4X65C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4x65C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4x65C02
4B3MC 1HNWC 4KHPC 4AQYC 4GKJC 4K0KC 1N32C 4MTNA 1MKYA 4X65C 4LFBC 4DCVA 5A2QD 2ONFA 2ZM6C 5LMUC 4DV6C 4LF6C 2HJGA 2QL8A 4NOZA 4JI7C 2UXCC 1K0RA 2PN2A 4LF9C 2UUBC 4MH4A 4JYAC 1VLAA 1HR0C 1ZB9A 4XX2A 3T1YC 4YY3C 4DCUA 4DR4C 1WH9A 4JI3C 1UKKA 3OTOC 2DYJA 5FLXD 4B3SC 1ML8A 3JAMD 1KKGA 1NYEA 4DV3C 1N36C 4B3RC 2YCBA 1ZB8A 1IBLC 4DV2C 3J7AD 1USPA 4JI5C 5IT9D 4BSZA 1FJGC 4DV1C 4X64C 2OPLB 4DR7C 1XMOC 1QWIA 4LFAC 1N34C 4NXMC 3J80D 3CJEA 2UUAC 4LF8C 2F4VC 2UU9C 2UUCC 2UXBC 2ASBA 2HHHC 4DV0C 4JV5C 4X66C 1J5EC 1LQLA 4JI8C 3AF5A 2CXCA 4DR2C 4JI4C 2KZFA 2D7VA 4LF7C 2PT7G 1N33C 1L2FA 2E8FA 4LFCC 1HNXC 2CY1A 2BJOA 1HNZC 4DR1C 3R9WA 2E8CA 4DCTA 1USPB 4DV5C 1XMQC 5IWAC 4OX9C 3T1HC 3AF6A 3IEVA 4X62C 2VQFC 5LMNC 4LF4C 4JI0C 1EGAA 5BR8C 1WF3A 3R9XA 4GKKC 2VQEC 1N2FA 1PA4A 1I94C 4DR5C 2UXDC 2ATWA 1HH2P 4LF5C 2XR1A 3J81D 3IEUA 4JI2C 4JI1C 1IBMC 4DV4C 2E7GA 4DV7C 3GKUA 2E8EA 2EGTA 1XNQC 2OPLA 4DUYC 3I07A 4JI6C 1JOSA 3EERA 3LUSA 4NXNC 2JMPA 4DCSA 4B3TC 4DUZC 1XNRC 4YHHC 4DR3C 4DR6C 2E5LC 1IBKC
chains in the Genus database with same CATH superfamily
1HNWC 4AQYC 1N32C 1MKYA 4X65C 4LFBC 2DHMA 3E7WA 2ONFA 2YWBA 2Z51A 4LF6C 5BSTA 4JYAC 3VNSA 1VLAA 1HR0C 3TQIA 2ZZNA 1ZB9A 5CZXA 1ULTA 4YY3C 4DCUA 4DR4C 2DYJA 3L95X 5KYTA 1ML8A 3JAMD 1KKGA 4DV3C 1N36C 4B3RC 1ZB8A 4X64C 4L2ZA 4R1MA 4RLQA 4LFAC 2UUAC 2KZ0A 2UXBC 2OO4A 4BC9A 3LNVA 2HHHC 2VSQA 4DV0C 4X66C 1J5EC 2QVXX 2WP0C 3AF5A 3PROC 5BUSA 4DR2C 1XDXA 1M6XC 4D4GA 3A9UA 4I9FA 2BH1X 2JNVA 4LFCC 3H2TA 1HNXC 3VNRA 4OXIA 2D1QA 4DR1C 4DV5C 3CQ3A 5IWAC 2M5OA 3IEVA 2KDNA 5LMNC 1WF3A 4TPSB 3R9XA 1HH2P 3CW8X 3IEUA 2VZEA 3G7SA 2OBVA 1XRAA 4D56A 4BC7A 3GKUA 4DUYC 5BSMA 5BUQA 3FM7A 3C5EA 3A25A 5BSVA 3LAXA 2QW0X 4DR3C 4DR6C 1IBKC 3A9VA 4B3MC 1AMUA 2AYAA 4GS5A 4K0KC 5K85A 4MTNA 4RVNA 4DCVA 5A1GA 5A2QD 4BCAA 2M5HA 2ZZMA 4OYCA 4DV6C 4NOZA 4JI7C 1K0RA 4LF9C 2UUBC 4MH4A 2D28C 4XX2A 5K8FA 3UOWA 1WH9A 1P4EC 3RV2A 4FTFA 5LCIA 1TH5A 3RG2A 1NYEA 2YCBA 1IB8A 1IBLC 4DV2C 3J7AD 4JI5C 3K6RA 2YWCA 4KTTA 1RG9A 4DR7C 4U5YD 2P2QA 1N34C 1MDBA 3PBKA 4LF8C 3UEBA 2UUCC 4G37A 4FUTA 1LCIA 2P2BA 5BSUA 3DLPX 4PUGA 4JI4C 3GR0A 4ISBA 2PT7G 2QVZX 4D57A 1L2FA 4G36A 2E8FA 2PG1E 3O2EA 3A26A 3GPCA 5H9UA 3R9WA 1XMQC 4OX9C 1YJ7A 4JM1A 3VNQA 2VQFC 4JI0C 1EGAA 5IFIA 4IZ6A 4GKKC 5ADZA 1MXCA 2D1RA 1I94C 4DR5C 2Y4OA 3NI2A 4HPVA 2P2JA 4JI2C 2WD9A 5T8TA 2P20A 3TUFA 4JI1C 1MDFA 4DV4C 4G1IA 2E7GA 1V60A 3A4IA 2PROA 4D4IA 3DHVA 2OPLA 2MM9A 3I07A 4JI6C 1V25A 3AY0A 5CZVA 4DUZC 3B7WA 1XNRC 1FUGA 4YHHC 5A1IA 4GKJC 4PUIA 3CW9A 1T5DX 1PG3A 5KEIA 2ZM6C 2MCQA 3FCEA 4NDNA 2ZTBA 3IMLA 2PN2A 2D27A 4RM3A 5DV9A 4PHTA 4PROC 3T1YC 1XHJA 4JI3C 4GXRA 5FLXD 1V26A 4B3SC 1O93A 4ZJZA 4ODJA 2MMAB 1USPA 4LE5A 1RY2A 1FJGC 2OPLB 5T8SA 3UZ0A 5JRHA 3J80D 3UX2A 2UU9C 2ASBA 1O90A 3UX3A 3I08A 3N54B 5BURA 1LQLA 1M6XA 3GR1A 1GPMA 4PUHA 3ETOA 2D7VA 4R1LA 1T5HX 4LF7C 2Y4NA 1VEHA 3NYQA 3EQ6A 3L8CA 5E7QA 2YX1A 2CY1A 5KYVA 2BJOA 4FUQA 4R0MA 3R44A 1P7LA 3FCCA 1USPB 3LNOA 3T1HC 2QVYX 1FLOA 5BR8C 3CQ2A 4PZPA 1N2FA 3SO4A 4GXQA 5AE2A 3E7XA 1UWDA 2ATWA 5A19A 4LF5C 4EATA 1IBMC 4DG9A 4DV7C 2DPLA 4L7IA 1MD9A 1XNQC 2D1TA 1XRBA 2D1SA 3EERA 3LUSA 4NXNC 4DCSA 4WS9A 3TR3A 5BSWA 4ZLPA 4KHPC 3NPDA 1YGTA 4BBYA 5AE3A 5LMUC 5BSRA 2HJGA 2NCLA 2QL8A 1P4EA 2UXCC 1MXBA 3TDEA 1UKKA 3OTOC 2Y27A 2E0GA 3CQ1A 2P2MA 1XRCA 5IT9D 4BSZA 1O9TA 4DV1C 2V7BA 3LGXA 1QM4A 3IPLA 3KXWA 1XMOC 1QWIA 2P2FA 4NXMC 3CJEA 2F4VC 4RLFA 4K0BA 1BA3A 4JV5C 4KTVA 3N2QA 3S82A 4JI8C 2CU6A 2CXCA 2KZFA 4L4QA 1NY8A 4IR7A 1N33C 4WV3A 1HNZC 3ETCA 3DAYA 3PESA 5GTDA 2E8CA 4DCTA 3AF6A 4X62C 1O92A 2P02A 4LF4C 4RMNA 1WCJA 2VQEC 1PA4A 1MXAA 4I9GA 3NYRA 2XR1A 3J81D 1PG4A 4RVOA 1XS3A 4DG8A 2E8EA 2EGTA 1JOSA 1PU1A 2JMPA 4B3TC 2E5LC 4RM2A 2UXDC 5AE1A
chains in the Genus database with same CATH topology
1HNWC 4AQYC 1N32C 1MKYA 4X65C 4LFBC 3E7WA 2ONFA 2YWBA 4LF6C 5BSTA 4JYAC 3VNSA 1VLAA 1HR0C 3TQIA 1ZB9A 5CZXA 1ULTA 4YY3C 4DCUA 4DR4C 2DYJA 3L95X 5KYTA 1ML8A 3JAMD 1KKGA 4DV3C 1N36C 4B3RC 1ZB8A 4X64C 4L2ZA 4R1MA 4RLQA 4LFAC 2UUAC 2UXBC 2OO4A 4BC9A 3LNVA 2HHHC 2VSQA 4DV0C 4X66C 1J5EC 2QVXX 2WP0C 3AF5A 3PROC 5BUSA 4DR2C 4D4GA 3A9UA 4I9FA 2BH1X 4LFCC 3H2TA 1HNXC 3VNRA 4OXIA 2D1QA 4DR1C 4DV5C 5IWAC 3IEVA 5LMNC 1WF3A 4TPSB 3R9XA 1HH2P 3CW8X 3IEUA 2VZEA 3G7SA 2OBVA 1XRAA 4D56A 4BC7A 3GKUA 4DUYC 5BSMA 5BUQA 3C5EA 5BSVA 3LAXA 2QW0X 4DR3C 4DR6C 1IBKC 3A9VA 4B3MC 1AMUA 2AYAA 4GS5A 4K0KC 5K85A 4MTNA 4RVNA 4DCVA 5A1GA 5A2QD 4BCAA 4OYCA 4DV6C 4NOZA 4JI7C 1K0RA 4LF9C 2UUBC 4MH4A 2D28C 4XX2A 5K8FA 3UOWA 1WH9A 3RV2A 4FTFA 3RG2A 1NYEA 2YCBA 1IBLC 4DV2C 3J7AD 4JI5C 2YWCA 4KTTA 1RG9A 4DR7C 4U5YD 2P2QA 1N34C 1MDBA 3PBKA 4LF8C 2UUCC 4G37A 4FUTA 1LCIA 2P2BA 5BSUA 3DLPX 4JI4C 3GR0A 4ISBA 2PT7G 2QVZX 4D57A 1L2FA 4G36A 2E8FA 3GPCA 5H9UA 3R9WA 1XMQC 4OX9C 1YJ7A 4JM1A 3VNQA 2VQFC 4JI0C 1EGAA 5IFIA 4IZ6A 4GKKC 5ADZA 1MXCA 2D1RA 1I94C 4DR5C 2Y4OA 3NI2A 4HPVA 2P2JA 4JI2C 2WD9A 5T8TA 2P20A 3TUFA 4JI1C 1MDFA 4DV4C 4G1IA 2E7GA 3A4IA 2PROA 4D4IA 3DHVA 2OPLA 3I07A 4JI6C 1V25A 5CZVA 4DUZC 3B7WA 1XNRC 1FUGA 4YHHC 5A1IA 4GKJC 3CW9A 1T5DX 1PG3A 5KEIA 2ZM6C 3FCEA 4NDNA 3IMLA 2PN2A 2D27A 4RM3A 5DV9A 4PHTA 4PROC 3T1YC 4JI3C 4GXRA 5FLXD 1V26A 4B3SC 1O93A 4ZJZA 4ODJA 1USPA 4LE5A 1RY2A 1FJGC 2OPLB 5T8SA 3UZ0A 5JRHA 3J80D 2UU9C 2ASBA 1O90A 3I08A 3N54B 5BURA 1LQLA 3GR1A 1GPMA 3ETOA 2D7VA 4R1LA 1T5HX 4LF7C 2Y4NA 3NYQA 3EQ6A 3L8CA 5E7QA 2CY1A 5KYVA 2BJOA 4FUQA 4R0MA 3R44A 1P7LA 3FCCA 1USPB 3T1HC 2QVYX 5BR8C 4PZPA 1N2FA 3SO4A 4GXQA 5AE2A 3E7XA 2ATWA 5A19A 4LF5C 4EATA 1IBMC 4DG9A 4DV7C 2DPLA 4L7IA 1MD9A 1XNQC 2D1TA 1XRBA 2D1SA 3EERA 3LUSA 4NXNC 4DCSA 4WS9A 5BSWA 4ZLPA 4KHPC 3NPDA 4BBYA 5AE3A 5LMUC 5BSRA 2HJGA 2QL8A 2UXCC 1MXBA 3TDEA 1UKKA 3OTOC 2Y27A 2E0GA 2P2MA 1XRCA 5IT9D 4BSZA 1O9TA 4DV1C 2V7BA 3LGXA 1QM4A 3IPLA 3KXWA 1XMOC 1QWIA 2P2FA 4NXMC 3CJEA 2F4VC 4RLFA 4K0BA 1BA3A 4JV5C 4KTVA 3N2QA 3S82A 4JI8C 2CXCA 2KZFA 4L4QA 4IR7A 1N33C 4WV3A 1HNZC 3ETCA 3DAYA 3PESA 5GTDA 2E8CA 4DCTA 3AF6A 4X62C 1O92A 2P02A 4LF4C 4RMNA 2VQEC 1PA4A 1MXAA 4I9GA 3NYRA 2XR1A 3J81D 1PG4A 4RVOA 4DG8A 2E8EA 2EGTA 1JOSA 2JMPA 4B3TC 2E5LC 4RM2A 2UXDC 5AE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M C;  1HNW C;  4KHP C;  4AQY C;  4GKJ C;  4K0K C;  1N32 C;  4MTN A;  1MKY A;  4X65 C;  4LFB C;  4DCV A;  5A2Q D;  2ONF A;  2ZM6 C;  5LMU C;  4DV6 C;  4LF6 C;  2HJG A;  2QL8 A;  4NOZ A;  4JI7 C;  2UXC C;  1K0R A;  2PN2 A;  4LF9 C;  2UUB C;  4MH4 A;  4JYA C;  1VLA A;  1HR0 C;  1ZB9 A;  4XX2 A;  3T1Y C;  4YY3 C;  4DCU A;  4DR4 C;  1WH9 A;  4JI3 C;  1UKK A;  3OTO C;  2DYJ A;  5FLX D;  4B3S C;  1ML8 A;  3JAM D;  1KKG A;  1NYE A;  4DV3 C;  1N36 C;  4B3R C;  2YCB A;  1ZB8 A;  1IBL C;  4DV2 C;  3J7A D;  1USP A;  4JI5 C;  5IT9 D;  4BSZ A;  1FJG C;  4DV1 C;  4X64 C;  2OPL B;  4DR7 C;  1XMO C;  1QWI A;  4LFA C;  1N34 C;  4NXM C;  3J80 D;  3CJE A;  2UUA C;  4LF8 C;  2F4V C;  2UU9 C;  2UUC C;  2UXB C;  2ASB A;  2HHH C;  4DV0 C;  4JV5 C;  4X66 C;  1J5E C;  1LQL A;  4JI8 C;  3AF5 A;  2CXC A;  4DR2 C;  4JI4 C;  2KZF A;  2D7V A;  4LF7 C;  2PT7 G;  1N33 C;  1L2F A;  2E8F A;  4LFC C;  1HNX C;  2CY1 A;  2BJO A;  1HNZ C;  4DR1 C;  3R9W A;  2E8C A;  4DCT A;  1USP B;  4DV5 C;  1XMQ C;  5IWA C;  4OX9 C;  3T1H C;  3AF6 A;  3IEV A;  4X62 C;  2VQF C;  5LMN C;  4LF4 C;  4JI0 C;  1EGA A;  5BR8 C;  1WF3 A;  3R9X A;  4GKK C;  2VQE C;  1N2F A;  1PA4 A;  1I94 C;  4DR5 C;  2UXD C;  2ATW A;  1HH2 P;  4LF5 C;  2XR1 A;  3J81 D;  3IEU A;  4JI2 C;  4JI1 C;  1IBM C;  4DV4 C;  2E7G A;  4DV7 C;  3GKU A;  2E8E A;  2EGT A;  1XNQ C;  2OPL A;  4DUY C;  3I07 A;  4JI6 C;  1JOS A;  3EER A;  3LUS A;  4NXN C;  2JMP A;  4DCS A;  4B3T C;  4DUZ C;  1XNR C;  4YHH C;  4DR3 C;  4DR6 C;  2E5L C;  1IBK C; 
#chains in the Genus database with same CATH topology
 1HNW C;  4AQY C;  1N32 C;  1MKY A;  4X65 C;  4LFB C;  2DHM A;  3E7W A;  2ONF A;  2YWB A;  2Z51 A;  4LF6 C;  5BST A;  4JYA C;  3VNS A;  1VLA A;  1HR0 C;  3TQI A;  2ZZN A;  1ZB9 A;  5CZX A;  1ULT A;  4YY3 C;  4DCU A;  4DR4 C;  2DYJ A;  3L95 X;  5KYT A;  1ML8 A;  3JAM D;  1KKG A;  4DV3 C;  1N36 C;  4B3R C;  1ZB8 A;  4X64 C;  4L2Z A;  4R1M A;  4RLQ A;  4LFA C;  2UUA C;  2KZ0 A;  2UXB C;  2OO4 A;  4BC9 A;  3LNV A;  2HHH C;  2VSQ A;  4DV0 C;  4X66 C;  1J5E C;  2QVX X;  2WP0 C;  3AF5 A;  3PRO C;  5BUS A;  4DR2 C;  1XDX A;  1M6X C;  4D4G A;  3A9U A;  4I9F A;  2BH1 X;  2JNV A;  4LFC C;  3H2T A;  1HNX C;  3VNR A;  4OXI A;  2D1Q A;  4DR1 C;  4DV5 C;  3CQ3 A;  5IWA C;  2M5O A;  3IEV A;  2KDN A;  5LMN C;  1WF3 A;  4TPS B;  3R9X A;  1HH2 P;  3CW8 X;  3IEU A;  2VZE A;  3G7S A;  2OBV A;  1XRA A;  4D56 A;  4BC7 A;  3GKU A;  4DUY C;  5BSM A;  5BUQ A;  3FM7 A;  3C5E A;  3A25 A;  5BSV A;  3LAX A;  2QW0 X;  4DR3 C;  4DR6 C;  1IBK C;  3A9V A;  4B3M C;  1AMU A;  2AYA A;  4GS5 A;  4K0K C;  5K85 A;  4MTN A;  4RVN A;  4DCV A;  5A1G A;  5A2Q D;  4BCA A;  2M5H A;  2ZZM A;  4OYC A;  4DV6 C;  4NOZ A;  4JI7 C;  1K0R A;  4LF9 C;  2UUB C;  4MH4 A;  2D28 C;  4XX2 A;  5K8F A;  3UOW A;  1WH9 A;  1P4E C;  3RV2 A;  4FTF A;  5LCI A;  1TH5 A;  3RG2 A;  1NYE A;  2YCB A;  1IB8 A;  1IBL C;  4DV2 C;  3J7A D;  4JI5 C;  3K6R A;  2YWC A;  4KTT A;  1RG9 A;  4DR7 C;  4U5Y D;  2P2Q A;  1N34 C;  1MDB A;  3PBK A;  4LF8 C;  3UEB A;  2UUC C;  4G37 A;  4FUT A;  1LCI A;  2P2B A;  5BSU A;  3DLP X;  4PUG A;  4JI4 C;  3GR0 A;  4ISB A;  2PT7 G;  2QVZ X;  4D57 A;  1L2F A;  4G36 A;  2E8F A;  2PG1 E;  3O2E A;  3A26 A;  3GPC A;  5H9U A;  3R9W A;  1XMQ C;  4OX9 C;  1YJ7 A;  4JM1 A;  3VNQ A;  2VQF C;  4JI0 C;  1EGA A;  5IFI A;  4IZ6 A;  4GKK C;  5ADZ A;  1MXC A;  2D1R A;  1I94 C;  4DR5 C;  2Y4O A;  3NI2 A;  4HPV A;  2P2J A;  4JI2 C;  2WD9 A;  5T8T A;  2P20 A;  3TUF A;  4JI1 C;  1MDF A;  4DV4 C;  4G1I A;  2E7G A;  1V60 A;  3A4I A;  2PRO A;  4D4I A;  3DHV A;  2OPL A;  2MM9 A;  3I07 A;  4JI6 C;  1V25 A;  3AY0 A;  5CZV A;  4DUZ C;  3B7W A;  1XNR C;  1FUG A;  4YHH C;  5A1I A;  4GKJ C;  4PUI A;  3CW9 A;  1T5D X;  1PG3 A;  5KEI A;  2ZM6 C;  2MCQ A;  3FCE A;  4NDN A;  2ZTB A;  3IML A;  2PN2 A;  2D27 A;  4RM3 A;  5DV9 A;  4PHT A;  4PRO C;  3T1Y C;  1XHJ A;  4JI3 C;  4GXR A;  5FLX D;  1V26 A;  4B3S C;  1O93 A;  4ZJZ A;  4ODJ A;  2MMA B;  1USP A;  4LE5 A;  1RY2 A;  1FJG C;  2OPL B;  5T8S A;  3UZ0 A;  5JRH A;  3J80 D;  3UX2 A;  2UU9 C;  2ASB A;  1O90 A;  3UX3 A;  3I08 A;  3N54 B;  5BUR A;  1LQL A;  1M6X A;  3GR1 A;  1GPM A;  4PUH A;  3ETO A;  2D7V A;  4R1L A;  1T5H X;  4LF7 C;  2Y4N A;  1VEH A;  3NYQ A;  3EQ6 A;  3L8C A;  5E7Q A;  2YX1 A;  2CY1 A;  5KYV A;  2BJO A;  4FUQ A;  4R0M A;  3R44 A;  1P7L A;  3FCC A;  1USP B;  3LNO A;  3T1H C;  2QVY X;  1FLO A;  5BR8 C;  3CQ2 A;  4PZP A;  1N2F A;  3SO4 A;  4GXQ A;  5AE2 A;  3E7X A;  1UWD A;  2ATW A;  5A19 A;  4LF5 C;  4EAT A;  1IBM C;  4DG9 A;  4DV7 C;  2DPL A;  4L7I A;  1MD9 A;  1XNQ C;  2D1T A;  1XRB A;  2D1S A;  3EER A;  3LUS A;  4NXN C;  4DCS A;  4WS9 A;  3TR3 A;  5BSW A;  4ZLP A;  4KHP C;  3NPD A;  1YGT A;  4BBY A;  5AE3 A;  5LMU C;  5BSR A;  2HJG A;  2NCL A;  2QL8 A;  1P4E A;  2UXC C;  1MXB A;  3TDE A;  1UKK A;  3OTO C;  2Y27 A;  2E0G A;  3CQ1 A;  2P2M A;  1XRC A;  5IT9 D;  4BSZ A;  1O9T A;  4DV1 C;  2V7B A;  3LGX A;  1QM4 A;  3IPL A;  3KXW A;  1XMO C;  1QWI A;  2P2F A;  4NXM C;  3CJE A;  2F4V C;  4RLF A;  4K0B A;  1BA3 A;  4JV5 C;  4KTV A;  3N2Q A;  3S82 A;  4JI8 C;  2CU6 A;  2CXC A;  2KZF A;  4L4Q A;  1NY8 A;  4IR7 A;  1N33 C;  4WV3 A;  1HNZ C;  3ETC A;  3DAY A;  3PES A;  5GTD A;  2E8C A;  4DCT A;  3AF6 A;  4X62 C;  1O92 A;  2P02 A;  4LF4 C;  4RMN A;  1WCJ A;  2VQE C;  1PA4 A;  1MXA A;  4I9G A;  3NYR A;  2XR1 A;  3J81 D;  1PG4 A;  4RVO A;  1XS3 A;  4DG8 A;  2E8E A;  2EGT A;  1JOS A;  1PU1 A;  2JMP A;  4B3T C;  2E5L C;  4RM2 A;  2UXD C;  5AE1 A; 
#chains in the Genus database with same CATH homology
 1HNW C;  4AQY C;  1N32 C;  1MKY A;  4X65 C;  4LFB C;  3E7W A;  2ONF A;  2YWB A;  4LF6 C;  5BST A;  4JYA C;  3VNS A;  1VLA A;  1HR0 C;  3TQI A;  1ZB9 A;  5CZX A;  1ULT A;  4YY3 C;  4DCU A;  4DR4 C;  2DYJ A;  3L95 X;  5KYT A;  1ML8 A;  3JAM D;  1KKG A;  4DV3 C;  1N36 C;  4B3R C;  1ZB8 A;  4X64 C;  4L2Z A;  4R1M A;  4RLQ A;  4LFA C;  2UUA C;  2UXB C;  2OO4 A;  4BC9 A;  3LNV A;  2HHH C;  2VSQ A;  4DV0 C;  4X66 C;  1J5E C;  2QVX X;  2WP0 C;  3AF5 A;  3PRO C;  5BUS A;  4DR2 C;  4D4G A;  3A9U A;  4I9F A;  2BH1 X;  4LFC C;  3H2T A;  1HNX C;  3VNR A;  4OXI A;  2D1Q A;  4DR1 C;  4DV5 C;  5IWA C;  3IEV A;  5LMN C;  1WF3 A;  4TPS B;  3R9X A;  1HH2 P;  3CW8 X;  3IEU A;  2VZE A;  3G7S A;  2OBV A;  1XRA A;  4D56 A;  4BC7 A;  3GKU A;  4DUY C;  5BSM A;  5BUQ A;  3C5E A;  5BSV A;  3LAX A;  2QW0 X;  4DR3 C;  4DR6 C;  1IBK C;  3A9V A;  4B3M C;  1AMU A;  2AYA A;  4GS5 A;  4K0K C;  5K85 A;  4MTN A;  4RVN A;  4DCV A;  5A1G A;  5A2Q D;  4BCA A;  4OYC A;  4DV6 C;  4NOZ A;  4JI7 C;  1K0R A;  4LF9 C;  2UUB C;  4MH4 A;  2D28 C;  4XX2 A;  5K8F A;  3UOW A;  1WH9 A;  3RV2 A;  4FTF A;  3RG2 A;  1NYE A;  2YCB A;  1IBL C;  4DV2 C;  3J7A D;  4JI5 C;  2YWC A;  4KTT A;  1RG9 A;  4DR7 C;  4U5Y D;  2P2Q A;  1N34 C;  1MDB A;  3PBK A;  4LF8 C;  2UUC C;  4G37 A;  4FUT A;  1LCI A;  2P2B A;  5BSU A;  3DLP X;  4JI4 C;  3GR0 A;  4ISB A;  2PT7 G;  2QVZ X;  4D57 A;  1L2F A;  4G36 A;  2E8F A;  3GPC A;  5H9U A;  3R9W A;  1XMQ C;  4OX9 C;  1YJ7 A;  4JM1 A;  3VNQ A;  2VQF C;  4JI0 C;  1EGA A;  5IFI A;  4IZ6 A;  4GKK C;  5ADZ A;  1MXC A;  2D1R A;  1I94 C;  4DR5 C;  2Y4O A;  3NI2 A;  4HPV A;  2P2J A;  4JI2 C;  2WD9 A;  5T8T A;  2P20 A;  3TUF A;  4JI1 C;  1MDF A;  4DV4 C;  4G1I A;  2E7G A;  3A4I A;  2PRO A;  4D4I A;  3DHV A;  2OPL A;  3I07 A;  4JI6 C;  1V25 A;  5CZV A;  4DUZ C;  3B7W A;  1XNR C;  1FUG A;  4YHH C;  5A1I A;  4GKJ C;  3CW9 A;  1T5D X;  1PG3 A;  5KEI A;  2ZM6 C;  3FCE A;  4NDN A;  3IML A;  2PN2 A;  2D27 A;  4RM3 A;  5DV9 A;  4PHT A;  4PRO C;  3T1Y C;  4JI3 C;  4GXR A;  5FLX D;  1V26 A;  4B3S C;  1O93 A;  4ZJZ A;  4ODJ A;  1USP A;  4LE5 A;  1RY2 A;  1FJG C;  2OPL B;  5T8S A;  3UZ0 A;  5JRH A;  3J80 D;  2UU9 C;  2ASB A;  1O90 A;  3I08 A;  3N54 B;  5BUR A;  1LQL A;  3GR1 A;  1GPM A;  3ETO A;  2D7V A;  4R1L A;  1T5H X;  4LF7 C;  2Y4N A;  3NYQ A;  3EQ6 A;  3L8C A;  5E7Q A;  2CY1 A;  5KYV A;  2BJO A;  4FUQ A;  4R0M A;  3R44 A;  1P7L A;  3FCC A;  1USP B;  3T1H C;  2QVY X;  5BR8 C;  4PZP A;  1N2F A;  3SO4 A;  4GXQ A;  5AE2 A;  3E7X A;  2ATW A;  5A19 A;  4LF5 C;  4EAT A;  1IBM C;  4DG9 A;  4DV7 C;  2DPL A;  4L7I A;  1MD9 A;  1XNQ C;  2D1T A;  1XRB A;  2D1S A;  3EER A;  3LUS A;  4NXN C;  4DCS A;  4WS9 A;  5BSW A;  4ZLP A;  4KHP C;  3NPD A;  4BBY A;  5AE3 A;  5LMU C;  5BSR A;  2HJG A;  2QL8 A;  2UXC C;  1MXB A;  3TDE A;  1UKK A;  3OTO C;  2Y27 A;  2E0G A;  2P2M A;  1XRC A;  5IT9 D;  4BSZ A;  1O9T A;  4DV1 C;  2V7B A;  3LGX A;  1QM4 A;  3IPL A;  3KXW A;  1XMO C;  1QWI A;  2P2F A;  4NXM C;  3CJE A;  2F4V C;  4RLF A;  4K0B A;  1BA3 A;  4JV5 C;  4KTV A;  3N2Q A;  3S82 A;  4JI8 C;  2CXC A;  2KZF A;  4L4Q A;  4IR7 A;  1N33 C;  4WV3 A;  1HNZ C;  3ETC A;  3DAY A;  3PES A;  5GTD A;  2E8C A;  4DCT A;  3AF6 A;  4X62 C;  1O92 A;  2P02 A;  4LF4 C;  4RMN A;  2VQE C;  1PA4 A;  1MXA A;  4I9G A;  3NYR A;  2XR1 A;  3J81 D;  1PG4 A;  4RVO A;  4DG8 A;  2E8E A;  2EGT A;  1JOS A;  2JMP A;  4B3T C;  2E5L C;  4RM2 A;  2UXD C;  5AE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...