4X65C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4x65C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4x65C02
4DV4C 4LFAC 1JOSA 1KKGA 4DCSA 4DUYC 2E8EA 4B3TC 2E7GA 4JI2C 4YHHC 1ZB8A 1HR0C 2ASBA 3IEVA 2UXDC 4LF4C 2ZM6C 1XNRC 2DYJA 1HH2P 2PN2A 1N34C 4LF6C 1QWIA 4DV7C 4DR3C 4JI7C 2ATWA 4LFCC 1LQLA 3I07A 5IWAC 2D7VA 3EERA 4DR4C 4DV6C 2BJOA 1WH9A 3J7AD 3AF6A 2PT7G 4JYAC 5BR8C 2UUBC 3J80D 4DR5C 1N32C 2QL8A 1USPB 3T1YC 5IT9D 4B3RC 2OPLA 3CJEA 1VLAA 2CXCA 4NXMC 4X65C 2UXBC 1ZB9A 2YCBA 4GKJC 1N36C 2CY1A 3JAMD 3AF5A 1HNXC 4DV3C 4DV2C 2VQFC 4BSZA 4DV5C 4LF9C 4DUZC 2E8FA 2ONFA 4XX2A 3OTOC 4OX9C 4JV5C 1XNQC 4DR2C 1NYEA 1L2FA 2UUAC 4LF7C 2E8CA 1WF3A 1PA4A 4YY3C 2EGTA 2HJGA 4JI1C 1FJGC 4NOZA 4DR1C 4GKKC 5LMUC 1N33C 4JI4C 4DV0C 5LMNC 2UUCC 4JI8C 4LF8C 3T1HC 1I94C 1UKKA 3J81D 2KZFA 3GKUA 1IBMC 4NXNC 2F4VC 1HNWC 4K0KC 4X62C 4DR6C 5A2QD 2HHHC 1XMQC 4DR7C 4MTNA 1HNZC 2UU9C 1IBLC 3R9XA 4DCVA 4B3SC 4JI0C 4AQYC 4JI3C 4KHPC 2XR1A 4LFBC 3LUSA 4JI6C 2VQEC 2E5LC 4LF5C 5FLXD 1USPA 3R9WA 1XMOC 1J5EC 1MKYA 1K0RA 4X64C 1EGAA 4X66C 4MH4A 4DV1C 4B3MC 3IEUA 1IBKC 4JI5C 4DCTA 2JMPA 1N2FA 2UXCC 1ML8A 4DCUA 2OPLB
chains in the Genus database with same CATH superfamily
3UZ0A 4JI2C 2ASBA 3IEVA 1XNRC 4RLQA 2PN2A 4LF6C 5ADZA 3UOWA 4PZPA 3A9VA 4DV7C 1LQLA 3J7AD 3GR0A 4DV6C 3FCEA 3RV2A 5BR8C 2Z51A 3J80D 3IPLA 5KYTA 3TUFA 4B3RC 2OPLA 2P20A 1VLAA 4X65C 4L7IA 2YCBA 4GKJC 2Y27A 3AF5A 2WD9A 5A19A 2VQFC 4BSZA 4DV5C 2BH1X 5K85A 4XX2A 4L2ZA 1VEHA 3UX3A 1IB8A 1WF3A 4YY3C 2EGTA 3NYRA 4JI1C 3DLPX 4KTVA 5BUSA 4DR1C 5LMUC 1N33C 2AYAA 1UKKA 2CU6A 4PUIA 1XS3A 5IFIA 3L95X 2F4VC 1HNWC 5AE1A 1QM4A 4DR7C 4MTNA 1ULTA 2M5HA 4AQYC 3G7SA 1XHJA 2VQEC 1MD9A 1XRBA 2MM9A 2QVZX 1J5EC 5BURA 4X66C 2NCLA 1XDXA 1ML8A 4DCUA 2OPLB 3R44A 4LFAC 1JOSA 5H9UA 5T8SA 3H2TA 2E8EA 4G36A 2E7GA 4LE5A 1HR0C 2MMAB 1PG4A 2YX1A 2D1RA 3CQ1A 4R1MA 4JI7C 4DR3C 1RY2A 4GXQA 5BSVA 4LFCC 2ATWA 4FUQA 2BJOA 1P4EC 2UUBC 4DG9A 2D1SA 4RLFA 4TPSB 3KXWA 4IR7A 1UWDA 4RVOA 4RMNA 4NXMC 1GPMA 1M6XC 1N36C 4DV3C 3CW9A 3FCCA 4LF9C 1YJ7A 4DUZC 4BCAA 2E8FA 2ONFA 5CZXA 4RM3A 3OTOC 4OX9C 3L8CA 1NYEA 5BSUA 4LF7C 1XRAA 3GR1A 3FM7A 1MDFA 3LAXA 4PUGA 1PG3A 5AE3A 4JI4C 2VZEA 5KYVA 4LF8C 2OO4A 4PUHA 3A9UA 4D56A 2KZFA 2D27A 4NXNC 4G1IA 1V60A 4JM1A 4DR6C 2HHHC 2UU9C 1MDBA 1IBLC 4DCVA 4B3SC 4ZLPA 2M5OA 4KHPC 3TR3A 2PG1E 3LUSA 3S82A 4JI6C 4LF5C 5DV9A 3R9WA 1XMOC 1MKYA 1O93A 4NDNA 1T5DX 1EGAA 2P2JA 1WCJA 4MH4A 4DV1C 4B3MC 1BA3A 4DCTA 2V7BA 2Y4NA 5T8TA 1N2FA 4PHTA 1T5HX 1FUGA 4KTTA 4IZ6A 1O90A 4DV4C 4U5YD 4WS9A 1RG9A 4DCSA 5LCIA 4B3TC 2P2QA 1ZB8A 4YHHC 2UXDC 4LF4C 2ZM6C 1O9TA 1NY8A 5JRHA 1LCIA 1MXBA 1HH2P 4GXRA 1N34C 3LNOA 5IWAC 3TDEA 4DR4C 2PT7G 3E7WA 5K8FA 4DR5C 1N32C 4L4QA 3C5EA 4ODJA 3T1YC 3VNQA 3CQ2A 1XRCA 3CJEA 4G37A 1ZB9A 2CY1A 3DAYA 4DV2C 5BSTA 4BBYA 4D57A 4DR2C 3PESA 4GS5A 2UUAC 1V26A 4R1LA 4FTFA 1PA4A 3RG2A 2HJGA 1FJGC 4NOZA 2VSQA 2YWBA 3UEBA 2P2FA 4EATA 3VNSA 3AY0A 2ZZMA 4DV0C 5LMNC 4JI8C 1FLOA 3VNRA 3J81D 3GKUA 2JNVA 5BUQA 4K0KC 3NI2A 1MXCA 5A2QD 1XMQC 3K6RA 1HNZC 3R9XA 2WP0C 4JI0C 2ZTBA 4K0BA 2E0GA 3IMLA 1USPA 4ISBA 4X64C 3CW8X 3ETOA 3IEUA 4D4IA 4OYCA 2D28C 2JMPA 3A26A 5A1GA 4ZJZA 3DHVA 5E7QA 4WV3A 4D4GA 3CQ3A 3N54B 4PROC 1KKGA 4DUYC 4OXIA 3N2QA 2P2BA 2DYJA 2QVXX 3NYQA 1QWIA 1MXAA 3I07A 1P4EA 4FUTA 2D7VA 2KZ0A 3EERA 3LGXA 1WH9A 5BSMA 3AF6A 4JYAC 2D1QA 2P2MA 3GPCA 2QW0X 2QL8A 1USPB 5IT9D 2CXCA 2UXBC 4RVNA 3E7XA 4BC9A 2PROA 3JAMD 5KEIA 1HNXC 3A4IA 3LNVA 1V25A 4JV5C 1AMUA 4I9GA 1XNQC 3ETCA 1L2FA 2E8CA 3UX2A 4R0MA 2D1TA 3PBKA 3EQ6A 3PROC 2P02A 1M6XA 3I08A 4GKKC 4BC7A 2UUCC 5BSWA 3T1HC 1I94C 3NPDA 1IBMC 2ZZNA 2YWCA 3B7WA 1YGTA 5BSRA 2MCQA 4X62C 3A25A 1O92A 2DPLA 5A1IA 4JI3C 1PU1A 2XR1A 4LFBC 4I9FA 5AE2A 3O2EA 5GTDA 3TQIA 2KDNA 3SO4A 2E5LC 2OBVA 5FLXD 1TH5A 1K0RA 4RM2A 5CZVA 1P7LA 2QVYX 2DHMA 4HPVA 1IBKC 4JI5C 2UXCC 2Y4OA 4DG8A
chains in the Genus database with same CATH topology
3UZ0A 4JI2C 2ASBA 3IEVA 1XNRC 4RLQA 2PN2A 4LF6C 5ADZA 3UOWA 4PZPA 3A9VA 4DV7C 1LQLA 3J7AD 3GR0A 4DV6C 3FCEA 3RV2A 5BR8C 3J80D 3IPLA 5KYTA 3TUFA 4B3RC 2OPLA 2P20A 1VLAA 4X65C 4L7IA 2YCBA 4GKJC 2Y27A 3AF5A 2WD9A 5A19A 2VQFC 4BSZA 4DV5C 2BH1X 5K85A 4XX2A 4L2ZA 1WF3A 4YY3C 2EGTA 3NYRA 4JI1C 3DLPX 4KTVA 5BUSA 4DR1C 5LMUC 1N33C 2AYAA 1UKKA 5IFIA 3L95X 2F4VC 1HNWC 5AE1A 1QM4A 4DR7C 4MTNA 1ULTA 4AQYC 3G7SA 2VQEC 1MD9A 1XRBA 2QVZX 1J5EC 5BURA 4X66C 1ML8A 4DCUA 2OPLB 3R44A 4LFAC 1JOSA 5H9UA 5T8SA 3H2TA 2E8EA 4G36A 2E7GA 4LE5A 1HR0C 1PG4A 2D1RA 4R1MA 4JI7C 4DR3C 1RY2A 4GXQA 5BSVA 4LFCC 2ATWA 4FUQA 2BJOA 2UUBC 4DG9A 2D1SA 4RLFA 4TPSB 3KXWA 4IR7A 4RVOA 4RMNA 4NXMC 1GPMA 1N36C 4DV3C 3CW9A 3FCCA 4LF9C 1YJ7A 4DUZC 4BCAA 2E8FA 2ONFA 5CZXA 4RM3A 3OTOC 4OX9C 3L8CA 1NYEA 5BSUA 4LF7C 1XRAA 3GR1A 1MDFA 3LAXA 1PG3A 5AE3A 4JI4C 2VZEA 5KYVA 4LF8C 2OO4A 3A9UA 4D56A 2KZFA 2D27A 4NXNC 4G1IA 4JM1A 4DR6C 2HHHC 2UU9C 1MDBA 1IBLC 4DCVA 4B3SC 4ZLPA 4KHPC 3LUSA 3S82A 4JI6C 4LF5C 5DV9A 3R9WA 1XMOC 1MKYA 1O93A 4NDNA 1T5DX 1EGAA 2P2JA 4B3MC 4MH4A 4DV1C 1BA3A 4DCTA 2V7BA 2Y4NA 5T8TA 1N2FA 4PHTA 1T5HX 1FUGA 4KTTA 4IZ6A 1O90A 4DV4C 4U5YD 4WS9A 1RG9A 4DCSA 4B3TC 2P2QA 1ZB8A 4YHHC 2UXDC 4LF4C 2ZM6C 1O9TA 5JRHA 1LCIA 1MXBA 1HH2P 4GXRA 1N34C 5IWAC 3TDEA 4DR4C 2PT7G 3E7WA 5K8FA 4DR5C 1N32C 4L4QA 3C5EA 4ODJA 3T1YC 3VNQA 1XRCA 3CJEA 4G37A 1ZB9A 2CY1A 3DAYA 4DV2C 5BSTA 4BBYA 4D57A 4DR2C 3PESA 4GS5A 2UUAC 1V26A 4R1LA 4FTFA 1PA4A 3RG2A 2HJGA 1FJGC 4NOZA 2VSQA 2YWBA 2P2FA 4EATA 3VNSA 4DV0C 5LMNC 4JI8C 3VNRA 3J81D 3GKUA 5BUQA 4K0KC 3NI2A 1MXCA 5A2QD 1XMQC 1HNZC 3R9XA 2WP0C 4JI0C 4K0BA 2E0GA 3IMLA 1USPA 4ISBA 4X64C 3CW8X 3ETOA 3IEUA 4D4IA 4OYCA 2D28C 2JMPA 5A1GA 4ZJZA 3DHVA 5E7QA 4WV3A 4D4GA 3N54B 4PROC 1KKGA 4DUYC 4OXIA 3N2QA 2P2BA 2DYJA 2QVXX 3NYQA 1QWIA 1MXAA 3I07A 4FUTA 2D7VA 3EERA 3LGXA 1WH9A 5BSMA 3AF6A 4JYAC 2D1QA 2P2MA 3GPCA 2QW0X 2QL8A 1USPB 5IT9D 2CXCA 2UXBC 4RVNA 3E7XA 4BC9A 2PROA 3JAMD 5KEIA 1HNXC 3A4IA 3LNVA 1V25A 4JV5C 1AMUA 4I9GA 1XNQC 3ETCA 1L2FA 2E8CA 4R0MA 2D1TA 3PBKA 3EQ6A 3PROC 2P02A 3I08A 4GKKC 4BC7A 2UUCC 5BSWA 3T1HC 1I94C 3NPDA 1IBMC 2YWCA 3B7WA 5BSRA 4X62C 1O92A 2DPLA 5A1IA 4JI3C 2XR1A 4LFBC 4I9FA 5AE2A 5GTDA 3TQIA 3SO4A 2E5LC 2OBVA 5FLXD 1K0RA 4RM2A 5CZVA 1P7LA 2QVYX 1IBKC 4HPVA 4JI5C 2UXCC 2Y4OA 4DG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 C;  4LFA C;  1JOS A;  1KKG A;  4DCS A;  4DUY C;  2E8E A;  4B3T C;  2E7G A;  4JI2 C;  4YHH C;  1ZB8 A;  1HR0 C;  2ASB A;  3IEV A;  2UXD C;  4LF4 C;  2ZM6 C;  1XNR C;  2DYJ A;  1HH2 P;  2PN2 A;  1N34 C;  4LF6 C;  1QWI A;  4DV7 C;  4DR3 C;  4JI7 C;  2ATW A;  4LFC C;  1LQL A;  3I07 A;  5IWA C;  2D7V A;  3EER A;  4DR4 C;  4DV6 C;  2BJO A;  1WH9 A;  3J7A D;  3AF6 A;  2PT7 G;  4JYA C;  5BR8 C;  2UUB C;  3J80 D;  4DR5 C;  1N32 C;  2QL8 A;  1USP B;  3T1Y C;  5IT9 D;  4B3R C;  2OPL A;  3CJE A;  1VLA A;  2CXC A;  4NXM C;  4X65 C;  2UXB C;  1ZB9 A;  2YCB A;  4GKJ C;  1N36 C;  2CY1 A;  3JAM D;  3AF5 A;  1HNX C;  4DV3 C;  4DV2 C;  2VQF C;  4BSZ A;  4DV5 C;  4LF9 C;  4DUZ C;  2E8F A;  2ONF A;  4XX2 A;  3OTO C;  4OX9 C;  4JV5 C;  1XNQ C;  4DR2 C;  1NYE A;  1L2F A;  2UUA C;  4LF7 C;  2E8C A;  1WF3 A;  1PA4 A;  4YY3 C;  2EGT A;  2HJG A;  4JI1 C;  1FJG C;  4NOZ A;  4DR1 C;  4GKK C;  5LMU C;  1N33 C;  4JI4 C;  4DV0 C;  5LMN C;  2UUC C;  4JI8 C;  4LF8 C;  3T1H C;  1I94 C;  1UKK A;  3J81 D;  2KZF A;  3GKU A;  1IBM C;  4NXN C;  2F4V C;  1HNW C;  4K0K C;  4X62 C;  4DR6 C;  5A2Q D;  2HHH C;  1XMQ C;  4DR7 C;  4MTN A;  1HNZ C;  2UU9 C;  1IBL C;  3R9X A;  4DCV A;  4B3S C;  4JI0 C;  4AQY C;  4JI3 C;  4KHP C;  2XR1 A;  4LFB C;  3LUS A;  4JI6 C;  2VQE C;  2E5L C;  4LF5 C;  5FLX D;  1USP A;  3R9W A;  1XMO C;  1J5E C;  1MKY A;  1K0R A;  4X64 C;  1EGA A;  4X66 C;  4MH4 A;  4DV1 C;  4B3M C;  3IEU A;  1IBK C;  4JI5 C;  4DCT A;  2JMP A;  1N2F A;  2UXC C;  1ML8 A;  4DCU A;  2OPL B; 
#chains in the Genus database with same CATH topology
 3UZ0 A;  4JI2 C;  2ASB A;  3IEV A;  1XNR C;  4RLQ A;  2PN2 A;  4LF6 C;  5ADZ A;  3UOW A;  4PZP A;  3A9V A;  4DV7 C;  1LQL A;  3J7A D;  3GR0 A;  4DV6 C;  3FCE A;  3RV2 A;  5BR8 C;  2Z51 A;  3J80 D;  3IPL A;  5KYT A;  3TUF A;  4B3R C;  2OPL A;  2P20 A;  1VLA A;  4X65 C;  4L7I A;  2YCB A;  4GKJ C;  2Y27 A;  3AF5 A;  2WD9 A;  5A19 A;  2VQF C;  4BSZ A;  4DV5 C;  2BH1 X;  5K85 A;  4XX2 A;  4L2Z A;  1VEH A;  3UX3 A;  1IB8 A;  1WF3 A;  4YY3 C;  2EGT A;  3NYR A;  4JI1 C;  3DLP X;  4KTV A;  5BUS A;  4DR1 C;  5LMU C;  1N33 C;  2AYA A;  1UKK A;  2CU6 A;  4PUI A;  1XS3 A;  5IFI A;  3L95 X;  2F4V C;  1HNW C;  5AE1 A;  1QM4 A;  4DR7 C;  4MTN A;  1ULT A;  2M5H A;  4AQY C;  3G7S A;  1XHJ A;  2VQE C;  1MD9 A;  1XRB A;  2MM9 A;  2QVZ X;  1J5E C;  5BUR A;  4X66 C;  2NCL A;  1XDX A;  1ML8 A;  4DCU A;  2OPL B;  3R44 A;  4LFA C;  1JOS A;  5H9U A;  5T8S A;  3H2T A;  2E8E A;  4G36 A;  2E7G A;  4LE5 A;  1HR0 C;  2MMA B;  1PG4 A;  2YX1 A;  2D1R A;  3CQ1 A;  4R1M A;  4JI7 C;  4DR3 C;  1RY2 A;  4GXQ A;  5BSV A;  4LFC C;  2ATW A;  4FUQ A;  2BJO A;  1P4E C;  2UUB C;  4DG9 A;  2D1S A;  4RLF A;  4TPS B;  3KXW A;  4IR7 A;  1UWD A;  4RVO A;  4RMN A;  4NXM C;  1GPM A;  1M6X C;  1N36 C;  4DV3 C;  3CW9 A;  3FCC A;  4LF9 C;  1YJ7 A;  4DUZ C;  4BCA A;  2E8F A;  2ONF A;  5CZX A;  4RM3 A;  3OTO C;  4OX9 C;  3L8C A;  1NYE A;  5BSU A;  4LF7 C;  1XRA A;  3GR1 A;  3FM7 A;  1MDF A;  3LAX A;  4PUG A;  1PG3 A;  5AE3 A;  4JI4 C;  2VZE A;  5KYV A;  4LF8 C;  2OO4 A;  4PUH A;  3A9U A;  4D56 A;  2KZF A;  2D27 A;  4NXN C;  4G1I A;  1V60 A;  4JM1 A;  4DR6 C;  2HHH C;  2UU9 C;  1MDB A;  1IBL C;  4DCV A;  4B3S C;  4ZLP A;  2M5O A;  4KHP C;  3TR3 A;  2PG1 E;  3LUS A;  3S82 A;  4JI6 C;  4LF5 C;  5DV9 A;  3R9W A;  1XMO C;  1MKY A;  1O93 A;  4NDN A;  1T5D X;  1EGA A;  2P2J A;  1WCJ A;  4MH4 A;  4DV1 C;  4B3M C;  1BA3 A;  4DCT A;  2V7B A;  2Y4N A;  5T8T A;  1N2F A;  4PHT A;  1T5H X;  1FUG A;  4KTT A;  4IZ6 A;  1O90 A;  4DV4 C;  4U5Y D;  4WS9 A;  1RG9 A;  4DCS A;  5LCI A;  4B3T C;  2P2Q A;  1ZB8 A;  4YHH C;  2UXD C;  4LF4 C;  2ZM6 C;  1O9T A;  1NY8 A;  5JRH A;  1LCI A;  1MXB A;  1HH2 P;  4GXR A;  1N34 C;  3LNO A;  5IWA C;  3TDE A;  4DR4 C;  2PT7 G;  3E7W A;  5K8F A;  4DR5 C;  1N32 C;  4L4Q A;  3C5E A;  4ODJ A;  3T1Y C;  3VNQ A;  3CQ2 A;  1XRC A;  3CJE A;  4G37 A;  1ZB9 A;  2CY1 A;  3DAY A;  4DV2 C;  5BST A;  4BBY A;  4D57 A;  4DR2 C;  3PES A;  4GS5 A;  2UUA C;  1V26 A;  4R1L A;  4FTF A;  1PA4 A;  3RG2 A;  2HJG A;  1FJG C;  4NOZ A;  2VSQ A;  2YWB A;  3UEB A;  2P2F A;  4EAT A;  3VNS A;  3AY0 A;  2ZZM A;  4DV0 C;  5LMN C;  4JI8 C;  1FLO A;  3VNR A;  3J81 D;  3GKU A;  2JNV A;  5BUQ A;  4K0K C;  3NI2 A;  1MXC A;  5A2Q D;  1XMQ C;  3K6R A;  1HNZ C;  3R9X A;  2WP0 C;  4JI0 C;  2ZTB A;  4K0B A;  2E0G A;  3IML A;  1USP A;  4ISB A;  4X64 C;  3CW8 X;  3ETO A;  3IEU A;  4D4I A;  4OYC A;  2D28 C;  2JMP A;  3A26 A;  5A1G A;  4ZJZ A;  3DHV A;  5E7Q A;  4WV3 A;  4D4G A;  3CQ3 A;  3N54 B;  4PRO C;  1KKG A;  4DUY C;  4OXI A;  3N2Q A;  2P2B A;  2DYJ A;  2QVX X;  3NYQ A;  1QWI A;  1MXA A;  3I07 A;  1P4E A;  4FUT A;  2D7V A;  2KZ0 A;  3EER A;  3LGX A;  1WH9 A;  5BSM A;  3AF6 A;  4JYA C;  2D1Q A;  2P2M A;  3GPC A;  2QW0 X;  2QL8 A;  1USP B;  5IT9 D;  2CXC A;  2UXB C;  4RVN A;  3E7X A;  4BC9 A;  2PRO A;  3JAM D;  5KEI A;  1HNX C;  3A4I A;  3LNV A;  1V25 A;  4JV5 C;  1AMU A;  4I9G A;  1XNQ C;  3ETC A;  1L2F A;  2E8C A;  3UX2 A;  4R0M A;  2D1T A;  3PBK A;  3EQ6 A;  3PRO C;  2P02 A;  1M6X A;  3I08 A;  4GKK C;  4BC7 A;  2UUC C;  5BSW A;  3T1H C;  1I94 C;  3NPD A;  1IBM C;  2ZZN A;  2YWC A;  3B7W A;  1YGT A;  5BSR A;  2MCQ A;  4X62 C;  3A25 A;  1O92 A;  2DPL A;  5A1I A;  4JI3 C;  1PU1 A;  2XR1 A;  4LFB C;  4I9F A;  5AE2 A;  3O2E A;  5GTD A;  3TQI A;  2KDN A;  3SO4 A;  2E5L C;  2OBV A;  5FLX D;  1TH5 A;  1K0R A;  4RM2 A;  5CZV A;  1P7L A;  2QVY X;  2DHM A;  4HPV A;  1IBK C;  4JI5 C;  2UXC C;  2Y4O A;  4DG8 A; 
#chains in the Genus database with same CATH homology
 3UZ0 A;  4JI2 C;  2ASB A;  3IEV A;  1XNR C;  4RLQ A;  2PN2 A;  4LF6 C;  5ADZ A;  3UOW A;  4PZP A;  3A9V A;  4DV7 C;  1LQL A;  3J7A D;  3GR0 A;  4DV6 C;  3FCE A;  3RV2 A;  5BR8 C;  3J80 D;  3IPL A;  5KYT A;  3TUF A;  4B3R C;  2OPL A;  2P20 A;  1VLA A;  4X65 C;  4L7I A;  2YCB A;  4GKJ C;  2Y27 A;  3AF5 A;  2WD9 A;  5A19 A;  2VQF C;  4BSZ A;  4DV5 C;  2BH1 X;  5K85 A;  4XX2 A;  4L2Z A;  1WF3 A;  4YY3 C;  2EGT A;  3NYR A;  4JI1 C;  3DLP X;  4KTV A;  5BUS A;  4DR1 C;  5LMU C;  1N33 C;  2AYA A;  1UKK A;  5IFI A;  3L95 X;  2F4V C;  1HNW C;  5AE1 A;  1QM4 A;  4DR7 C;  4MTN A;  1ULT A;  4AQY C;  3G7S A;  2VQE C;  1MD9 A;  1XRB A;  2QVZ X;  1J5E C;  5BUR A;  4X66 C;  1ML8 A;  4DCU A;  2OPL B;  3R44 A;  4LFA C;  1JOS A;  5H9U A;  5T8S A;  3H2T A;  2E8E A;  4G36 A;  2E7G A;  4LE5 A;  1HR0 C;  1PG4 A;  2D1R A;  4R1M A;  4JI7 C;  4DR3 C;  1RY2 A;  4GXQ A;  5BSV A;  4LFC C;  2ATW A;  4FUQ A;  2BJO A;  2UUB C;  4DG9 A;  2D1S A;  4RLF A;  4TPS B;  3KXW A;  4IR7 A;  4RVO A;  4RMN A;  4NXM C;  1GPM A;  1N36 C;  4DV3 C;  3CW9 A;  3FCC A;  4LF9 C;  1YJ7 A;  4DUZ C;  4BCA A;  2E8F A;  2ONF A;  5CZX A;  4RM3 A;  3OTO C;  4OX9 C;  3L8C A;  1NYE A;  5BSU A;  4LF7 C;  1XRA A;  3GR1 A;  1MDF A;  3LAX A;  1PG3 A;  5AE3 A;  4JI4 C;  2VZE A;  5KYV A;  4LF8 C;  2OO4 A;  3A9U A;  4D56 A;  2KZF A;  2D27 A;  4NXN C;  4G1I A;  4JM1 A;  4DR6 C;  2HHH C;  2UU9 C;  1MDB A;  1IBL C;  4DCV A;  4B3S C;  4ZLP A;  4KHP C;  3LUS A;  3S82 A;  4JI6 C;  4LF5 C;  5DV9 A;  3R9W A;  1XMO C;  1MKY A;  1O93 A;  4NDN A;  1T5D X;  1EGA A;  2P2J A;  4B3M C;  4MH4 A;  4DV1 C;  1BA3 A;  4DCT A;  2V7B A;  2Y4N A;  5T8T A;  1N2F A;  4PHT A;  1T5H X;  1FUG A;  4KTT A;  4IZ6 A;  1O90 A;  4DV4 C;  4U5Y D;  4WS9 A;  1RG9 A;  4DCS A;  4B3T C;  2P2Q A;  1ZB8 A;  4YHH C;  2UXD C;  4LF4 C;  2ZM6 C;  1O9T A;  5JRH A;  1LCI A;  1MXB A;  1HH2 P;  4GXR A;  1N34 C;  5IWA C;  3TDE A;  4DR4 C;  2PT7 G;  3E7W A;  5K8F A;  4DR5 C;  1N32 C;  4L4Q A;  3C5E A;  4ODJ A;  3T1Y C;  3VNQ A;  1XRC A;  3CJE A;  4G37 A;  1ZB9 A;  2CY1 A;  3DAY A;  4DV2 C;  5BST A;  4BBY A;  4D57 A;  4DR2 C;  3PES A;  4GS5 A;  2UUA C;  1V26 A;  4R1L A;  4FTF A;  1PA4 A;  3RG2 A;  2HJG A;  1FJG C;  4NOZ A;  2VSQ A;  2YWB A;  2P2F A;  4EAT A;  3VNS A;  4DV0 C;  5LMN C;  4JI8 C;  3VNR A;  3J81 D;  3GKU A;  5BUQ A;  4K0K C;  3NI2 A;  1MXC A;  5A2Q D;  1XMQ C;  1HNZ C;  3R9X A;  2WP0 C;  4JI0 C;  4K0B A;  2E0G A;  3IML A;  1USP A;  4ISB A;  4X64 C;  3CW8 X;  3ETO A;  3IEU A;  4D4I A;  4OYC A;  2D28 C;  2JMP A;  5A1G A;  4ZJZ A;  3DHV A;  5E7Q A;  4WV3 A;  4D4G A;  3N54 B;  4PRO C;  1KKG A;  4DUY C;  4OXI A;  3N2Q A;  2P2B A;  2DYJ A;  2QVX X;  3NYQ A;  1QWI A;  1MXA A;  3I07 A;  4FUT A;  2D7V A;  3EER A;  3LGX A;  1WH9 A;  5BSM A;  3AF6 A;  4JYA C;  2D1Q A;  2P2M A;  3GPC A;  2QW0 X;  2QL8 A;  1USP B;  5IT9 D;  2CXC A;  2UXB C;  4RVN A;  3E7X A;  4BC9 A;  2PRO A;  3JAM D;  5KEI A;  1HNX C;  3A4I A;  3LNV A;  1V25 A;  4JV5 C;  1AMU A;  4I9G A;  1XNQ C;  3ETC A;  1L2F A;  2E8C A;  4R0M A;  2D1T A;  3PBK A;  3EQ6 A;  3PRO C;  2P02 A;  3I08 A;  4GKK C;  4BC7 A;  2UUC C;  5BSW A;  3T1H C;  1I94 C;  3NPD A;  1IBM C;  2YWC A;  3B7W A;  5BSR A;  4X62 C;  1O92 A;  2DPL A;  5A1I A;  4JI3 C;  2XR1 A;  4LFB C;  4I9F A;  5AE2 A;  5GTD A;  3TQI A;  3SO4 A;  2E5L C;  2OBV A;  5FLX D;  1K0R A;  4RM2 A;  5CZV A;  1P7L A;  2QVY X;  1IBK C;  4HPV A;  4JI5 C;  2UXC C;  2Y4O A;  4DG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...