4X65C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4x65C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4x65C02
4JI0C 4LF8C 4DR7C 1VLAA 2QL8A 2E8FA 2ASBA 1J5EC 4JI4C 3AF6A 3GKUA 1XNRC 4YY3C 4JI2C 4DR6C 3J7AD 5LMNC 1XNQC 4X66C 4DV6C 1QWIA 1USPA 1HH2P 4DCUA 1IBKC 4LFBC 4DR2C 1KKGA 5BR8C 2OPLB 4JI3C 3EERA 3IEUA 2PT7G 1I94C 2F4VC 4JI8C 4LF6C 4DR1C 4DUYC 1JOSA 1XMOC 1WH9A 2JMPA 2UUCC 4JI7C 2UU9C 4JI1C 4LFAC 2ONFA 4XX2A 4X65C 3IEVA 4X64C 2UXDC 1N33C 2D7VA 2BJOA 1L2FA 1N32C 1UKKA 4DR3C 4DV0C 3R9XA 4JI5C 4MTNA 4GKJC 2UUBC 4DCTA 2UXCC 3LUSA 4BSZA 5LMUC 2E8EA 2E7GA 4AQYC 4LFCC 2EGTA 2XR1A 3T1HC 1LQLA 2ZM6C 4DV4C 4NXMC 1FJGC 2UXBC 4NOZA 4DV5C 4DV2C 3OTOC 4DR5C 4B3TC 1ZB9A 2VQEC 1N34C 4OX9C 4NXNC 1USPB 1XMQC 5IT9D 2OPLA 5FLXD 1EGAA 2DYJA 4B3MC 1NYEA 1HNZC 2YCBA 2E8CA 4DR4C 4JV5C 3J80D 4KHPC 4MH4A 4DV7C 1K0RA 4DUZC 1ZB8A 1PA4A 4DV3C 2E5LC 4JI6C 4GKKC 4X62C 1N36C 3CJEA 3AF5A 4LF5C 1HNWC 4YHHC 4B3SC 4B3RC 2VQFC 5IWAC 4DV1C 1HR0C 1ML8A 3T1YC 4K0KC 2ATWA 2KZFA 1IBMC 1N2FA 3JAMD 4DCSA 3R9WA 4LF4C 4LF7C 5A2QD 2HJGA 3I07A 4DCVA 4JYAC 1WF3A 2CXCA 1IBLC 2UUAC 2PN2A 2CY1A 1HNXC 2HHHC 1MKYA 3J81D 4LF9C
chains in the Genus database with same CATH superfamily
1VEHA 2BH1X 4EATA 4DR7C 3O2EA 2ASBA 1J5EC 4OYCA 1RG9A 4JI4C 5IFIA 1XNRC 4JI2C 3J7AD 5LMNC 1XNQC 1USPA 4BBYA 4LFBC 3A25A 4ZLPA 2OPLB 5BSWA 2P2FA 3S82A 4PUGA 3IEUA 1I94C 3L8CA 4GXQA 4IR7A 1JOSA 4PHTA 1PG3A 2ONFA 4X65C 4X64C 2UXDC 4WV3A 5E7QA 2D7VA 1T5HX 2OBVA 3LNVA 4R0MA 5A1IA 4LE5A 1MXBA 2AYAA 4JM1A 1XHJA 5A19A 2E8EA 2KZ0A 3N2QA 3LNOA 2YWCA 3TR3A 1FJGC 5BSMA 5H9UA 3PESA 4DV2C 4DR5C 4B3TC 4OX9C 1MDFA 3DLPX 2M5HA 4NXNC 1USPB 3G7SA 5CZVA 4G1IA 3IPLA 1UWDA 5T8SA 5GTDA 3UZ0A 2D1QA 1YJ7A 2MMAB 4DV7C 3FCCA 3EQ6A 3CW9A 4L2ZA 1K0RA 4DUZC 1PA4A 4DV3C 2E5LC 4I9GA 1BA3A 4LF5C 1XS3A 4FUQA 1M6XC 1NY8A 2VQFC 4DV1C 1ML8A 4RLQA 2D1RA 1N2FA 3JAMD 2YWBA 1XDXA 2P2JA 3I07A 1IBLC 1O92A 3CQ3A 1M6XA 3FM7A 5LCIA 3UX2A 5AE2A 3A9UA 3AF6A 4I9FA 1YGTA 3GKUA 4K0BA 2WP0C 4YY3C 2D28C 4DR6C 1P4EC 4X66C 1QWIA 1IBKC 4FUTA 4DR2C 1KKGA 5K8FA 3ETCA 2QVZX 4JI3C 3EERA 3TQIA 1P4EA 3NPDA 1MD9A 5KYTA 3CW8X 2UUCC 3GPCA 1O93A 2P2QA 5K85A 1N33C 1L2FA 4DR3C 4IZ6A 4JI5C 5ADZA 2UUBC 3VNRA 2Y4NA 4G36A 4BSZA 5LMUC 4L4QA 2E7GA 4AQYC 2MCQA 4LFCC 2XR1A 4HPVA 1PU1A 1LQLA 1LCIA 4OXIA 4NOZA 4DV5C 1TH5A 2NCLA 5CZXA 3A26A 4L7IA 1EGAA 2PG1E 3PBKA 2DPLA 5BSUA 4DR4C 4MH4A 1XRAA 3K6RA 1IB8A 2M5OA 2PROA 1ZB8A 5BURA 3AF5A 1HNWC 5BSRA 4B3RC 1HR0C 3DAYA 2KZFA 1IBMC 3GR1A 3UOWA 4DCSA 4LF4C 1MXAA 5A2QD 4DCVA 4JYAC 4RMNA 2CXCA 3L95X 2UUAC 1HNXC 3J81D 1P7LA 2DHMA 4LF9C 4JI0C 4LF8C 1O90A 4PUIA 1VLAA 2QL8A 3SO4A 4RM2A 3TUFA 5AE3A 4D4IA 4DG9A 2KDNA 4G37A 3UEBA 4DCUA 2V7BA 5BR8C 3H2TA 2PT7G 4JI8C 4DR1C 4DUYC 1XRBA 2MM9A 2JMPA 2Y27A 4JI7C 4XX2A 3VNSA 3R9XA 4DV0C 2YX1A 2VZEA 4MTNA 2VSQA 2Z51A 4FTFA 3LGXA 4RLFA 4U5YD 2QVYX 2ZM6C 4NXMC 5BUQA 2UXBC 4RVOA 3FCEA 2VQEC 1N34C 1PG4A 5BUSA 4GXRA 1QM4A 5IT9D 5FLXD 3A9VA 2DYJA 4B3MC 1V25A 1NYEA 1HNZC 2YCBA 4KTVA 4KHPC 2Y4OA 3GR0A 3IMLA 3B7WA 4X62C 3R44A 1N36C 1AMUA 1O9TA 2D1TA 4ODJA 3VNQA 4YHHC 4B3SC 1WCJA 3T1YC 2E0GA 2WD9A 3LAXA 4LF7C 3DHVA 2HJGA 5AE1A 2CY1A 5A1GA 1MKYA 4PUHA 1XMOC 1XRCA 3RG2A 3A4IA 2E8FA 1MXCA 2JNVA 5T8TA 4R1MA 4DV6C 1HH2P 3PROC 2D27A 5KYVA 3ETOA 3I08A 3E7XA 4KTTA 4D57A 1FLOA 4DG8A 2F4VC 4LF6C 1V60A 1WH9A 2UU9C 4JI1C 4LFAC 3IEVA 3AY0A 2BJOA 1N32C 3NYRA 1UKKA 4GKJC 4PROC 4BC7A 2ZZMA 1V26A 2P20A 3NI2A 2P02A 4RVNA 2CU6A 4BCAA 4DCTA 2UXCC 3LUSA 4WS9A 4PZPA 1FUGA 2P2MA 2D1SA 3UX3A 2EGTA 4D56A 3T1HC 4ZJZA 5BSTA 3RV2A 4DV4C 3CQ1A 4D4GA 2OO4A 4BC9A 3NYQA 1MDBA 5KEIA 3OTOC 1ZB9A 1T5DX 3KXWA 2P2BA 1XMQC 4NDNA 4ISBA 2OPLA 5DV9A 1ULTA 3N54B 2E8CA 2ZTBA 4JV5C 3J80D 4GS5A 4JI6C 1GPMA 4GKKC 2QW0X 3CJEA 2QVXX 5BSVA 1RY2A 5IWAC 4K0KC 2ZZNA 2ATWA 3R9WA 3C5EA 4RM3A 4R1LA 3E7WA 1WF3A 2PN2A 3TDEA 3CQ2A 5JRHA 2HHHC 4TPSB
chains in the Genus database with same CATH topology
2BH1X 4EATA 4DR7C 2ASBA 1J5EC 4OYCA 1RG9A 4JI4C 5IFIA 1XNRC 4JI2C 3J7AD 5LMNC 1XNQC 1USPA 4BBYA 4LFBC 4ZLPA 2OPLB 5BSWA 2P2FA 3S82A 3IEUA 1I94C 3L8CA 4GXQA 4IR7A 1JOSA 4PHTA 1PG3A 2ONFA 4X65C 4X64C 2UXDC 4WV3A 5E7QA 2D7VA 1T5HX 2OBVA 3LNVA 4R0MA 5A1IA 4LE5A 1MXBA 2AYAA 4JM1A 5A19A 2E8EA 3N2QA 2YWCA 1FJGC 5BSMA 5H9UA 3PESA 4DV2C 4DR5C 4B3TC 4OX9C 1MDFA 3DLPX 4NXNC 1USPB 3G7SA 5CZVA 4G1IA 3IPLA 5T8SA 5GTDA 3UZ0A 2D1QA 1YJ7A 4DV7C 3FCCA 3EQ6A 3CW9A 4L2ZA 1K0RA 4DUZC 1PA4A 4DV3C 2E5LC 4I9GA 1BA3A 4LF5C 4FUQA 2VQFC 4DV1C 1ML8A 4RLQA 2D1RA 1N2FA 3JAMD 2YWBA 2P2JA 3I07A 1IBLC 1O92A 5AE2A 3A9UA 3AF6A 4I9FA 3GKUA 4K0BA 2WP0C 4YY3C 2D28C 4DR6C 4X66C 1QWIA 1IBKC 4FUTA 4DR2C 1KKGA 5K8FA 3ETCA 2QVZX 4JI3C 3EERA 3TQIA 3NPDA 1MD9A 5KYTA 3CW8X 2UUCC 3GPCA 1O93A 2P2QA 5K85A 1N33C 1L2FA 4DR3C 4IZ6A 4JI5C 5ADZA 2UUBC 3VNRA 2Y4NA 4G36A 4BSZA 5LMUC 4L4QA 2E7GA 4AQYC 4LFCC 2XR1A 4HPVA 1LQLA 1LCIA 4OXIA 4NOZA 4DV5C 5CZXA 4L7IA 1EGAA 3PBKA 2DPLA 5BSUA 4DR4C 4MH4A 1XRAA 2PROA 1ZB8A 5BURA 3AF5A 1HNWC 5BSRA 4B3RC 1HR0C 3DAYA 2KZFA 1IBMC 3GR1A 3UOWA 4DCSA 4LF4C 1MXAA 5A2QD 4DCVA 4JYAC 4RMNA 2CXCA 3L95X 2UUAC 1HNXC 3J81D 1P7LA 4LF9C 4JI0C 4LF8C 1O90A 1VLAA 2QL8A 3SO4A 4RM2A 3TUFA 5AE3A 4D4IA 4DG9A 4G37A 4DCUA 2V7BA 5BR8C 3H2TA 2PT7G 4JI8C 4DR1C 4DUYC 1XRBA 2JMPA 2Y27A 4JI7C 4XX2A 3VNSA 3R9XA 4DV0C 2VZEA 4MTNA 2VSQA 4FTFA 3LGXA 4RLFA 4U5YD 2QVYX 2ZM6C 4NXMC 5BUQA 2UXBC 4RVOA 3FCEA 2VQEC 1N34C 1PG4A 5BUSA 4GXRA 1QM4A 5IT9D 5FLXD 3A9VA 2DYJA 4B3MC 1V25A 1NYEA 1HNZC 2YCBA 4KTVA 4KHPC 2Y4OA 3GR0A 3IMLA 3B7WA 4X62C 3R44A 1N36C 1AMUA 1O9TA 2D1TA 4ODJA 3VNQA 4YHHC 4B3SC 3T1YC 2E0GA 2WD9A 3LAXA 4LF7C 3DHVA 2HJGA 5AE1A 2CY1A 5A1GA 1XMOC 1MKYA 1XRCA 3RG2A 3A4IA 2E8FA 1MXCA 5T8TA 4R1MA 4DV6C 1HH2P 3PROC 2D27A 5KYVA 3ETOA 3I08A 3E7XA 4KTTA 4D57A 4DG8A 2F4VC 4LF6C 1WH9A 2UU9C 4JI1C 4LFAC 3IEVA 2BJOA 1N32C 3NYRA 1UKKA 4GKJC 4PROC 4BC7A 1V26A 2P20A 3NI2A 2P02A 4RVNA 4BCAA 4DCTA 2UXCC 3LUSA 4WS9A 4PZPA 1FUGA 2P2MA 2D1SA 2EGTA 4D56A 3T1HC 4ZJZA 5BSTA 3RV2A 4DV4C 4D4GA 2OO4A 4BC9A 3NYQA 1MDBA 5KEIA 3OTOC 1ZB9A 1T5DX 3KXWA 2P2BA 1XMQC 4NDNA 4ISBA 2OPLA 5DV9A 1ULTA 3N54B 2E8CA 4JV5C 3J80D 4GS5A 4JI6C 1GPMA 4GKKC 2QW0X 3CJEA 2QVXX 5BSVA 1RY2A 5IWAC 4K0KC 2ATWA 3R9WA 3C5EA 4RM3A 4R1LA 3E7WA 1WF3A 2PN2A 3TDEA 5JRHA 2HHHC 4TPSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 C;  4LF8 C;  4DR7 C;  1VLA A;  2QL8 A;  2E8F A;  2ASB A;  1J5E C;  4JI4 C;  3AF6 A;  3GKU A;  1XNR C;  4YY3 C;  4JI2 C;  4DR6 C;  3J7A D;  5LMN C;  1XNQ C;  4X66 C;  4DV6 C;  1QWI A;  1USP A;  1HH2 P;  4DCU A;  1IBK C;  4LFB C;  4DR2 C;  1KKG A;  5BR8 C;  2OPL B;  4JI3 C;  3EER A;  3IEU A;  2PT7 G;  1I94 C;  2F4V C;  4JI8 C;  4LF6 C;  4DR1 C;  4DUY C;  1JOS A;  1XMO C;  1WH9 A;  2JMP A;  2UUC C;  4JI7 C;  2UU9 C;  4JI1 C;  4LFA C;  2ONF A;  4XX2 A;  4X65 C;  3IEV A;  4X64 C;  2UXD C;  1N33 C;  2D7V A;  2BJO A;  1L2F A;  1N32 C;  1UKK A;  4DR3 C;  4DV0 C;  3R9X A;  4JI5 C;  4MTN A;  4GKJ C;  2UUB C;  4DCT A;  2UXC C;  3LUS A;  4BSZ A;  5LMU C;  2E8E A;  2E7G A;  4AQY C;  4LFC C;  2EGT A;  2XR1 A;  3T1H C;  1LQL A;  2ZM6 C;  4DV4 C;  4NXM C;  1FJG C;  2UXB C;  4NOZ A;  4DV5 C;  4DV2 C;  3OTO C;  4DR5 C;  4B3T C;  1ZB9 A;  2VQE C;  1N34 C;  4OX9 C;  4NXN C;  1USP B;  1XMQ C;  5IT9 D;  2OPL A;  5FLX D;  1EGA A;  2DYJ A;  4B3M C;  1NYE A;  1HNZ C;  2YCB A;  2E8C A;  4DR4 C;  4JV5 C;  3J80 D;  4KHP C;  4MH4 A;  4DV7 C;  1K0R A;  4DUZ C;  1ZB8 A;  1PA4 A;  4DV3 C;  2E5L C;  4JI6 C;  4GKK C;  4X62 C;  1N36 C;  3CJE A;  3AF5 A;  4LF5 C;  1HNW C;  4YHH C;  4B3S C;  4B3R C;  2VQF C;  5IWA C;  4DV1 C;  1HR0 C;  1ML8 A;  3T1Y C;  4K0K C;  2ATW A;  2KZF A;  1IBM C;  1N2F A;  3JAM D;  4DCS A;  3R9W A;  4LF4 C;  4LF7 C;  5A2Q D;  2HJG A;  3I07 A;  4DCV A;  4JYA C;  1WF3 A;  2CXC A;  1IBL C;  2UUA C;  2PN2 A;  2CY1 A;  1HNX C;  2HHH C;  1MKY A;  3J81 D;  4LF9 C; 
#chains in the Genus database with same CATH topology
 1VEH A;  2BH1 X;  4EAT A;  4DR7 C;  3O2E A;  2ASB A;  1J5E C;  4OYC A;  1RG9 A;  4JI4 C;  5IFI A;  1XNR C;  4JI2 C;  3J7A D;  5LMN C;  1XNQ C;  1USP A;  4BBY A;  4LFB C;  3A25 A;  4ZLP A;  2OPL B;  5BSW A;  2P2F A;  3S82 A;  4PUG A;  3IEU A;  1I94 C;  3L8C A;  4GXQ A;  4IR7 A;  1JOS A;  4PHT A;  1PG3 A;  2ONF A;  4X65 C;  4X64 C;  2UXD C;  4WV3 A;  5E7Q A;  2D7V A;  1T5H X;  2OBV A;  3LNV A;  4R0M A;  5A1I A;  4LE5 A;  1MXB A;  2AYA A;  4JM1 A;  1XHJ A;  5A19 A;  2E8E A;  2KZ0 A;  3N2Q A;  3LNO A;  2YWC A;  3TR3 A;  1FJG C;  5BSM A;  5H9U A;  3PES A;  4DV2 C;  4DR5 C;  4B3T C;  4OX9 C;  1MDF A;  3DLP X;  2M5H A;  4NXN C;  1USP B;  3G7S A;  5CZV A;  4G1I A;  3IPL A;  1UWD A;  5T8S A;  5GTD A;  3UZ0 A;  2D1Q A;  1YJ7 A;  2MMA B;  4DV7 C;  3FCC A;  3EQ6 A;  3CW9 A;  4L2Z A;  1K0R A;  4DUZ C;  1PA4 A;  4DV3 C;  2E5L C;  4I9G A;  1BA3 A;  4LF5 C;  1XS3 A;  4FUQ A;  1M6X C;  1NY8 A;  2VQF C;  4DV1 C;  1ML8 A;  4RLQ A;  2D1R A;  1N2F A;  3JAM D;  2YWB A;  1XDX A;  2P2J A;  3I07 A;  1IBL C;  1O92 A;  3CQ3 A;  1M6X A;  3FM7 A;  5LCI A;  3UX2 A;  5AE2 A;  3A9U A;  3AF6 A;  4I9F A;  1YGT A;  3GKU A;  4K0B A;  2WP0 C;  4YY3 C;  2D28 C;  4DR6 C;  1P4E C;  4X66 C;  1QWI A;  1IBK C;  4FUT A;  4DR2 C;  1KKG A;  5K8F A;  3ETC A;  2QVZ X;  4JI3 C;  3EER A;  3TQI A;  1P4E A;  3NPD A;  1MD9 A;  5KYT A;  3CW8 X;  2UUC C;  3GPC A;  1O93 A;  2P2Q A;  5K85 A;  1N33 C;  1L2F A;  4DR3 C;  4IZ6 A;  4JI5 C;  5ADZ A;  2UUB C;  3VNR A;  2Y4N A;  4G36 A;  4BSZ A;  5LMU C;  4L4Q A;  2E7G A;  4AQY C;  2MCQ A;  4LFC C;  2XR1 A;  4HPV A;  1PU1 A;  1LQL A;  1LCI A;  4OXI A;  4NOZ A;  4DV5 C;  1TH5 A;  2NCL A;  5CZX A;  3A26 A;  4L7I A;  1EGA A;  2PG1 E;  3PBK A;  2DPL A;  5BSU A;  4DR4 C;  4MH4 A;  1XRA A;  3K6R A;  1IB8 A;  2M5O A;  2PRO A;  1ZB8 A;  5BUR A;  3AF5 A;  1HNW C;  5BSR A;  4B3R C;  1HR0 C;  3DAY A;  2KZF A;  1IBM C;  3GR1 A;  3UOW A;  4DCS A;  4LF4 C;  1MXA A;  5A2Q D;  4DCV A;  4JYA C;  4RMN A;  2CXC A;  3L95 X;  2UUA C;  1HNX C;  3J81 D;  1P7L A;  2DHM A;  4LF9 C;  4JI0 C;  4LF8 C;  1O90 A;  4PUI A;  1VLA A;  2QL8 A;  3SO4 A;  4RM2 A;  3TUF A;  5AE3 A;  4D4I A;  4DG9 A;  2KDN A;  4G37 A;  3UEB A;  4DCU A;  2V7B A;  5BR8 C;  3H2T A;  2PT7 G;  4JI8 C;  4DR1 C;  4DUY C;  1XRB A;  2MM9 A;  2JMP A;  2Y27 A;  4JI7 C;  4XX2 A;  3VNS A;  3R9X A;  4DV0 C;  2YX1 A;  2VZE A;  4MTN A;  2VSQ A;  2Z51 A;  4FTF A;  3LGX A;  4RLF A;  4U5Y D;  2QVY X;  2ZM6 C;  4NXM C;  5BUQ A;  2UXB C;  4RVO A;  3FCE A;  2VQE C;  1N34 C;  1PG4 A;  5BUS A;  4GXR A;  1QM4 A;  5IT9 D;  5FLX D;  3A9V A;  2DYJ A;  4B3M C;  1V25 A;  1NYE A;  1HNZ C;  2YCB A;  4KTV A;  4KHP C;  2Y4O A;  3GR0 A;  3IML A;  3B7W A;  4X62 C;  3R44 A;  1N36 C;  1AMU A;  1O9T A;  2D1T A;  4ODJ A;  3VNQ A;  4YHH C;  4B3S C;  1WCJ A;  3T1Y C;  2E0G A;  2WD9 A;  3LAX A;  4LF7 C;  3DHV A;  2HJG A;  5AE1 A;  2CY1 A;  5A1G A;  1MKY A;  4PUH A;  1XMO C;  1XRC A;  3RG2 A;  3A4I A;  2E8F A;  1MXC A;  2JNV A;  5T8T A;  4R1M A;  4DV6 C;  1HH2 P;  3PRO C;  2D27 A;  5KYV A;  3ETO A;  3I08 A;  3E7X A;  4KTT A;  4D57 A;  1FLO A;  4DG8 A;  2F4V C;  4LF6 C;  1V60 A;  1WH9 A;  2UU9 C;  4JI1 C;  4LFA C;  3IEV A;  3AY0 A;  2BJO A;  1N32 C;  3NYR A;  1UKK A;  4GKJ C;  4PRO C;  4BC7 A;  2ZZM A;  1V26 A;  2P20 A;  3NI2 A;  2P02 A;  4RVN A;  2CU6 A;  4BCA A;  4DCT A;  2UXC C;  3LUS A;  4WS9 A;  4PZP A;  1FUG A;  2P2M A;  2D1S A;  3UX3 A;  2EGT A;  4D56 A;  3T1H C;  4ZJZ A;  5BST A;  3RV2 A;  4DV4 C;  3CQ1 A;  4D4G A;  2OO4 A;  4BC9 A;  3NYQ A;  1MDB A;  5KEI A;  3OTO C;  1ZB9 A;  1T5D X;  3KXW A;  2P2B A;  1XMQ C;  4NDN A;  4ISB A;  2OPL A;  5DV9 A;  1ULT A;  3N54 B;  2E8C A;  2ZTB A;  4JV5 C;  3J80 D;  4GS5 A;  4JI6 C;  1GPM A;  4GKK C;  2QW0 X;  3CJE A;  2QVX X;  5BSV A;  1RY2 A;  5IWA C;  4K0K C;  2ZZN A;  2ATW A;  3R9W A;  3C5E A;  4RM3 A;  4R1L A;  3E7W A;  1WF3 A;  2PN2 A;  3TDE A;  3CQ2 A;  5JRH A;  2HHH C;  4TPS B; 
#chains in the Genus database with same CATH homology
 2BH1 X;  4EAT A;  4DR7 C;  2ASB A;  1J5E C;  4OYC A;  1RG9 A;  4JI4 C;  5IFI A;  1XNR C;  4JI2 C;  3J7A D;  5LMN C;  1XNQ C;  1USP A;  4BBY A;  4LFB C;  4ZLP A;  2OPL B;  5BSW A;  2P2F A;  3S82 A;  3IEU A;  1I94 C;  3L8C A;  4GXQ A;  4IR7 A;  1JOS A;  4PHT A;  1PG3 A;  2ONF A;  4X65 C;  4X64 C;  2UXD C;  4WV3 A;  5E7Q A;  2D7V A;  1T5H X;  2OBV A;  3LNV A;  4R0M A;  5A1I A;  4LE5 A;  1MXB A;  2AYA A;  4JM1 A;  5A19 A;  2E8E A;  3N2Q A;  2YWC A;  1FJG C;  5BSM A;  5H9U A;  3PES A;  4DV2 C;  4DR5 C;  4B3T C;  4OX9 C;  1MDF A;  3DLP X;  4NXN C;  1USP B;  3G7S A;  5CZV A;  4G1I A;  3IPL A;  5T8S A;  5GTD A;  3UZ0 A;  2D1Q A;  1YJ7 A;  4DV7 C;  3FCC A;  3EQ6 A;  3CW9 A;  4L2Z A;  1K0R A;  4DUZ C;  1PA4 A;  4DV3 C;  2E5L C;  4I9G A;  1BA3 A;  4LF5 C;  4FUQ A;  2VQF C;  4DV1 C;  1ML8 A;  4RLQ A;  2D1R A;  1N2F A;  3JAM D;  2YWB A;  2P2J A;  3I07 A;  1IBL C;  1O92 A;  5AE2 A;  3A9U A;  3AF6 A;  4I9F A;  3GKU A;  4K0B A;  2WP0 C;  4YY3 C;  2D28 C;  4DR6 C;  4X66 C;  1QWI A;  1IBK C;  4FUT A;  4DR2 C;  1KKG A;  5K8F A;  3ETC A;  2QVZ X;  4JI3 C;  3EER A;  3TQI A;  3NPD A;  1MD9 A;  5KYT A;  3CW8 X;  2UUC C;  3GPC A;  1O93 A;  2P2Q A;  5K85 A;  1N33 C;  1L2F A;  4DR3 C;  4IZ6 A;  4JI5 C;  5ADZ A;  2UUB C;  3VNR A;  2Y4N A;  4G36 A;  4BSZ A;  5LMU C;  4L4Q A;  2E7G A;  4AQY C;  4LFC C;  2XR1 A;  4HPV A;  1LQL A;  1LCI A;  4OXI A;  4NOZ A;  4DV5 C;  5CZX A;  4L7I A;  1EGA A;  3PBK A;  2DPL A;  5BSU A;  4DR4 C;  4MH4 A;  1XRA A;  2PRO A;  1ZB8 A;  5BUR A;  3AF5 A;  1HNW C;  5BSR A;  4B3R C;  1HR0 C;  3DAY A;  2KZF A;  1IBM C;  3GR1 A;  3UOW A;  4DCS A;  4LF4 C;  1MXA A;  5A2Q D;  4DCV A;  4JYA C;  4RMN A;  2CXC A;  3L95 X;  2UUA C;  1HNX C;  3J81 D;  1P7L A;  4LF9 C;  4JI0 C;  4LF8 C;  1O90 A;  1VLA A;  2QL8 A;  3SO4 A;  4RM2 A;  3TUF A;  5AE3 A;  4D4I A;  4DG9 A;  4G37 A;  4DCU A;  2V7B A;  5BR8 C;  3H2T A;  2PT7 G;  4JI8 C;  4DR1 C;  4DUY C;  1XRB A;  2JMP A;  2Y27 A;  4JI7 C;  4XX2 A;  3VNS A;  3R9X A;  4DV0 C;  2VZE A;  4MTN A;  2VSQ A;  4FTF A;  3LGX A;  4RLF A;  4U5Y D;  2QVY X;  2ZM6 C;  4NXM C;  5BUQ A;  2UXB C;  4RVO A;  3FCE A;  2VQE C;  1N34 C;  1PG4 A;  5BUS A;  4GXR A;  1QM4 A;  5IT9 D;  5FLX D;  3A9V A;  2DYJ A;  4B3M C;  1V25 A;  1NYE A;  1HNZ C;  2YCB A;  4KTV A;  4KHP C;  2Y4O A;  3GR0 A;  3IML A;  3B7W A;  4X62 C;  3R44 A;  1N36 C;  1AMU A;  1O9T A;  2D1T A;  4ODJ A;  3VNQ A;  4YHH C;  4B3S C;  3T1Y C;  2E0G A;  2WD9 A;  3LAX A;  4LF7 C;  3DHV A;  2HJG A;  5AE1 A;  2CY1 A;  5A1G A;  1XMO C;  1MKY A;  1XRC A;  3RG2 A;  3A4I A;  2E8F A;  1MXC A;  5T8T A;  4R1M A;  4DV6 C;  1HH2 P;  3PRO C;  2D27 A;  5KYV A;  3ETO A;  3I08 A;  3E7X A;  4KTT A;  4D57 A;  4DG8 A;  2F4V C;  4LF6 C;  1WH9 A;  2UU9 C;  4JI1 C;  4LFA C;  3IEV A;  2BJO A;  1N32 C;  3NYR A;  1UKK A;  4GKJ C;  4PRO C;  4BC7 A;  1V26 A;  2P20 A;  3NI2 A;  2P02 A;  4RVN A;  4BCA A;  4DCT A;  2UXC C;  3LUS A;  4WS9 A;  4PZP A;  1FUG A;  2P2M A;  2D1S A;  2EGT A;  4D56 A;  3T1H C;  4ZJZ A;  5BST A;  3RV2 A;  4DV4 C;  4D4G A;  2OO4 A;  4BC9 A;  3NYQ A;  1MDB A;  5KEI A;  3OTO C;  1ZB9 A;  1T5D X;  3KXW A;  2P2B A;  1XMQ C;  4NDN A;  4ISB A;  2OPL A;  5DV9 A;  1ULT A;  3N54 B;  2E8C A;  4JV5 C;  3J80 D;  4GS5 A;  4JI6 C;  1GPM A;  4GKK C;  2QW0 X;  3CJE A;  2QVX X;  5BSV A;  1RY2 A;  5IWA C;  4K0K C;  2ATW A;  3R9W A;  3C5E A;  4RM3 A;  4R1L A;  3E7W A;  1WF3 A;  2PN2 A;  3TDE A;  5JRH A;  2HHH C;  4TPS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...