4X62C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4x62C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4x62C02
2UXDC 1N33C 1L2FA 4LF8C 4BSZA 4GKKC 1HNXC 1XMOC 4DR2C 4NOZA 3J80D 4DCTA 4X66C 2VQEC 1N32C 4GKJC 4NXNC 1ML8A 5IWAC 3IEUA 4LF4C 3J7AD 3I07A 2PN2A 4MTNA 4XX2A 3JAMD 3EERA 4B3SC 1I94C 4JI8C 4LF9C 4DR4C 2HHHC 4LFCC 1N34C 5FLXD 1PA4A 2UXBC 4MH4A 4DR1C 4JI7C 1WH9A 4DCSA 4LF5C 2OPLA 1FJGC 4JV5C 4DV2C 1KKGA 1WF3A 4JI5C 2PT7G 1MKYA 4DV1C 2ATWA 4OX9C 1EGAA 4B3MC 1ZB9A 4DUYC 1QWIA 2E7GA 4LFBC 2KZFA 4LF6C 2VQFC 2CY1A 4DUZC 2CXCA 4DCVA 3GKUA 4JI3C 4YHHC 1XNRC 1XMQC 2QL8A 1LQLA 2E8CA 2E8FA 1ZB8A 3AF6A 1IBLC 2ONFA 4X64C 4DV3C 2UUBC 2DYJA 4X65C 1HR0C 4LFAC 2YCBA 4JI6C 5LMUC 3T1YC 4B3RC 4X62C 5LMNC 5A2QD 2ZM6C 4B3TC 4DR7C 4K0KC 1UKKA 2EGTA 2UXCC 3IEVA 2E8EA 1XNQC 3OTOC 1NYEA 1N2FA 1VLAA 4DV6C 2E5LC 4DR3C 4DV5C 4DR5C 4JI4C 1HNZC 1USPA 4AQYC 4DV4C 4JYAC 1IBMC 2UU9C 1K0RA 1IBKC 3R9XA 2OPLB 1USPB 2JMPA 4JI2C 4DCUA 4KHPC 5IT9D 1JOSA 2F4VC 1HH2P 4JI0C 4JI1C 1N36C 5BR8C 2UUCC 4YY3C 3LUSA 2BJOA 2HJGA 4LF7C 4DV0C 4DV7C 3R9WA 3CJEA 3J81D 2D7VA 3AF5A 2XR1A 4NXMC 2ASBA 1J5EC 3T1HC 1HNWC 4DR6C 2UUAC
chains in the Genus database with same CATH superfamily
1T5DX 3R44A 5A1GA 1UWDA 3J80D 4X66C 2VQEC 3L8CA 1N32C 4GKJC 5BUQA 3VNRA 3J7AD 3I07A 4B3SC 1V26A 1TH5A 4BCAA 5AE2A 4D4GA 2D1RA 5T8SA 4BC9A 5FLXD 2UXBC 1MXAA 4JI7C 2P2JA 4PUIA 2DPLA 1FJGC 2KZ0A 1WF3A 4DV1C 2PROA 4ODJA 4B3MC 2YX1A 2E7GA 3C5EA 4ZLPA 2KZFA 4LF6C 2CXCA 4DCVA 4JI3C 4YHHC 5AE3A 5KEIA 1O93A 2QL8A 3DAYA 1XRCA 1LQLA 2E8CA 2Y27A 2QVZX 1PG3A 2P02A 4K0BA 5LMNC 4OXIA 4RLQA 2ZM6C 4K0KC 5A19A 3E7WA 3VNQA 2P2QA 1N2FA 1VLAA 2WD9A 3ETCA 3DLPX 3GPCA 4DV4C 4JYAC 3E7XA 3R9XA 3O2EA 4RLFA 5IT9D 4WS9A 1XDXA 1JOSA 4PHTA 5BSWA 4RMNA 2YWBA 1O9TA 4I9GA 2UUCC 3TUFA 4LF7C 3K6RA 3PESA 3CJEA 3EQ6A 2D7VA 3NYQA 2XR1A 4NXMC 1M6XA 2ASBA 1J5EC 1L2FA 1P7LA 4R0MA 2V7BA 1HNXC 1O92A 4NOZA 5CZVA 3UOWA 3GR0A 1NY8A 3B7WA 3RG2A 4RVOA 4LF4C 5IWAC 5LCIA 2NCLA 1I94C 4JI8C 2OBVA 4KTVA 4LF9C 2HHHC 3L95X 5KYVA 4KTTA 4MH4A 1T5HX 2VZEA 3N2QA 3LGXA 1MD9A 4DCSA 3A26A 2OPLA 4JV5C 4DG9A 4JI5C 3TR3A 1AMUA 1MKYA 1XRAA 4RM2A 4FUTA 1ZB9A 1XS3A 4DUYC 5BSRA 3FM7A 3NI2A 5JRHA 4ISBA 4IZ6A 4JM1A 3GKUA 4D56A 3A25A 2P2BA 3PBKA 1XMQC 5GTDA 2D28C 4DV3C 1HR0C 2D27A 4JI6C 2CU6A 4B3RC 4X62C 5CZXA 5A2QD 4DR7C 3A9UA 3H2TA 2ZZMA 4ZJZA 3OTOC 4DV6C 2E5LC 4DR3C 2D1TA 4DR5C 4WV3A 4JI4C 1BA3A 1IBMC 2OPLB 4JI2C 4D4IA 4KHPC 4HPVA 4JI1C 3TQIA 4PZPA 3LUSA 2HJGA 3CW8X 4DV0C 3R9WA 2MCQA 3LNOA 4PUGA 3J81D 3I08A 3AF5A 1XHJA 2UXDC 4LF8C 2DHMA 4DR2C 2AYAA 5A1IA 1ML8A 4PUHA 4MTNA 4XX2A 1VEHA 4L4QA 1V25A 5DV9A 4PROC 1LCIA 3RV2A 4RVNA 1RY2A 5K8FA 1N34C 2MM9A 1XRBA 1PA4A 4DR1C 5BSVA 1WH9A 1MDFA 1IB8A 1QWIA 4LFBC 4NDNA 2CY1A 2KDNA 4DUZC 4L2ZA 1MXBA 2PG1E 2ZTBA 2P20A 1XNRC 3IPLA 1IBLC 1FLOA 2UUBC 2ONFA 3ETOA 4X65C 3CQ1A 4FTFA 1V60A 4B3TC 2UXCC 2M5OA 2BH1X 2E8EA 4G37A 1RG9A 1NYEA 4BBYA 5ADZA 2JNVA 2QW0X 1QM4A 4IR7A 1FUGA 1HNZC 5E7QA 3LAXA 2OO4A 2UU9C 4GXRA 2VSQA 3UZ0A 2JMPA 5KYTA 1WCJA 2F4VC 5BSUA 4JI0C 1N36C 3FCEA 2BJOA 1P4EA 3IMLA 2Y4NA 2M5HA 4RM3A 1YGTA 2Y4OA 5BSMA 3T1HC 1HNWC 1MDBA 2UUAC 5T8TA 1N33C 3TDEA 5IFIA 4BSZA 4GKKC 1XMOC 4LE5A 3NYRA 3CQ3A 4DCTA 4NXNC 2Z51A 2WP0C 3IEUA 2PN2A 3JAMD 3EERA 4DR4C 4LFCC 1M6XC 1O90A 3CQ2A 3DHVA 4LF5C 3UX3A 1P4EC 4DV2C 1KKGA 2PT7G 4L7IA 2ATWA 4TPSB 3UX2A 4OX9C 1EGAA 2P2FA 4U5YD 3VNSA 3CW9A 3NPDA 1GPMA 2D1QA 4G36A 3A4IA 2VQFC 3G7SA 5BUSA 3LNVA 4OYCA 4DG8A 4FUQA 3PROC 3A9VA 4R1LA 5AE1A 5BSTA 2E8FA 3AF6A 1ZB8A 4GS5A 4X64C 2DYJA 4LFAC 2YCBA 5LMUC 1PG4A 3T1YC 1YJ7A 3FCCA 1UKKA 2EGTA 5K85A 3IEVA 1XNQC 2E0GA 4D57A 3GR1A 3KXWA 2P2MA 2YWCA 4DV5C 4BC7A 3S82A 4I9FA 1USPA 4AQYC 2QVYX 2MMAB 3AY0A 4R1MA 3SO4A 4G1IA 1K0RA 1IBKC 4GXQA 1USPB 1PU1A 2QVXX 4DCUA 1HH2P 5BR8C 5BURA 4YY3C 4DV7C 2ZZNA 3N54B 4EATA 5H9UA 2D1SA 1ULTA 1MXCA 3UEBA 4DR6C
chains in the Genus database with same CATH topology
1T5DX 3R44A 5A1GA 3J80D 4X66C 2VQEC 3L8CA 1N32C 4GKJC 5BUQA 3VNRA 3J7AD 3I07A 4B3SC 1V26A 4BCAA 5AE2A 4D4GA 2D1RA 5T8SA 4BC9A 5FLXD 2UXBC 1MXAA 4JI7C 2P2JA 2DPLA 1FJGC 1WF3A 4DV1C 2PROA 4ODJA 4B3MC 2E7GA 3C5EA 4ZLPA 2KZFA 4LF6C 2CXCA 4DCVA 4JI3C 4YHHC 5AE3A 5KEIA 1O93A 2QL8A 3DAYA 1XRCA 1LQLA 2E8CA 2Y27A 2QVZX 1PG3A 2P02A 4K0BA 5LMNC 4OXIA 4RLQA 2ZM6C 4K0KC 5A19A 3E7WA 3VNQA 2P2QA 1N2FA 1VLAA 2WD9A 3ETCA 3DLPX 3GPCA 4DV4C 4JYAC 3E7XA 3R9XA 4RLFA 5IT9D 4WS9A 1JOSA 4PHTA 5BSWA 4RMNA 2YWBA 1O9TA 4I9GA 2UUCC 3TUFA 4LF7C 3PESA 3CJEA 3EQ6A 2D7VA 3NYQA 2XR1A 4NXMC 2ASBA 1J5EC 1L2FA 1P7LA 4R0MA 2V7BA 1HNXC 1O92A 4NOZA 5CZVA 3UOWA 3GR0A 3B7WA 3RG2A 4RVOA 4LF4C 5IWAC 1I94C 4JI8C 2OBVA 4KTVA 4LF9C 2HHHC 3L95X 5KYVA 4KTTA 4MH4A 1T5HX 2VZEA 3N2QA 3LGXA 1MD9A 4DCSA 2OPLA 4JV5C 4DG9A 4JI5C 1AMUA 1MKYA 1XRAA 4RM2A 4FUTA 1ZB9A 4DUYC 5BSRA 3NI2A 5JRHA 4ISBA 4IZ6A 4JM1A 3GKUA 4D56A 2P2BA 3PBKA 1XMQC 5GTDA 2D28C 4DV3C 1HR0C 2D27A 4JI6C 4B3RC 4X62C 5CZXA 5A2QD 4DR7C 3A9UA 3H2TA 4ZJZA 3OTOC 4DV6C 2E5LC 4DR3C 2D1TA 4DR5C 4WV3A 4JI4C 1BA3A 1IBMC 2OPLB 4JI2C 4D4IA 4KHPC 4HPVA 4JI1C 3TQIA 4PZPA 3LUSA 2HJGA 3CW8X 4DV0C 3R9WA 3J81D 3I08A 3AF5A 2UXDC 4LF8C 4DR2C 2AYAA 5A1IA 1ML8A 4MTNA 4XX2A 4L4QA 1V25A 5DV9A 4PROC 1LCIA 3RV2A 4RVNA 1RY2A 5K8FA 1N34C 1XRBA 1PA4A 4DR1C 5BSVA 1WH9A 1MDFA 1QWIA 4LFBC 4NDNA 2CY1A 4DUZC 4L2ZA 1MXBA 2P20A 1XNRC 3IPLA 1IBLC 2UUBC 2ONFA 3ETOA 4X65C 4FTFA 4B3TC 2UXCC 2BH1X 2E8EA 4G37A 1RG9A 1NYEA 4BBYA 5ADZA 2QW0X 1QM4A 4IR7A 1FUGA 1HNZC 5E7QA 3LAXA 2OO4A 2UU9C 4GXRA 2VSQA 3UZ0A 2JMPA 5KYTA 2F4VC 5BSUA 4JI0C 1N36C 3FCEA 2BJOA 3IMLA 2Y4NA 4RM3A 2Y4OA 5BSMA 3T1HC 1HNWC 1MDBA 2UUAC 5T8TA 1N33C 3TDEA 5IFIA 4BSZA 4GKKC 1XMOC 4LE5A 3NYRA 4DCTA 4NXNC 2WP0C 3IEUA 2PN2A 3JAMD 3EERA 4DR4C 4LFCC 1O90A 3DHVA 4LF5C 4DV2C 1KKGA 2PT7G 4L7IA 2ATWA 4TPSB 4OX9C 1EGAA 2P2FA 4U5YD 3VNSA 3CW9A 3NPDA 1GPMA 2D1QA 4G36A 3A4IA 2VQFC 3G7SA 5BUSA 3LNVA 4OYCA 4DG8A 4FUQA 3PROC 3A9VA 4R1LA 5AE1A 5BSTA 2E8FA 3AF6A 1ZB8A 4GS5A 4X64C 2DYJA 4LFAC 2YCBA 5LMUC 1PG4A 3T1YC 1YJ7A 3FCCA 1UKKA 2EGTA 5K85A 3IEVA 1XNQC 2E0GA 4D57A 3GR1A 3KXWA 2P2MA 2YWCA 4DV5C 4BC7A 3S82A 4I9FA 1USPA 4AQYC 2QVYX 4R1MA 3SO4A 4G1IA 1K0RA 1IBKC 4GXQA 1USPB 4DCUA 2QVXX 1HH2P 5BR8C 5BURA 4YY3C 4DV7C 3N54B 4EATA 5H9UA 2D1SA 1ULTA 1MXCA 4DR6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD C;  1N33 C;  1L2F A;  4LF8 C;  4BSZ A;  4GKK C;  1HNX C;  1XMO C;  4DR2 C;  4NOZ A;  3J80 D;  4DCT A;  4X66 C;  2VQE C;  1N32 C;  4GKJ C;  4NXN C;  1ML8 A;  5IWA C;  3IEU A;  4LF4 C;  3J7A D;  3I07 A;  2PN2 A;  4MTN A;  4XX2 A;  3JAM D;  3EER A;  4B3S C;  1I94 C;  4JI8 C;  4LF9 C;  4DR4 C;  2HHH C;  4LFC C;  1N34 C;  5FLX D;  1PA4 A;  2UXB C;  4MH4 A;  4DR1 C;  4JI7 C;  1WH9 A;  4DCS A;  4LF5 C;  2OPL A;  1FJG C;  4JV5 C;  4DV2 C;  1KKG A;  1WF3 A;  4JI5 C;  2PT7 G;  1MKY A;  4DV1 C;  2ATW A;  4OX9 C;  1EGA A;  4B3M C;  1ZB9 A;  4DUY C;  1QWI A;  2E7G A;  4LFB C;  2KZF A;  4LF6 C;  2VQF C;  2CY1 A;  4DUZ C;  2CXC A;  4DCV A;  3GKU A;  4JI3 C;  4YHH C;  1XNR C;  1XMQ C;  2QL8 A;  1LQL A;  2E8C A;  2E8F A;  1ZB8 A;  3AF6 A;  1IBL C;  2ONF A;  4X64 C;  4DV3 C;  2UUB C;  2DYJ A;  4X65 C;  1HR0 C;  4LFA C;  2YCB A;  4JI6 C;  5LMU C;  3T1Y C;  4B3R C;  4X62 C;  5LMN C;  5A2Q D;  2ZM6 C;  4B3T C;  4DR7 C;  4K0K C;  1UKK A;  2EGT A;  2UXC C;  3IEV A;  2E8E A;  1XNQ C;  3OTO C;  1NYE A;  1N2F A;  1VLA A;  4DV6 C;  2E5L C;  4DR3 C;  4DV5 C;  4DR5 C;  4JI4 C;  1HNZ C;  1USP A;  4AQY C;  4DV4 C;  4JYA C;  1IBM C;  2UU9 C;  1K0R A;  1IBK C;  3R9X A;  2OPL B;  1USP B;  2JMP A;  4JI2 C;  4DCU A;  4KHP C;  5IT9 D;  1JOS A;  2F4V C;  1HH2 P;  4JI0 C;  4JI1 C;  1N36 C;  5BR8 C;  2UUC C;  4YY3 C;  3LUS A;  2BJO A;  2HJG A;  4LF7 C;  4DV0 C;  4DV7 C;  3R9W A;  3CJE A;  3J81 D;  2D7V A;  3AF5 A;  2XR1 A;  4NXM C;  2ASB A;  1J5E C;  3T1H C;  1HNW C;  4DR6 C;  2UUA C; 
#chains in the Genus database with same CATH topology
 1T5D X;  3R44 A;  5A1G A;  1UWD A;  3J80 D;  4X66 C;  2VQE C;  3L8C A;  1N32 C;  4GKJ C;  5BUQ A;  3VNR A;  3J7A D;  3I07 A;  4B3S C;  1V26 A;  1TH5 A;  4BCA A;  5AE2 A;  4D4G A;  2D1R A;  5T8S A;  4BC9 A;  5FLX D;  2UXB C;  1MXA A;  4JI7 C;  2P2J A;  4PUI A;  2DPL A;  1FJG C;  2KZ0 A;  1WF3 A;  4DV1 C;  2PRO A;  4ODJ A;  4B3M C;  2YX1 A;  2E7G A;  3C5E A;  4ZLP A;  2KZF A;  4LF6 C;  2CXC A;  4DCV A;  4JI3 C;  4YHH C;  5AE3 A;  5KEI A;  1O93 A;  2QL8 A;  3DAY A;  1XRC A;  1LQL A;  2E8C A;  2Y27 A;  2QVZ X;  1PG3 A;  2P02 A;  4K0B A;  5LMN C;  4OXI A;  4RLQ A;  2ZM6 C;  4K0K C;  5A19 A;  3E7W A;  3VNQ A;  2P2Q A;  1N2F A;  1VLA A;  2WD9 A;  3ETC A;  3DLP X;  3GPC A;  4DV4 C;  4JYA C;  3E7X A;  3R9X A;  3O2E A;  4RLF A;  5IT9 D;  4WS9 A;  1XDX A;  1JOS A;  4PHT A;  5BSW A;  4RMN A;  2YWB A;  1O9T A;  4I9G A;  2UUC C;  3TUF A;  4LF7 C;  3K6R A;  3PES A;  3CJE A;  3EQ6 A;  2D7V A;  3NYQ A;  2XR1 A;  4NXM C;  1M6X A;  2ASB A;  1J5E C;  1L2F A;  1P7L A;  4R0M A;  2V7B A;  1HNX C;  1O92 A;  4NOZ A;  5CZV A;  3UOW A;  3GR0 A;  1NY8 A;  3B7W A;  3RG2 A;  4RVO A;  4LF4 C;  5IWA C;  5LCI A;  2NCL A;  1I94 C;  4JI8 C;  2OBV A;  4KTV A;  4LF9 C;  2HHH C;  3L95 X;  5KYV A;  4KTT A;  4MH4 A;  1T5H X;  2VZE A;  3N2Q A;  3LGX A;  1MD9 A;  4DCS A;  3A26 A;  2OPL A;  4JV5 C;  4DG9 A;  4JI5 C;  3TR3 A;  1AMU A;  1MKY A;  1XRA A;  4RM2 A;  4FUT A;  1ZB9 A;  1XS3 A;  4DUY C;  5BSR A;  3FM7 A;  3NI2 A;  5JRH A;  4ISB A;  4IZ6 A;  4JM1 A;  3GKU A;  4D56 A;  3A25 A;  2P2B A;  3PBK A;  1XMQ C;  5GTD A;  2D28 C;  4DV3 C;  1HR0 C;  2D27 A;  4JI6 C;  2CU6 A;  4B3R C;  4X62 C;  5CZX A;  5A2Q D;  4DR7 C;  3A9U A;  3H2T A;  2ZZM A;  4ZJZ A;  3OTO C;  4DV6 C;  2E5L C;  4DR3 C;  2D1T A;  4DR5 C;  4WV3 A;  4JI4 C;  1BA3 A;  1IBM C;  2OPL B;  4JI2 C;  4D4I A;  4KHP C;  4HPV A;  4JI1 C;  3TQI A;  4PZP A;  3LUS A;  2HJG A;  3CW8 X;  4DV0 C;  3R9W A;  2MCQ A;  3LNO A;  4PUG A;  3J81 D;  3I08 A;  3AF5 A;  1XHJ A;  2UXD C;  4LF8 C;  2DHM A;  4DR2 C;  2AYA A;  5A1I A;  1ML8 A;  4PUH A;  4MTN A;  4XX2 A;  1VEH A;  4L4Q A;  1V25 A;  5DV9 A;  4PRO C;  1LCI A;  3RV2 A;  4RVN A;  1RY2 A;  5K8F A;  1N34 C;  2MM9 A;  1XRB A;  1PA4 A;  4DR1 C;  5BSV A;  1WH9 A;  1MDF A;  1IB8 A;  1QWI A;  4LFB C;  4NDN A;  2CY1 A;  2KDN A;  4DUZ C;  4L2Z A;  1MXB A;  2PG1 E;  2ZTB A;  2P20 A;  1XNR C;  3IPL A;  1IBL C;  1FLO A;  2UUB C;  2ONF A;  3ETO A;  4X65 C;  3CQ1 A;  4FTF A;  1V60 A;  4B3T C;  2UXC C;  2M5O A;  2BH1 X;  2E8E A;  4G37 A;  1RG9 A;  1NYE A;  4BBY A;  5ADZ A;  2JNV A;  2QW0 X;  1QM4 A;  4IR7 A;  1FUG A;  1HNZ C;  5E7Q A;  3LAX A;  2OO4 A;  2UU9 C;  4GXR A;  2VSQ A;  3UZ0 A;  2JMP A;  5KYT A;  1WCJ A;  2F4V C;  5BSU A;  4JI0 C;  1N36 C;  3FCE A;  2BJO A;  1P4E A;  3IML A;  2Y4N A;  2M5H A;  4RM3 A;  1YGT A;  2Y4O A;  5BSM A;  3T1H C;  1HNW C;  1MDB A;  2UUA C;  5T8T A;  1N33 C;  3TDE A;  5IFI A;  4BSZ A;  4GKK C;  1XMO C;  4LE5 A;  3NYR A;  3CQ3 A;  4DCT A;  4NXN C;  2Z51 A;  2WP0 C;  3IEU A;  2PN2 A;  3JAM D;  3EER A;  4DR4 C;  4LFC C;  1M6X C;  1O90 A;  3CQ2 A;  3DHV A;  4LF5 C;  3UX3 A;  1P4E C;  4DV2 C;  1KKG A;  2PT7 G;  4L7I A;  2ATW A;  4TPS B;  3UX2 A;  4OX9 C;  1EGA A;  2P2F A;  4U5Y D;  3VNS A;  3CW9 A;  3NPD A;  1GPM A;  2D1Q A;  4G36 A;  3A4I A;  2VQF C;  3G7S A;  5BUS A;  3LNV A;  4OYC A;  4DG8 A;  4FUQ A;  3PRO C;  3A9V A;  4R1L A;  5AE1 A;  5BST A;  2E8F A;  3AF6 A;  1ZB8 A;  4GS5 A;  4X64 C;  2DYJ A;  4LFA C;  2YCB A;  5LMU C;  1PG4 A;  3T1Y C;  1YJ7 A;  3FCC A;  1UKK A;  2EGT A;  5K85 A;  3IEV A;  1XNQ C;  2E0G A;  4D57 A;  3GR1 A;  3KXW A;  2P2M A;  2YWC A;  4DV5 C;  4BC7 A;  3S82 A;  4I9F A;  1USP A;  4AQY C;  2QVY X;  2MMA B;  3AY0 A;  4R1M A;  3SO4 A;  4G1I A;  1K0R A;  1IBK C;  4GXQ A;  1USP B;  1PU1 A;  2QVX X;  4DCU A;  1HH2 P;  5BR8 C;  5BUR A;  4YY3 C;  4DV7 C;  2ZZN A;  3N54 B;  4EAT A;  5H9U A;  2D1S A;  1ULT A;  1MXC A;  3UEB A;  4DR6 C; 
#chains in the Genus database with same CATH homology
 1T5D X;  3R44 A;  5A1G A;  3J80 D;  4X66 C;  2VQE C;  3L8C A;  1N32 C;  4GKJ C;  5BUQ A;  3VNR A;  3J7A D;  3I07 A;  4B3S C;  1V26 A;  4BCA A;  5AE2 A;  4D4G A;  2D1R A;  5T8S A;  4BC9 A;  5FLX D;  2UXB C;  1MXA A;  4JI7 C;  2P2J A;  2DPL A;  1FJG C;  1WF3 A;  4DV1 C;  2PRO A;  4ODJ A;  4B3M C;  2E7G A;  3C5E A;  4ZLP A;  2KZF A;  4LF6 C;  2CXC A;  4DCV A;  4JI3 C;  4YHH C;  5AE3 A;  5KEI A;  1O93 A;  2QL8 A;  3DAY A;  1XRC A;  1LQL A;  2E8C A;  2Y27 A;  2QVZ X;  1PG3 A;  2P02 A;  4K0B A;  5LMN C;  4OXI A;  4RLQ A;  2ZM6 C;  4K0K C;  5A19 A;  3E7W A;  3VNQ A;  2P2Q A;  1N2F A;  1VLA A;  2WD9 A;  3ETC A;  3DLP X;  3GPC A;  4DV4 C;  4JYA C;  3E7X A;  3R9X A;  4RLF A;  5IT9 D;  4WS9 A;  1JOS A;  4PHT A;  5BSW A;  4RMN A;  2YWB A;  1O9T A;  4I9G A;  2UUC C;  3TUF A;  4LF7 C;  3PES A;  3CJE A;  3EQ6 A;  2D7V A;  3NYQ A;  2XR1 A;  4NXM C;  2ASB A;  1J5E C;  1L2F A;  1P7L A;  4R0M A;  2V7B A;  1HNX C;  1O92 A;  4NOZ A;  5CZV A;  3UOW A;  3GR0 A;  3B7W A;  3RG2 A;  4RVO A;  4LF4 C;  5IWA C;  1I94 C;  4JI8 C;  2OBV A;  4KTV A;  4LF9 C;  2HHH C;  3L95 X;  5KYV A;  4KTT A;  4MH4 A;  1T5H X;  2VZE A;  3N2Q A;  3LGX A;  1MD9 A;  4DCS A;  2OPL A;  4JV5 C;  4DG9 A;  4JI5 C;  1AMU A;  1MKY A;  1XRA A;  4RM2 A;  4FUT A;  1ZB9 A;  4DUY C;  5BSR A;  3NI2 A;  5JRH A;  4ISB A;  4IZ6 A;  4JM1 A;  3GKU A;  4D56 A;  2P2B A;  3PBK A;  1XMQ C;  5GTD A;  2D28 C;  4DV3 C;  1HR0 C;  2D27 A;  4JI6 C;  4B3R C;  4X62 C;  5CZX A;  5A2Q D;  4DR7 C;  3A9U A;  3H2T A;  4ZJZ A;  3OTO C;  4DV6 C;  2E5L C;  4DR3 C;  2D1T A;  4DR5 C;  4WV3 A;  4JI4 C;  1BA3 A;  1IBM C;  2OPL B;  4JI2 C;  4D4I A;  4KHP C;  4HPV A;  4JI1 C;  3TQI A;  4PZP A;  3LUS A;  2HJG A;  3CW8 X;  4DV0 C;  3R9W A;  3J81 D;  3I08 A;  3AF5 A;  2UXD C;  4LF8 C;  4DR2 C;  2AYA A;  5A1I A;  1ML8 A;  4MTN A;  4XX2 A;  4L4Q A;  1V25 A;  5DV9 A;  4PRO C;  1LCI A;  3RV2 A;  4RVN A;  1RY2 A;  5K8F A;  1N34 C;  1XRB A;  1PA4 A;  4DR1 C;  5BSV A;  1WH9 A;  1MDF A;  1QWI A;  4LFB C;  4NDN A;  2CY1 A;  4DUZ C;  4L2Z A;  1MXB A;  2P20 A;  1XNR C;  3IPL A;  1IBL C;  2UUB C;  2ONF A;  3ETO A;  4X65 C;  4FTF A;  4B3T C;  2UXC C;  2BH1 X;  2E8E A;  4G37 A;  1RG9 A;  1NYE A;  4BBY A;  5ADZ A;  2QW0 X;  1QM4 A;  4IR7 A;  1FUG A;  1HNZ C;  5E7Q A;  3LAX A;  2OO4 A;  2UU9 C;  4GXR A;  2VSQ A;  3UZ0 A;  2JMP A;  5KYT A;  2F4V C;  5BSU A;  4JI0 C;  1N36 C;  3FCE A;  2BJO A;  3IML A;  2Y4N A;  4RM3 A;  2Y4O A;  5BSM A;  3T1H C;  1HNW C;  1MDB A;  2UUA C;  5T8T A;  1N33 C;  3TDE A;  5IFI A;  4BSZ A;  4GKK C;  1XMO C;  4LE5 A;  3NYR A;  4DCT A;  4NXN C;  2WP0 C;  3IEU A;  2PN2 A;  3JAM D;  3EER A;  4DR4 C;  4LFC C;  1O90 A;  3DHV A;  4LF5 C;  4DV2 C;  1KKG A;  2PT7 G;  4L7I A;  2ATW A;  4TPS B;  4OX9 C;  1EGA A;  2P2F A;  4U5Y D;  3VNS A;  3CW9 A;  3NPD A;  1GPM A;  2D1Q A;  4G36 A;  3A4I A;  2VQF C;  3G7S A;  5BUS A;  3LNV A;  4OYC A;  4DG8 A;  4FUQ A;  3PRO C;  3A9V A;  4R1L A;  5AE1 A;  5BST A;  2E8F A;  3AF6 A;  1ZB8 A;  4GS5 A;  4X64 C;  2DYJ A;  4LFA C;  2YCB A;  5LMU C;  1PG4 A;  3T1Y C;  1YJ7 A;  3FCC A;  1UKK A;  2EGT A;  5K85 A;  3IEV A;  1XNQ C;  2E0G A;  4D57 A;  3GR1 A;  3KXW A;  2P2M A;  2YWC A;  4DV5 C;  4BC7 A;  3S82 A;  4I9F A;  1USP A;  4AQY C;  2QVY X;  4R1M A;  3SO4 A;  4G1I A;  1K0R A;  1IBK C;  4GXQ A;  1USP B;  4DCU A;  2QVX X;  1HH2 P;  5BR8 C;  5BUR A;  4YY3 C;  4DV7 C;  3N54 B;  4EAT A;  5H9U A;  2D1S A;  1ULT A;  1MXC A;  4DR6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...