQ2 A;  4JI0 C;  1HR0 C;  3I08 A;  2UUA C;  5IT9 D;  3NYQ A;  1ZB9 A;  2ONF A;  2E8C A;  3IML A;  3IPL A;  3S82 A;  3KXW A;  4RVO A;  3JAM D;  4D56 A;  3A26 A;  4X66 C;  2VQE C;  2JMP A;  2UUB C;  3C5E A;  5IFI A;  2Y27 A;  2PN2 A;  4XX2 A;  4NDN A;  3TDE A;  3SO4 A;  2HHH C;  3CW8 X;  1MDB A;  3NYR A;  1O92 A;  2JNV A;  4RM2 A;  1VLA A;  2PT7 G;  1NY8 A;  4PRO C;  5A2Q D;  5AE3 A;  3NI2 A;  2F4V C;  4PZP A;  1K0R A;  2QVY X;  4NXM C;  3UOW A;  3TR3 A;  3VNR A;  1YJ7 A;  4DUY C;  5K8F A;  3CJE A;  3EQ6 A;  2D28 C;  2P2F A;  3R9X A;  4L2Z A;  1MDF A;  4BCA A;  1LQL A;  2D1T A;  2PRO A;  3K6R A;  4R0M A;  5LCI A;  4DCU A;  5T8T A;  1PG3 A;  3RG2 A;  2M5O A;  5AE1 A;  1IB8 A;  4LFA C;  4GS5 A;  5BSW A;  4KTT A;  4WV3 A;  1T5H X;  3GR1 A;  4LFC C;  1V60 A;  4PUG A;  1NYE A;  1XNR C;  4NOZ A;  1J5E C;  3LUS A;  4DUZ C;  3N2Q A;  4L4Q A;  2MMA B;  4DR4 C;  1LCI A;  5FLX D;  5LMU C;  5H9U A;  3A9U A;  2QW0 X;  2YCB A;  4R1L A;  4JV5 C;  3L95 X;  3T1Y C;  1QWI A;  2M5H A;  1O90 A;  3LGX A;  2PG1 E;  1XS3 A;  1KKG A;  5KYV A;  2E8F A;  3UEB A;  3TQI A;  4DR1 C;  4EAT A;  5BSM A;  3ETO A;  4DR2 C;  4DR5 C;  4FTF A;  1HNZ C;  3IEU A;  4DR7 C;  4LF8 C;  2YX1 A;  3PES A;  5BR8 C;  4I9G A;  3IEV A;  1FJG C;  3CW9 A;  3LNO A;  2VSQ A;  2HJG A;  2E7G A;  1PG4 A;  1N32 C;  4JI7 C;  1EGA A;  2WD9 A;  2YWB A;  4LF7 C;  3ETC A;  3L8C A;  3DLP X;  3J80 D;  3UZ0 A;  2ZM6 C;  4RMN A;  2DHM A;  3E7X A;  4IR7 A;  4HPV A;  3E7W A;  1USP A;  2OBV A;  4DV6 C;  1HNW C;  4RLF A;  4KHP C;  4LF6 C;  1XDX A;  1YGT A;  2D1Q A;  4JI3 C;  2P2J A;  5E7Q A;  4BC9 A;  4JI4 C;  5DV9 A;  2UXB C;  3H2T A;  1ZB8 A;  3FCE A;  1VEH A;  1TH5 A;  1P4E C;  4AQY C;  2ASB A;  4ISB A;  4PUI A;  4X62 C;  4JI6 C;  2P2M A;  1MXB A;  1XHJ A;  3DHV A;  1IBM C;  1XMO C;  3VNQ A;  2D27 A;  4MTN A;  1RG9 A;  5ADZ A;  2OPL A;  1WH9 A;  3J7A D;  3FM7 A;  1ML8 A;  2ZZN A;  1T5D X;  2VQF C;  3OTO C;  1HNX C;  4FUQ A;  2ATW A;  4K0K C;  3CQ3 A;  5A1G A;  3N54 B;  5BST A;  3G7S A;  2BJO A;  4DV2 C;  1WF3 A;  4JI2 C;  5BSV A;  1XNQ C;  4X65 C;  2CXC A;  4JYA C;  4DV5 C;  5A19 A;  1RY2 A;  2AYA A;  1PU1 A;  4R1M A;  2P02 A;  1HH2 P;  3GPC A;  2KZF A;  3AY0 A;  5GTD A;  2UXC C;  2P2B A;  1PA4 A;  2QVX X;  4JM1 A;  1V25 A;  1O93 A;  2QVZ X;  1P7L A;  4NXN C;  5T8S A;  4MH4 A;  3GR0 A;  4LE5 A;  4OX9 C;  1M6X A;  2DPL A;  4GKK C;  3CQ1 A;  1O9T A;  1XRA A;  3AF5 A;  3PBK A;  2Y4O A;  2KZ0 A;  4I9F A;  4DG8 A;  3UX3 A;  2EGT A;  1MKY A;  5K85 A;  1QM4 A;  5LMN C;  4GKJ C;  5A1I A;  1L2F A;  3DAY A;  5BSU A;  1WCJ A;  4JI1 C;  4LFB C;  4YY3 C;  4B3M C;  2CU6 A;  3A25 A;  1M6X C;  4B3R C;  1N33 C;  4G36 A;  2E0G A;  4FUT A;  1UWD A;  3GKU A;  2CY1 A;  4ODJ A;  4DR3 C;  3R44 A;  1XRB A;  1UKK A;  3LAX A; 
#chains in the Genus database with same CATH homology
 2UXD C;  3B7W A;  1XMQ C;  4OXI A;  5BUQ A;  4U5Y D;  4DV3 C;  4BSZ A;  1IBK C;  4D4G A;  5BUR A;  4LF9 C;  4RVN A;  2DYJ A;  1MXA A;  2P2Q A;  3A9V A;  5AE2 A;  2Y4N A;  5BSR A;  2OO4 A;  4B3T C;  3AF6 A;  4OYC A;  1N36 C;  2P20 A;  4ZLP A;  4RM3 A;  1JOS A;  3VNS A;  1FUG A;  4GXQ A;  4DG9 A;  3LNV A;  4G37 A;  5KEI A;  1BA3 A;  2XR1 A;  4BBY A;  4DV0 C;  3PRO C;  5BUS A;  1V26 A;  4L7I A;  2WP0 C;  4DV4 C;  1XRC A;  4WS9 A;  2E5L C;  2QL8 A;  4IZ6 A;  1IBL C;  5CZX A;  3J81 D;  2V7B A;  4YHH C;  1GPM A;  1USP B;  4TPS B;  4DCV A;  4DCS A;  2D1S A;  4DV7 C;  4K0B A;  4G1I A;  2D1R A;  4BC7 A;  4GXR A;  3FCC A;  4LF4 C;  4ZJZ A;  1MXC A;  2D7V A;  3RV2 A;  1MD9 A;  3I07 A;  1N2F A;  4B3S C;  2UU9 C;  4DCT A;  4LF5 C;  4PHT A;  3T1H C;  2OPL B;  2UUC C;  4JI5 C;  4DV1 C;  1ULT A;  5CZV A;  3EER A;  5JRH A;  2BH1 X;  4D57 A;  1I94 C;  4JI8 C;  4D4I A;  4X64 C;  3NPD A;  5KYT A;  2VZE A;  3TUF A;  3A4I A;  1AMU A;  4DR6 C;  2E8E A;  4KTV A;  4RLQ A;  1N34 C;  2YWC A;  3R9W A;  5IWA C;  4JI0 C;  1HR0 C;  3I08 A;  2UUA C;  5IT9 D;  3NYQ A;  1ZB9 A;  2ONF A;  2E8C A;  3IML A;  3IPL A;  3S82 A;  3KXW A;  4RVO A;  3JAM D;  4D56 A;  4X66 C;  2VQE C;  2JMP A;  2UUB C;  3C5E A;  5IFI A;  2Y27 A;  2PN2 A;  4XX2 A;  4NDN A;  3TDE A;  3SO4 A;  2HHH C;  3CW8 X;  1MDB A;  3NYR A;  1O92 A;  4RM2 A;  1VLA A;  2PT7 G;  4PRO C;  5A2Q D;  5AE3 A;  3NI2 A;  2F4V C;  4PZP A;  1K0R A;  2QVY X;  4NXM C;  3UOW A;  4DUY C;  3VNR A;  1YJ7 A;  5K8F A;  3CJE A;  3EQ6 A;  2D28 C;  2P2F A;  3R9X A;  4L2Z A;  1MDF A;  4BCA A;  1LQL A;  2D1T A;  2PRO A;  4R0M A;  4DCU A;  5T8T A;  1PG3 A;  3RG2 A;  5AE1 A;  4LFA C;  4GS5 A;  5BSW A;  4KTT A;  4WV3 A;  1T5H X;  3GR1 A;  4LFC C;  1NYE A;  1XNR C;  4NOZ A;  1J5E C;  3LUS A;  4DUZ C;  3N2Q A;  4L4Q A;  4DR4 C;  1LCI A;  5LMU C;  5FLX D;  5H9U A;  3A9U A;  2QW0 X;  2YCB A;  4R1L A;  4JV5 C;  3L95 X;  3T1Y C;  1QWI A;  1O90 A;  3LGX A;  1KKG A;  5KYV A;  2E8F A;  3TQI A;  4DR1 C;  4EAT A;  5BSM A;  3ETO A;  4DR2 C;  4DR5 C;  4FTF A;  1HNZ C;  3IEU A;  4DR7 C;  4LF8 C;  3PES A;  5BR8 C;  4I9G A;  3IEV A;  1FJG C;  3CW9 A;  2VSQ A;  2HJG A;  2E7G A;  1PG4 A;  1N32 C;  4JI7 C;  1EGA A;  2WD9 A;  2YWB A;  4LF7 C;  3ETC A;  3L8C A;  3DLP X;  3J80 D;  3UZ0 A;  2ZM6 C;  4RMN A;  3E7X A;  4IR7 A;  4HPV A;  3E7W A;  1USP A;  2OBV A;  4DV6 C;  1HNW C;  4RLF A;  4KHP C;  4LF6 C;  2D1Q A;  4JI3 C;  2P2J A;  5E7Q A;  4BC9 A;  4JI4 C;  5DV9 A;  2UXB C;  3H2T A;  1ZB8 A;  3FCE A;  4AQY C;  2ASB A;  4ISB A;  4X62 C;  4JI6 C;  2P2M A;  1MXB A;  3DHV A;  1IBM C;  1XMO C;  3VNQ A;  2D27 A;  4MTN A;  1RG9 A;  5ADZ A;  2OPL A;  1WH9 A;  3J7A D;  1ML8 A;  1T5D X;  2VQF C;  3OTO C;  1HNX C;  4FUQ A;  2ATW A;  4K0K C;  5A1G A;  3N54 B;  5BST A;  3G7S A;  2BJO A;  4DV2 C;  1WF3 A;  4JI2 C;  5BSV A;  1XNQ C;  4X65 C;  2CXC A;  4JYA C;  4DV5 C;  5A19 A;  1RY2 A;  2AYA A;  4R1M A;  2P02 A;  1HH2 P;  3GPC A;  2KZF A;  5GTD A;  2UXC C;  2P2B A;  1PA4 A;  2QVX X;  4JM1 A;  1V25 A;  1O93 A;  2QVZ X;  1P7L A;  4NXN C;  5T8S A;  4MH4 A;  3GR0 A;  4LE5 A;  4OX9 C;  2DPL A;  4GKK C;  1O9T A;  1XRA A;  3AF5 A;  3PBK A;  2Y4O A;  4I9F A;  4DG8 A;  2EGT A;  1MKY A;  5K85 A;  1QM4 A;  5LMN C;  4GKJ C;  5A1I A;  1L2F A;  3DAY A;  5BSU A;  4LFB C;  4JI1 C;  4YY3 C;  4B3M C;  4B3R C;  1N33 C;  4G36 A;  2E0G A;  4FUT A;  3GKU A;  2CY1 A;  4ODJ A;  4DR3 C;  3R44 A;  1XRB A;  1UKK A;  3LAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...