4X62C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4x62C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4x62C02
1WF3A 3EERA 3JAMD 4JV5C 1IBLC 3LUSA 1JOSA 5IWAC 4LFCC 3AF5A 4DUYC 2KZFA 1HR0C 2UU9C 4DR3C 2PN2A 4NXNC 2UXBC 4DR4C 4GKJC 4DV7C 3I07A 2UUCC 3CJEA 2UUAC 1HNZC 1L2FA 2HJGA 4BSZA 4AQYC 1MKYA 1UKKA 4DR6C 1WH9A 3J80D 1XMQC 1HNXC 1KKGA 2XR1A 4X62C 3IEUA 1NYEA 2E8EA 4DCSA 2UXCC 1N33C 4XX2A 2PT7G 5LMUC 1XNQC 4YY3C 4JI4C 4JI2C 4B3SC 4LF8C 4LF7C 2CXCA 4KHPC 2UUBC 2E5LC 2QL8A 4X65C 1PA4A 2OPLB 2OPLA 1ZB9A 4X66C 4DV0C 4DR5C 4JI7C 4DV4C 2YCBA 1J5EC 2E8FA 4X64C 1ZB8A 2HHHC 4LF9C 1FJGC 3IEVA 4DV5C 4DR7C 1HH2P 1IBKC 3R9XA 1VLAA 4JI1C 2DYJA 3R9WA 4DUZC 5FLXD 1USPA 3AF6A 1N2FA 3J7AD 4DCVA 4K0KC 2VQEC 4B3TC 4MTNA 2VQFC 2F4VC 5A2QD 5BR8C 4DR2C 5IT9D 1XMOC 4LF4C 4MH4A 1USPB 2JMPA 4DCTA 4GKKC 2BJOA 2CY1A 5LMNC 4DCUA 3OTOC 4JI6C 4LF5C 1ML8A 4JYAC 1N32C 2UXDC 4JI3C 1N34C 3J81D 1LQLA 4LF6C 4B3RC 4OX9C 4YHHC 1XNRC 4JI8C 4DV2C 4JI0C 2ZM6C 4B3MC 2ATWA 3T1YC 1K0RA 2EGTA 1I94C 4JI5C 4DV1C 3GKUA 4DV3C 4DV6C 2E8CA 2ASBA 4DR1C 4NOZA 4LFAC 1QWIA 3T1HC 2D7VA 1N36C 1IBMC 2E7GA 4NXMC 4LFBC 1HNWC 2ONFA 1EGAA
chains in the Genus database with same CATH superfamily
4RLQA 3E7WA 3ETCA 5AE2A 1IBLC 1V26A 3LUSA 5T8SA 5A19A 2D1RA 5BUQA 4RM3A 4GKJC 2HJGA 4IR7A 3RG2A 1WH9A 2OO4A 2XR1A 1YGTA 1WCJA 2E8EA 2UXCC 3N54B 4LF8C 5JRHA 3DHVA 4BC9A 4ODJA 4KHPC 2OPLA 1ZB9A 4DR5C 3FCEA 5CZVA 5LCIA 1MXBA 1ZB8A 1FJGC 5AE3A 2DYJA 4DUZC 1USPA 3AF6A 1N2FA 3DLPX 1P4EC 1M6XC 2VQEC 5BSTA 2VQFC 2F4VC 1O9TA 5A1IA 1LCIA 1GPMA 4LE5A 2P2JA 4GKKC 2BJOA 4D4GA 5LMNC 4LFBC 2D1SA 3N2QA 5ADZA 1T5DX 2D28C 1PU1A 4JI3C 2KZ0A 2ZTBA 4OX9C 3LGXA 2D1QA 2QVZX 2PG1E 5BSWA 3NYRA 3K6RA 3H2TA 4BCAA 4B3MC 3FCCA 2EGTA 1O92A 3LNVA 4DR1C 3UX3A 2V7BA 3T1HC 2D7VA 4D4IA 1IBMC 2E7GA 5K8FA 3FM7A 4NXMC 1HNWC 3E7XA 3EERA 2P20A 3EQ6A 4LFCC 4DUYC 5E7QA 4DR3C 4DR4C 4DV7C 3TUFA 5H9UA 1XDXA 1L2FA 4BSZA 3VNRA 1YJ7A 1UKKA 1IB8A 3CW8X 4DR6C 3J80D 1XMQC 1KKGA 5BUSA 4RVOA 4BBYA 4DCSA 4XX2A 3VNSA 4FTFA 4G37A 4JI2C 3A9VA 4B3SC 3PROC 4PZPA 3KXWA 3L8CA 2UUBC 2E0GA 4X66C 1MXCA 4DV0C 4ZLPA 1MD9A 1J5EC 2E8FA 5DV9A 4X64C 4LF9C 1FUGA 3IEVA 4DV5C 4PROC 1IBKC 3R9XA 1VLAA 4KTVA 5KYTA 3J7AD 4TPSB 4GS5A 1TH5A 5A2QD 5BR8C 5AE1A 5IT9D 2ZZNA 2YWCA 3L95X 5IFIA 3NPDA 3DAYA 4DCTA 5BURA 3VNQA 1ML8A 3J81D 1BA3A 1LQLA 4U5YD 4B3RC 3A26A 5CZXA 2ZM6C 4OXIA 3SO4A 2OBVA 1MDBA 2ATWA 1PG4A 2MMAB 4PHTA 1P7LA 3B7WA 2VSQA 3LNOA 3S82A 2E8CA 2Z51A 2QVYX 2ASBA 3A9UA 3RV2A 1V60A 4FUQA 1EGAA 1WF3A 4JV5C 3AF5A 2KZFA 4NDNA 3GR0A 2VZEA 1HR0C 2P2FA 4DG8A 4NXNC 2UXBC 1RG9A 4D57A 2P02A 3I07A 3PBKA 2UUCC 2UUAC 1HNZC 4EATA 4I9GA 4AQYC 1MKYA 4R1LA 3TQIA 1NYEA 4G36A 2MM9A 5T8TA 4IZ6A 2PT7G 4DG9A 3A4IA 5LMUC 3TR3A 4YY3C 1XNQC 4JI4C 4BC7A 2QL8A 4X65C 1PA4A 5KEIA 2Y4NA 4R0MA 1MXAA 4JI7C 2YCBA 3UEBA 1P4EA 1M6XA 3CQ3A 1FLOA 3O2EA 4DR7C 4RLFA 2YX1A 3R9WA 4RM2A 4PUIA 1XHJA 2KDNA 5KYVA 4B3TC 2JNVA 4DR2C 3G7SA 3C5EA 4R1MA 3CW9A 2CY1A 4LF5C 5BSVA 1O93A 4YHHC 2PROA 2Y4OA 4DV2C 4JI0C 3A25A 2Y27A 1K0RA 4HPVA 1XS3A 5K85A 1I94C 3R44A 3AY0A 3GKUA 4DV3C 4DV6C 1NY8A 2CU6A 3TDEA 2AYAA 1MDFA 1QM4A 4RMNA 1QWIA 3NI2A 4ISBA 2QW0X 1V25A 2D27A 1T5HX 3ETOA 4L7IA 2ONFA 3JAMD 2ZZMA 1PG3A 4D56A 3PESA 1JOSA 5IWAC 3I08A 4JM1A 1XRAA 4RVNA 2UU9C 2PN2A 4G1IA 2BH1X 3NYQA 2QVXX 3CQ2A 2D1TA 3CJEA 3GPCA 3CQ1A 4PUGA 5BSRA 2WP0C 2M5OA 1ULTA 5GTDA 1HNXC 4X62C 3IEUA 4WS9A 4I9FA 2NCLA 4KTTA 1N33C 2MCQA 4LF7C 2CXCA 2WD9A 1AMUA 2E5LC 2OPLB 4L4QA 4DV4C 3LAXA 5BSMA 2HHHC 4ZJZA 1HH2P 2P2BA 5BSUA 4JI1C 1O90A 5FLXD 4L2ZA 4WV3A 4PUHA 4DCVA 4K0KC 4MTNA 1XRCA 4FUTA 1XMOC 1VEHA 4LF4C 4MH4A 3UOWA 1USPB 1UWDA 2JMPA 2P2QA 2P2MA 4DCUA 3OTOC 4JI6C 2YWBA 1N32C 4JYAC 2UXDC 1N34C 4LF6C 1RY2A 2M5HA 1XNRC 4JI8C 4K0BA 3T1YC 4JI5C 4DV1C 4GXQA 2DPLA 5A1GA 3IMLA 2DHMA 4NOZA 4LFAC 1XRBA 4GXRA 1N36C 3UX2A 3GR1A 3IPLA 4OYCA 3UZ0A
chains in the Genus database with same CATH topology
4RLQA 3E7WA 3ETCA 5AE2A 1IBLC 1V26A 3LUSA 5T8SA 5A19A 2D1RA 5BUQA 4RM3A 4GKJC 2HJGA 4IR7A 3RG2A 1WH9A 2OO4A 2XR1A 2E8EA 2UXCC 3N54B 4LF8C 5JRHA 3DHVA 4BC9A 4ODJA 4KHPC 2OPLA 1ZB9A 4DR5C 3FCEA 5CZVA 1MXBA 1ZB8A 1FJGC 5AE3A 2DYJA 4DUZC 1USPA 3AF6A 1N2FA 3DLPX 2VQEC 5BSTA 2VQFC 2F4VC 1O9TA 5A1IA 1LCIA 1GPMA 4LE5A 2P2JA 4GKKC 2BJOA 4D4GA 5LMNC 4LFBC 2D1SA 3N2QA 5ADZA 1T5DX 2D28C 4JI3C 4OX9C 3LGXA 2D1QA 2QVZX 5BSWA 3NYRA 3H2TA 4BCAA 4B3MC 3FCCA 2EGTA 1O92A 3LNVA 4DR1C 2V7BA 3T1HC 2D7VA 4D4IA 1IBMC 2E7GA 5K8FA 4NXMC 1HNWC 3E7XA 3EERA 2P20A 3EQ6A 4LFCC 4DUYC 5E7QA 4DR3C 4DR4C 4DV7C 3TUFA 5H9UA 1L2FA 4BSZA 3VNRA 1YJ7A 1UKKA 3CW8X 4DR6C 3J80D 1XMQC 1KKGA 5BUSA 4RVOA 4BBYA 4DCSA 4XX2A 3VNSA 4FTFA 4G37A 4JI2C 3A9VA 4B3SC 3PROC 4PZPA 3KXWA 3L8CA 2UUBC 2E0GA 4X66C 1MXCA 4DV0C 4ZLPA 1MD9A 1J5EC 2E8FA 5DV9A 4X64C 4LF9C 1FUGA 3IEVA 4DV5C 4PROC 1IBKC 3R9XA 1VLAA 4KTVA 5KYTA 3J7AD 4TPSB 4GS5A 5A2QD 5BR8C 5AE1A 5IT9D 2YWCA 3L95X 5IFIA 3NPDA 3DAYA 4DCTA 5BURA 3VNQA 1ML8A 3J81D 1BA3A 1LQLA 4U5YD 4B3RC 5CZXA 2ZM6C 4OXIA 3SO4A 2OBVA 1MDBA 2ATWA 1PG4A 4PHTA 1P7LA 3B7WA 2VSQA 3S82A 2E8CA 2ASBA 2QVYX 3A9UA 3RV2A 4FUQA 1EGAA 1WF3A 4JV5C 3AF5A 2KZFA 4NDNA 3GR0A 2VZEA 1HR0C 2P2FA 4DG8A 4NXNC 2UXBC 1RG9A 4D57A 2P02A 3I07A 3PBKA 2UUCC 2UUAC 1HNZC 4EATA 4I9GA 4AQYC 1MKYA 4R1LA 3TQIA 1NYEA 4G36A 5T8TA 4IZ6A 2PT7G 4DG9A 3A4IA 5LMUC 1XNQC 4YY3C 4JI4C 4BC7A 2QL8A 4X65C 1PA4A 5KEIA 2Y4NA 4R0MA 1MXAA 4JI7C 2YCBA 4DR7C 4RLFA 3R9WA 4RM2A 5KYVA 4B3TC 4DR2C 3G7SA 3C5EA 4R1MA 3CW9A 2CY1A 4LF5C 5BSVA 1O93A 4YHHC 2PROA 2Y4OA 4DV2C 4JI0C 2Y27A 1K0RA 4HPVA 5K85A 1I94C 3R44A 3GKUA 4DV3C 4DV6C 3TDEA 2AYAA 1MDFA 1QM4A 4RMNA 1QWIA 3NI2A 4ISBA 2QW0X 1V25A 2D27A 1T5HX 4L7IA 3ETOA 2ONFA 3JAMD 1PG3A 4D56A 3PESA 1JOSA 5IWAC 3I08A 4JM1A 1XRAA 4RVNA 2UU9C 2PN2A 4G1IA 2BH1X 3NYQA 2QVXX 2D1TA 3CJEA 3GPCA 5BSRA 2WP0C 1ULTA 5GTDA 1HNXC 4X62C 3IEUA 4WS9A 4I9FA 4KTTA 1N33C 4LF7C 2CXCA 2WD9A 1AMUA 2E5LC 2OPLB 4L4QA 4DV4C 3LAXA 5BSMA 2HHHC 4ZJZA 1HH2P 2P2BA 5BSUA 4JI1C 1O90A 5FLXD 4L2ZA 4WV3A 4DCVA 4K0KC 4MTNA 1XRCA 4FUTA 1XMOC 4LF4C 4MH4A 3UOWA 1USPB 2JMPA 2P2QA 2P2MA 4DCUA 3OTOC 4JI6C 2YWBA 1N32C 4JYAC 2UXDC 1N34C 4LF6C 1RY2A 1XNRC 4JI8C 4K0BA 3T1YC 4JI5C 4DV1C 4GXQA 2DPLA 5A1GA 3IMLA 4NOZA 4LFAC 1XRBA 4GXRA 1N36C 3GR1A 3IPLA 4OYCA 3UZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WF3 A;  3EER A;  3JAM D;  4JV5 C;  1IBL C;  3LUS A;  1JOS A;  5IWA C;  4LFC C;  3AF5 A;  4DUY C;  2KZF A;  1HR0 C;  2UU9 C;  4DR3 C;  2PN2 A;  4NXN C;  2UXB C;  4DR4 C;  4GKJ C;  4DV7 C;  3I07 A;  2UUC C;  3CJE A;  2UUA C;  1HNZ C;  1L2F A;  2HJG A;  4BSZ A;  4AQY C;  1MKY A;  1UKK A;  4DR6 C;  1WH9 A;  3J80 D;  1XMQ C;  1HNX C;  1KKG A;  2XR1 A;  4X62 C;  3IEU A;  1NYE A;  2E8E A;  4DCS A;  2UXC C;  1N33 C;  4XX2 A;  2PT7 G;  5LMU C;  1XNQ C;  4YY3 C;  4JI4 C;  4JI2 C;  4B3S C;  4LF8 C;  4LF7 C;  2CXC A;  4KHP C;  2UUB C;  2E5L C;  2QL8 A;  4X65 C;  1PA4 A;  2OPL B;  2OPL A;  1ZB9 A;  4X66 C;  4DV0 C;  4DR5 C;  4JI7 C;  4DV4 C;  2YCB A;  1J5E C;  2E8F A;  4X64 C;  1ZB8 A;  2HHH C;  4LF9 C;  1FJG C;  3IEV A;  4DV5 C;  4DR7 C;  1HH2 P;  1IBK C;  3R9X A;  1VLA A;  4JI1 C;  2DYJ A;  3R9W A;  4DUZ C;  5FLX D;  1USP A;  3AF6 A;  1N2F A;  3J7A D;  4DCV A;  4K0K C;  2VQE C;  4B3T C;  4MTN A;  2VQF C;  2F4V C;  5A2Q D;  5BR8 C;  4DR2 C;  5IT9 D;  1XMO C;  4LF4 C;  4MH4 A;  1USP B;  2JMP A;  4DCT A;  4GKK C;  2BJO A;  2CY1 A;  5LMN C;  4DCU A;  3OTO C;  4JI6 C;  4LF5 C;  1ML8 A;  4JYA C;  1N32 C;  2UXD C;  4JI3 C;  1N34 C;  3J81 D;  1LQL A;  4LF6 C;  4B3R C;  4OX9 C;  4YHH C;  1XNR C;  4JI8 C;  4DV2 C;  4JI0 C;  2ZM6 C;  4B3M C;  2ATW A;  3T1Y C;  1K0R A;  2EGT A;  1I94 C;  4JI5 C;  4DV1 C;  3GKU A;  4DV3 C;  4DV6 C;  2E8C A;  2ASB A;  4DR1 C;  4NOZ A;  4LFA C;  1QWI A;  3T1H C;  2D7V A;  1N36 C;  1IBM C;  2E7G A;  4NXM C;  4LFB C;  1HNW C;  2ONF A;  1EGA A; 
#chains in the Genus database with same CATH topology
 4RLQ A;  3E7W A;  3ETC A;  5AE2 A;  1IBL C;  1V26 A;  3LUS A;  5T8S A;  5A19 A;  2D1R A;  5BUQ A;  4RM3 A;  4GKJ C;  2HJG A;  4IR7 A;  3RG2 A;  1WH9 A;  2OO4 A;  2XR1 A;  1YGT A;  1WCJ A;  2E8E A;  2UXC C;  3N54 B;  4LF8 C;  5JRH A;  3DHV A;  4BC9 A;  4ODJ A;  4KHP C;  2OPL A;  1ZB9 A;  4DR5 C;  3FCE A;  5CZV A;  5LCI A;  1MXB A;  1ZB8 A;  1FJG C;  5AE3 A;  2DYJ A;  4DUZ C;  1USP A;  3AF6 A;  1N2F A;  3DLP X;  1P4E C;  1M6X C;  2VQE C;  5BST A;  2VQF C;  2F4V C;  1O9T A;  5A1I A;  1LCI A;  1GPM A;  4LE5 A;  2P2J A;  4GKK C;  2BJO A;  4D4G A;  5LMN C;  4LFB C;  2D1S A;  3N2Q A;  5ADZ A;  1T5D X;  2D28 C;  1PU1 A;  4JI3 C;  2KZ0 A;  2ZTB A;  4OX9 C;  3LGX A;  2D1Q A;  2QVZ X;  2PG1 E;  5BSW A;  3NYR A;  3K6R A;  3H2T A;  4BCA A;  4B3M C;  3FCC A;  2EGT A;  1O92 A;  3LNV A;  4DR1 C;  3UX3 A;  2V7B A;  3T1H C;  2D7V A;  4D4I A;  1IBM C;  2E7G A;  5K8F A;  3FM7 A;  4NXM C;  1HNW C;  3E7X A;  3EER A;  2P20 A;  3EQ6 A;  4LFC C;  4DUY C;  5E7Q A;  4DR3 C;  4DR4 C;  4DV7 C;  3TUF A;  5H9U A;  1XDX A;  1L2F A;  4BSZ A;  3VNR A;  1YJ7 A;  1UKK A;  1IB8 A;  3CW8 X;  4DR6 C;  3J80 D;  1XMQ C;  1KKG A;  5BUS A;  4RVO A;  4BBY A;  4DCS A;  4XX2 A;  3VNS A;  4FTF A;  4G37 A;  4JI2 C;  3A9V A;  4B3S C;  3PRO C;  4PZP A;  3KXW A;  3L8C A;  2UUB C;  2E0G A;  4X66 C;  1MXC A;  4DV0 C;  4ZLP A;  1MD9 A;  1J5E C;  2E8F A;  5DV9 A;  4X64 C;  4LF9 C;  1FUG A;  3IEV A;  4DV5 C;  4PRO C;  1IBK C;  3R9X A;  1VLA A;  4KTV A;  5KYT A;  3J7A D;  4TPS B;  4GS5 A;  1TH5 A;  5A2Q D;  5BR8 C;  5AE1 A;  5IT9 D;  2ZZN A;  2YWC A;  3L95 X;  5IFI A;  3NPD A;  3DAY A;  4DCT A;  5BUR A;  3VNQ A;  1ML8 A;  3J81 D;  1BA3 A;  1LQL A;  4U5Y D;  4B3R C;  3A26 A;  5CZX A;  2ZM6 C;  4OXI A;  3SO4 A;  2OBV A;  1MDB A;  2ATW A;  1PG4 A;  2MMA B;  4PHT A;  1P7L A;  3B7W A;  2VSQ A;  3LNO A;  3S82 A;  2E8C A;  2Z51 A;  2QVY X;  2ASB A;  3A9U A;  3RV2 A;  1V60 A;  4FUQ A;  1EGA A;  1WF3 A;  4JV5 C;  3AF5 A;  2KZF A;  4NDN A;  3GR0 A;  2VZE A;  1HR0 C;  2P2F A;  4DG8 A;  4NXN C;  2UXB C;  1RG9 A;  4D57 A;  2P02 A;  3I07 A;  3PBK A;  2UUC C;  2UUA C;  1HNZ C;  4EAT A;  4I9G A;  4AQY C;  1MKY A;  4R1L A;  3TQI A;  1NYE A;  4G36 A;  2MM9 A;  5T8T A;  4IZ6 A;  2PT7 G;  4DG9 A;  3A4I A;  5LMU C;  3TR3 A;  4YY3 C;  1XNQ C;  4JI4 C;  4BC7 A;  2QL8 A;  4X65 C;  1PA4 A;  5KEI A;  2Y4N A;  4R0M A;  1MXA A;  4JI7 C;  2YCB A;  3UEB A;  1P4E A;  1M6X A;  3CQ3 A;  1FLO A;  3O2E A;  4DR7 C;  4RLF A;  2YX1 A;  3R9W A;  4RM2 A;  4PUI A;  1XHJ A;  2KDN A;  5KYV A;  4B3T C;  2JNV A;  4DR2 C;  3G7S A;  3C5E A;  4R1M A;  3CW9 A;  2CY1 A;  4LF5 C;  5BSV A;  1O93 A;  4YHH C;  2PRO A;  2Y4O A;  4DV2 C;  4JI0 C;  3A25 A;  2Y27 A;  1K0R A;  4HPV A;  1XS3 A;  5K85 A;  1I94 C;  3R44 A;  3AY0 A;  3GKU A;  4DV3 C;  4DV6 C;  1NY8 A;  2CU6 A;  3TDE A;  2AYA A;  1MDF A;  1QM4 A;  4RMN A;  1QWI A;  3NI2 A;  4ISB A;  2QW0 X;  1V25 A;  2D27 A;  1T5H X;  3ETO A;  4L7I A;  2ONF A;  3JAM D;  2ZZM A;  1PG3 A;  4D56 A;  3PES A;  1JOS A;  5IWA C;  3I08 A;  4JM1 A;  1XRA A;  4RVN A;  2UU9 C;  2PN2 A;  4G1I A;  2BH1 X;  3NYQ A;  2QVX X;  3CQ2 A;  2D1T A;  3CJE A;  3GPC A;  3CQ1 A;  4PUG A;  5BSR A;  2WP0 C;  2M5O A;  1ULT A;  5GTD A;  1HNX C;  4X62 C;  3IEU A;  4WS9 A;  4I9F A;  2NCL A;  4KTT A;  1N33 C;  2MCQ A;  4LF7 C;  2CXC A;  2WD9 A;  1AMU A;  2E5L C;  2OPL B;  4L4Q A;  4DV4 C;  3LAX A;  5BSM A;  2HHH C;  4ZJZ A;  1HH2 P;  2P2B A;  5BSU A;  4JI1 C;  1O90 A;  5FLX D;  4L2Z A;  4WV3 A;  4PUH A;  4DCV A;  4K0K C;  4MTN A;  1XRC A;  4FUT A;  1XMO C;  1VEH A;  4LF4 C;  4MH4 A;  3UOW A;  1USP B;  1UWD A;  2JMP A;  2P2Q A;  2P2M A;  4DCU A;  3OTO C;  4JI6 C;  2YWB A;  1N32 C;  4JYA C;  2UXD C;  1N34 C;  4LF6 C;  1RY2 A;  2M5H A;  1XNR C;  4JI8 C;  4K0B A;  3T1Y C;  4JI5 C;  4DV1 C;  4GXQ A;  2DPL A;  5A1G A;  3IML A;  2DHM A;  4NOZ A;  4LFA C;  1XRB A;  4GXR A;  1N36 C;  3UX2 A;  3GR1 A;  3IPL A;  4OYC A;  3UZ0 A; 
#chains in the Genus database with same CATH homology
 4RLQ A;  3E7W A;  3ETC A;  5AE2 A;  1IBL C;  1V26 A;  3LUS A;  5T8S A;  5A19 A;  2D1R A;  5BUQ A;  4RM3 A;  4GKJ C;  2HJG A;  4IR7 A;  3RG2 A;  1WH9 A;  2OO4 A;  2XR1 A;  2E8E A;  2UXC C;  3N54 B;  4LF8 C;  5JRH A;  3DHV A;  4BC9 A;  4ODJ A;  4KHP C;  2OPL A;  1ZB9 A;  4DR5 C;  3FCE A;  5CZV A;  1MXB A;  1ZB8 A;  1FJG C;  5AE3 A;  2DYJ A;  4DUZ C;  1USP A;  3AF6 A;  1N2F A;  3DLP X;  2VQE C;  5BST A;  2VQF C;  2F4V C;  1O9T A;  5A1I A;  1LCI A;  1GPM A;  4LE5 A;  2P2J A;  4GKK C;  2BJO A;  4D4G A;  5LMN C;  4LFB C;  2D1S A;  3N2Q A;  5ADZ A;  1T5D X;  2D28 C;  4JI3 C;  4OX9 C;  3LGX A;  2D1Q A;  2QVZ X;  5BSW A;  3NYR A;  3H2T A;  4BCA A;  4B3M C;  3FCC A;  2EGT A;  1O92 A;  3LNV A;  4DR1 C;  2V7B A;  3T1H C;  2D7V A;  4D4I A;  1IBM C;  2E7G A;  5K8F A;  4NXM C;  1HNW C;  3E7X A;  3EER A;  2P20 A;  3EQ6 A;  4LFC C;  4DUY C;  5E7Q A;  4DR3 C;  4DR4 C;  4DV7 C;  3TUF A;  5H9U A;  1L2F A;  4BSZ A;  3VNR A;  1YJ7 A;  1UKK A;  3CW8 X;  4DR6 C;  3J80 D;  1XMQ C;  1KKG A;  5BUS A;  4RVO A;  4BBY A;  4DCS A;  4XX2 A;  3VNS A;  4FTF A;  4G37 A;  4JI2 C;  3A9V A;  4B3S C;  3PRO C;  4PZP A;  3KXW A;  3L8C A;  2UUB C;  2E0G A;  4X66 C;  1MXC A;  4DV0 C;  4ZLP A;  1MD9 A;  1J5E C;  2E8F A;  5DV9 A;  4X64 C;  4LF9 C;  1FUG A;  3IEV A;  4DV5 C;  4PRO C;  1IBK C;  3R9X A;  1VLA A;  4KTV A;  5KYT A;  3J7A D;  4TPS B;  4GS5 A;  5A2Q D;  5BR8 C;  5AE1 A;  5IT9 D;  2YWC A;  3L95 X;  5IFI A;  3NPD A;  3DAY A;  4DCT A;  5BUR A;  3VNQ A;  1ML8 A;  3J81 D;  1BA3 A;  1LQL A;  4U5Y D;  4B3R C;  5CZX A;  2ZM6 C;  4OXI A;  3SO4 A;  2OBV A;  1MDB A;  2ATW A;  1PG4 A;  4PHT A;  1P7L A;  3B7W A;  2VSQ A;  3S82 A;  2E8C A;  2ASB A;  2QVY X;  3A9U A;  3RV2 A;  4FUQ A;  1EGA A;  1WF3 A;  4JV5 C;  3AF5 A;  2KZF A;  4NDN A;  3GR0 A;  2VZE A;  1HR0 C;  2P2F A;  4DG8 A;  4NXN C;  2UXB C;  1RG9 A;  4D57 A;  2P02 A;  3I07 A;  3PBK A;  2UUC C;  2UUA C;  1HNZ C;  4EAT A;  4I9G A;  4AQY C;  1MKY A;  4R1L A;  3TQI A;  1NYE A;  4G36 A;  5T8T A;  4IZ6 A;  2PT7 G;  4DG9 A;  3A4I A;  5LMU C;  1XNQ C;  4YY3 C;  4JI4 C;  4BC7 A;  2QL8 A;  4X65 C;  1PA4 A;  5KEI A;  2Y4N A;  4R0M A;  1MXA A;  4JI7 C;  2YCB A;  4DR7 C;  4RLF A;  3R9W A;  4RM2 A;  5KYV A;  4B3T C;  4DR2 C;  3G7S A;  3C5E A;  4R1M A;  3CW9 A;  2CY1 A;  4LF5 C;  5BSV A;  1O93 A;  4YHH C;  2PRO A;  2Y4O A;  4DV2 C;  4JI0 C;  2Y27 A;  1K0R A;  4HPV A;  5K85 A;  1I94 C;  3R44 A;  3GKU A;  4DV3 C;  4DV6 C;  3TDE A;  2AYA A;  1MDF A;  1QM4 A;  4RMN A;  1QWI A;  3NI2 A;  4ISB A;  2QW0 X;  1V25 A;  2D27 A;  1T5H X;  4L7I A;  3ETO A;  2ONF A;  3JAM D;  1PG3 A;  4D56 A;  3PES A;  1JOS A;  5IWA C;  3I08 A;  4JM1 A;  1XRA A;  4RVN A;  2UU9 C;  2PN2 A;  4G1I A;  2BH1 X;  3NYQ A;  2QVX X;  2D1T A;  3CJE A;  3GPC A;  5BSR A;  2WP0 C;  1ULT A;  5GTD A;  1HNX C;  4X62 C;  3IEU A;  4WS9 A;  4I9F A;  4KTT A;  1N33 C;  4LF7 C;  2CXC A;  2WD9 A;  1AMU A;  2E5L C;  2OPL B;  4L4Q A;  4DV4 C;  3LAX A;  5BSM A;  2HHH C;  4ZJZ A;  1HH2 P;  2P2B A;  5BSU A;  4JI1 C;  1O90 A;  5FLX D;  4L2Z A;  4WV3 A;  4DCV A;  4K0K C;  4MTN A;  1XRC A;  4FUT A;  1XMO C;  4LF4 C;  4MH4 A;  3UOW A;  1USP B;  2JMP A;  2P2Q A;  2P2M A;  4DCU A;  3OTO C;  4JI6 C;  2YWB A;  1N32 C;  4JYA C;  2UXD C;  1N34 C;  4LF6 C;  1RY2 A;  1XNR C;  4JI8 C;  4K0B A;  3T1Y C;  4JI5 C;  4DV1 C;  4GXQ A;  2DPL A;  5A1G A;  3IML A;  4NOZ A;  4LFA C;  1XRB A;  4GXR A;  1N36 C;  3GR1 A;  3IPL A;  4OYC A;  3UZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...