4DV3C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv3C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv3C02
4DCSA 2D7VA 3T1YC 4B3TC 4JI4C 4YHHC 1IBMC 3J81D 1XMOC 3GKUA 1LQLA 2PN2A 2E8FA 5A2QD 2JMPA 4DV3C 1UKKA 2DYJA 2VQFC 4JI0C 1HH2P 2KZFA 1USPA 1HNZC 5IT9D 1N33C 5FLXD 4DUYC 4DV0C 1XMQC 4JI1C 4LF7C 2UXCC 2UUCC 4DR7C 3I07A 1QWIA 4DR3C 1J5EC 2CXCA 4GKKC 1HR0C 1I94C 1N2FA 1EGAA 3J7AD 4OX9C 1NYEA 3R9WA 2E8EA 2E5LC 4LFAC 1ML8A 2E7GA 4B3MC 2UUAC 4JYAC 2XR1A 4MTNA 4KHPC 4DCTA 1PA4A 5LMUC 2ATWA 2UXDC 1HNWC 4DR4C 3LUSA 2HHHC 4BSZA 4DR6C 4DR2C 2UU9C 4DR1C 4MH4A 4XX2A 1L2FA 1USPB 4DV6C 3CJEA 2ONFA 4JI8C 1N32C 4DV4C 1VLAA 4DV2C 3R9XA 1FJGC 5LMNC 1KKGA 1WF3A 2OPLA 3IEUA 2UUBC 4LF4C 3JAMD 4AQYC 4JI6C 4LF9C 2ASBA 4JI7C 4DCVA 4X64C 4LF5C 4GKJC 4JI3C 2BJOA 4LFBC 1ZB8A 4DV1C 3AF5A 4DR5C 4JI5C 4LF6C 4LFCC 1MKYA 2YCBA 4NXNC 2PT7G 2E8CA 5IWAC 4NOZA 2UXBC 2HJGA 2VQEC 4B3SC 4DV5C 1N36C 1IBKC 1JOSA 4DCUA 5BR8C 2F4VC 4X65C 1ZB9A 4DV7C 1HNXC 3AF6A 1IBLC 4JV5C 4LF8C 3IEVA 2EGTA 3J80D 2OPLB 1XNRC 1N34C 4NXMC 2QL8A 3T1HC 2CY1A 1K0RA 3EERA 3OTOC 4K0KC 1WH9A 4X62C 4B3RC 4JI2C 4X66C 2ZM6C 4DUZC 1XNQC 4YY3C
chains in the Genus database with same CATH superfamily
2D7VA 3S82A 3G7SA 1M6XC 3J81D 1V25A 2VQFC 1USPA 1MXBA 4RLFA 1N33C 2QVZX 1PG4A 1J5EC 1HR0C 2VZEA 2OBVA 1IB8A 4R1LA 2P2BA 3PBKA 5A1GA 4U5YD 5LMUC 2UXDC 1T5DX 4D4IA 3LUSA 2P02A 4DR6C 4DR2C 2UU9C 4R0MA 4MH4A 4XX2A 1USPB 3K6RA 3E7WA 4JI8C 4DV2C 5KYTA 4RVOA 1WF3A 3IEUA 3VNQA 4JI6C 3A9VA 3PESA 3TDEA 4JI7C 4DV1C 1O90A 4DR5C 5DV9A 2ZTBA 2YCBA 4FUTA 1XS3A 2E8CA 2UXBC 2HJGA 5BUSA 2VQEC 1TH5A 4DV5C 2YX1A 1IBKC 1XRAA 4BCAA 3L95X 4DV7C 3ETCA 2QVYX 3AF6A 4LF8C 1XDXA 4FUQA 4PUIA 2QL8A 3CW8X 1P4EA 2ZM6C 3LGXA 2CU6A 3A9UA 2D1TA 4DCSA 1T5HX 3A25A 5H9UA 4DG9A 4JI4C 1LQLA 2E8FA 2JMPA 4DV3C 1UKKA 5BSUA 1HH2P 4D4GA 3UZ0A 2P2FA 2V7BA 4DUYC 4DV0C 4BC7A 2MCQA 5E7QA 3NI2A 2QW0X 1AMUA 2WD9A 2CXCA 1PG3A 5A1IA 3J7AD 2E8EA 2E5LC 4LFAC 1MDBA 2XR1A 4KHPC 1PA4A 3H2TA 2ATWA 5LCIA 5AE2A 4BSZA 3UOWA 4ZJZA 3LAXA 2P20A 5CZVA 1MDFA 1LCIA 2D27A 5BURA 1VLAA 3R9XA 2JNVA 3CQ3A 2OPLA 5ADZA 2M5OA 1ULTA 3GR1A 4OYCA 2BH1X 3DAYA 2Z51A 2BJOA 4LF6C 1MKYA 4NXNC 3FM7A 3L8CA 3VNSA 3DLPX 4G36A 3NYQA 3SO4A 1N36C 2DHMA 4DCUA 2F4VC 4X65C 2PROA 4NDNA 1HNXC 2D28C 3A4IA 5BSMA 2EGTA 4L7IA 2OPLB 4I9GA 1YJ7A 2CY1A 1WH9A 4JI2C 2KDNA 1YGTA 3VNRA 4DUZC 2M5HA 4B3TC 4BBYA 1IBMC 5CZXA 3PROC 3GKUA 4PROC 2PN2A 3GPCA 2DYJA 1XRCA 2P2JA 1XMQC 4JI1C 3TQIA 5K8FA 4DR7C 4PHTA 3IPLA 3I07A 3N2QA 4G1IA 4DR3C 4GKKC 4LE5A 2MMAB 5GTDA 1N2FA 2P2MA 1EGAA 4FTFA 5AE1A 1NYEA 2VSQA 1ML8A 3FCCA 2E7GA 4B3MC 4OXIA 4IZ6A 2UUAC 4JYAC 2KZ0A 4MTNA 4HPVA 4DCTA 4KTVA 4G37A 4GS5A 2HHHC 2E0GA 1O93A 2D1QA 3O2EA 4DV6C 3RG2A 1N32C 2OO4A 3B7WA 2YWCA 1M6XA 3R44A 4RM2A 2Y27A 5LMNC 5BSWA 1KKGA 4LF4C 4D57A 1BA3A 3JAMD 4AQYC 4PUGA 4LF9C 2ASBA 5AE3A 4RMNA 3LNOA 3CQ1A 4X64C 3CW9A 1V60A 1ZB8A 3AF5A 1MD9A 2YWBA 4R1MA 2PT7G 5JRHA 4NOZA 1UWDA 1O9TA 2Y4OA 3RV2A 2NCLA 1JOSA 4RM3A 3UEBA 5BR8C 3EQ6A 1P7LA 4WS9A 3E7XA 4JV5C 4RVNA 3FCEA 3J80D 1XNRC 1N34C 3UX3A 2Y4NA 5T8SA 4NXMC 3OTOC 1K0RA 3EERA 4K0KC 4GXRA 4B3RC 5T8TA 4X66C 5A19A 1RY2A 4YY3C 3C5EA 1FUGA 3T1YC 3NYRA 4YHHC 4PUHA 1V26A 1XMOC 3LNVA 2DPLA 3UX2A 5A2QD 1FLOA 4JI0C 2KZFA 3CQ2A 1HNZC 5IT9D 2MM9A 5FLXD 4LF7C 2UXCC 2UUCC 1O92A 5BSRA 3A26A 1QWIA 2D1RA 4EATA 3I08A 1I94C 5IFIA 5BSVA 4OX9C 3N54B 3R9WA 4IR7A 2WP0C 3GR0A 1HNWC 3TUFA 2ZZMA 1XRBA 3IMLA 4DR4C 5KYVA 2AYAA 4DR1C 5BUQA 1L2FA 3CJEA 2ONFA 1VEHA 1GPMA 1PU1A 4DV4C 4PZPA 1MXAA 1FJGC 4L4QA 4JM1A 2PG1E 2UUBC 3TR3A 4K0BA 1XHJA 4RLQA 4DCVA 4LF5C 1NY8A 4JI3C 4GKJC 4LFBC 3KXWA 3ETOA 4JI5C 4WV3A 4LFCC 4ODJA 2D1SA 4GXQA 2ZZNA 5K85A 5IWAC 2QVXX 1QM4A 2P2QA 1RG9A 4I9FA 4L2ZA 4B3SC 1P4EC 1WCJA 4D56A 1ZB9A 4TPSB 3DHVA 3AY0A 1MXCA 1IBLC 4BC9A 3IEVA 3NPDA 5KEIA 4KTTA 3T1HC 4DG8A 4ISBA 4X62C 4ZLPA 5BSTA 1XNQC
chains in the Genus database with same CATH topology
2D7VA 3S82A 3G7SA 3J81D 1V25A 2VQFC 1USPA 1MXBA 4RLFA 1N33C 2QVZX 1PG4A 1J5EC 1HR0C 2VZEA 2OBVA 4R1LA 2P2BA 3PBKA 5A1GA 4U5YD 5LMUC 2UXDC 1T5DX 4D4IA 3LUSA 2P02A 4DR6C 4DR2C 2UU9C 4R0MA 4MH4A 4XX2A 1USPB 3E7WA 4JI8C 4DV2C 5KYTA 4RVOA 1WF3A 3IEUA 3VNQA 4JI6C 3A9VA 3PESA 3TDEA 4JI7C 4DV1C 1O90A 4DR5C 5DV9A 2YCBA 4FUTA 2E8CA 2UXBC 2HJGA 5BUSA 2VQEC 4DV5C 1IBKC 1XRAA 4BCAA 3L95X 4DV7C 3ETCA 2QVYX 3AF6A 4LF8C 4FUQA 2QL8A 3CW8X 2ZM6C 3LGXA 3A9UA 2D1TA 4DCSA 1T5HX 5H9UA 4DG9A 4JI4C 1LQLA 2E8FA 2JMPA 4DV3C 1UKKA 5BSUA 1HH2P 4D4GA 3UZ0A 2P2FA 2V7BA 4DUYC 4DV0C 4BC7A 5E7QA 3NI2A 2QW0X 1AMUA 2WD9A 2CXCA 1PG3A 5A1IA 3J7AD 2E8EA 2E5LC 4LFAC 1MDBA 2XR1A 4KHPC 1PA4A 3H2TA 2ATWA 5AE2A 4BSZA 3UOWA 4ZJZA 3LAXA 2P20A 5CZVA 1MDFA 1LCIA 2D27A 5BURA 1VLAA 3R9XA 2OPLA 5ADZA 1ULTA 3GR1A 4OYCA 2BH1X 3DAYA 2BJOA 4LF6C 1MKYA 4NXNC 3L8CA 3VNSA 3DLPX 4G36A 3NYQA 3SO4A 1N36C 4DCUA 2F4VC 4X65C 2PROA 4NDNA 1HNXC 2D28C 3A4IA 5BSMA 2EGTA 4L7IA 2OPLB 4I9GA 1YJ7A 2CY1A 1WH9A 4JI2C 3VNRA 4DUZC 4B3TC 4BBYA 1IBMC 5CZXA 3PROC 3GKUA 4PROC 2PN2A 3GPCA 2DYJA 1XRCA 2P2JA 1XMQC 4JI1C 3TQIA 5K8FA 4DR7C 4PHTA 3IPLA 3I07A 3N2QA 4G1IA 4DR3C 4GKKC 4LE5A 5GTDA 1N2FA 2P2MA 1EGAA 4FTFA 5AE1A 1NYEA 2VSQA 1ML8A 3FCCA 2E7GA 4B3MC 4OXIA 4IZ6A 2UUAC 4JYAC 4MTNA 4HPVA 4DCTA 4KTVA 4G37A 4GS5A 2HHHC 2E0GA 1O93A 2D1QA 4DV6C 3RG2A 1N32C 2OO4A 3B7WA 2YWCA 3R44A 4RM2A 2Y27A 5LMNC 5BSWA 1KKGA 4LF4C 4D57A 1BA3A 3JAMD 4AQYC 4LF9C 2ASBA 5AE3A 4RMNA 4X64C 3CW9A 1ZB8A 3AF5A 1MD9A 2YWBA 4R1MA 2PT7G 5JRHA 4NOZA 1O9TA 2Y4OA 3RV2A 1JOSA 4RM3A 5BR8C 3EQ6A 1P7LA 4WS9A 3E7XA 4JV5C 4RVNA 3FCEA 3J80D 1XNRC 1N34C 2Y4NA 5T8SA 4NXMC 3OTOC 1K0RA 3EERA 4K0KC 4GXRA 4B3RC 5T8TA 4X66C 5A19A 1RY2A 4YY3C 3C5EA 1FUGA 3T1YC 3NYRA 4YHHC 1V26A 1XMOC 3LNVA 2DPLA 5A2QD 4JI0C 2KZFA 1HNZC 5IT9D 5FLXD 4LF7C 2UXCC 2UUCC 1O92A 5BSRA 1QWIA 2D1RA 4EATA 3I08A 1I94C 5IFIA 5BSVA 4OX9C 3N54B 3R9WA 4IR7A 2WP0C 3GR0A 1HNWC 3TUFA 1XRBA 3IMLA 4DR4C 5KYVA 2AYAA 4DR1C 5BUQA 1L2FA 3CJEA 2ONFA 1GPMA 4DV4C 4PZPA 1MXAA 1FJGC 4L4QA 4JM1A 2UUBC 4K0BA 4RLQA 4DCVA 4LF5C 4GKJC 4JI3C 4LFBC 3KXWA 3ETOA 4JI5C 4WV3A 4LFCC 4ODJA 2D1SA 4GXQA 5K85A 5IWAC 2QVXX 1QM4A 2P2QA 1RG9A 4I9FA 4L2ZA 4B3SC 4D56A 1ZB9A 4TPSB 3DHVA 1MXCA 1IBLC 4BC9A 3IEVA 3NPDA 3T1HC 4KTTA 5KEIA 4DG8A 4ISBA 4X62C 4ZLPA 5BSTA 1XNQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DCS A;  2D7V A;  3T1Y C;  4B3T C;  4JI4 C;  4YHH C;  1IBM C;  3J81 D;  1XMO C;  3GKU A;  1LQL A;  2PN2 A;  2E8F A;  5A2Q D;  2JMP A;  4DV3 C;  1UKK A;  2DYJ A;  2VQF C;  4JI0 C;  1HH2 P;  2KZF A;  1USP A;  1HNZ C;  5IT9 D;  1N33 C;  5FLX D;  4DUY C;  4DV0 C;  1XMQ C;  4JI1 C;  4LF7 C;  2UXC C;  2UUC C;  4DR7 C;  3I07 A;  1QWI A;  4DR3 C;  1J5E C;  2CXC A;  4GKK C;  1HR0 C;  1I94 C;  1N2F A;  1EGA A;  3J7A D;  4OX9 C;  1NYE A;  3R9W A;  2E8E A;  2E5L C;  4LFA C;  1ML8 A;  2E7G A;  4B3M C;  2UUA C;  4JYA C;  2XR1 A;  4MTN A;  4KHP C;  4DCT A;  1PA4 A;  5LMU C;  2ATW A;  2UXD C;  1HNW C;  4DR4 C;  3LUS A;  2HHH C;  4BSZ A;  4DR6 C;  4DR2 C;  2UU9 C;  4DR1 C;  4MH4 A;  4XX2 A;  1L2F A;  1USP B;  4DV6 C;  3CJE A;  2ONF A;  4JI8 C;  1N32 C;  4DV4 C;  1VLA A;  4DV2 C;  3R9X A;  1FJG C;  5LMN C;  1KKG A;  1WF3 A;  2OPL A;  3IEU A;  2UUB C;  4LF4 C;  3JAM D;  4AQY C;  4JI6 C;  4LF9 C;  2ASB A;  4JI7 C;  4DCV A;  4X64 C;  4LF5 C;  4GKJ C;  4JI3 C;  2BJO A;  4LFB C;  1ZB8 A;  4DV1 C;  3AF5 A;  4DR5 C;  4JI5 C;  4LF6 C;  4LFC C;  1MKY A;  2YCB A;  4NXN C;  2PT7 G;  2E8C A;  5IWA C;  4NOZ A;  2UXB C;  2HJG A;  2VQE C;  4B3S C;  4DV5 C;  1N36 C;  1IBK C;  1JOS A;  4DCU A;  5BR8 C;  2F4V C;  4X65 C;  1ZB9 A;  4DV7 C;  1HNX C;  3AF6 A;  1IBL C;  4JV5 C;  4LF8 C;  3IEV A;  2EGT A;  3J80 D;  2OPL B;  1XNR C;  1N34 C;  4NXM C;  2QL8 A;  3T1H C;  2CY1 A;  1K0R A;  3EER A;  3OTO C;  4K0K C;  1WH9 A;  4X62 C;  4B3R C;  4JI2 C;  4X66 C;  2ZM6 C;  4DUZ C;  1XNQ C;  4YY3 C; 
#chains in the Genus database with same CATH topology
 2D7V A;  3S82 A;  3G7S A;  1M6X C;  3J81 D;  1V25 A;  2VQF C;  1USP A;  1MXB A;  4RLF A;  1N33 C;  2QVZ X;  1PG4 A;  1J5E C;  1HR0 C;  2VZE A;  2OBV A;  1IB8 A;  4R1L A;  2P2B A;  3PBK A;  5A1G A;  4U5Y D;  5LMU C;  2UXD C;  1T5D X;  4D4I A;  3LUS A;  2P02 A;  4DR6 C;  4DR2 C;  2UU9 C;  4R0M A;  4MH4 A;  4XX2 A;  1USP B;  3K6R A;  3E7W A;  4JI8 C;  4DV2 C;  5KYT A;  4RVO A;  1WF3 A;  3IEU A;  3VNQ A;  4JI6 C;  3A9V A;  3PES A;  3TDE A;  4JI7 C;  4DV1 C;  1O90 A;  4DR5 C;  5DV9 A;  2ZTB A;  2YCB A;  4FUT A;  1XS3 A;  2E8C A;  2UXB C;  2HJG A;  5BUS A;  2VQE C;  1TH5 A;  4DV5 C;  2YX1 A;  1IBK C;  1XRA A;  4BCA A;  3L95 X;  4DV7 C;  3ETC A;  2QVY X;  3AF6 A;  4LF8 C;  1XDX A;  4FUQ A;  4PUI A;  2QL8 A;  3CW8 X;  1P4E A;  2ZM6 C;  3LGX A;  2CU6 A;  3A9U A;  2D1T A;  4DCS A;  1T5H X;  3A25 A;  5H9U A;  4DG9 A;  4JI4 C;  1LQL A;  2E8F A;  2JMP A;  4DV3 C;  1UKK A;  5BSU A;  1HH2 P;  4D4G A;  3UZ0 A;  2P2F A;  2V7B A;  4DUY C;  4DV0 C;  4BC7 A;  2MCQ A;  5E7Q A;  3NI2 A;  2QW0 X;  1AMU A;  2WD9 A;  2CXC A;  1PG3 A;  5A1I A;  3J7A D;  2E8E A;  2E5L C;  4LFA C;  1MDB A;  2XR1 A;  4KHP C;  1PA4 A;  3H2T A;  2ATW A;  5LCI A;  5AE2 A;  4BSZ A;  3UOW A;  4ZJZ A;  3LAX A;  2P20 A;  5CZV A;  1MDF A;  1LCI A;  2D27 A;  5BUR A;  1VLA A;  3R9X A;  2JNV A;  3CQ3 A;  2OPL A;  5ADZ A;  2M5O A;  1ULT A;  3GR1 A;  4OYC A;  2BH1 X;  3DAY A;  2Z51 A;  2BJO A;  4LF6 C;  1MKY A;  4NXN C;  3FM7 A;  3L8C A;  3VNS A;  3DLP X;  4G36 A;  3NYQ A;  3SO4 A;  1N36 C;  2DHM A;  4DCU A;  2F4V C;  4X65 C;  2PRO A;  4NDN A;  1HNX C;  2D28 C;  3A4I A;  5BSM A;  2EGT A;  4L7I A;  2OPL B;  4I9G A;  1YJ7 A;  2CY1 A;  1WH9 A;  4JI2 C;  2KDN A;  1YGT A;  3VNR A;  4DUZ C;  2M5H A;  4B3T C;  4BBY A;  1IBM C;  5CZX A;  3PRO C;  3GKU A;  4PRO C;  2PN2 A;  3GPC A;  2DYJ A;  1XRC A;  2P2J A;  1XMQ C;  4JI1 C;  3TQI A;  5K8F A;  4DR7 C;  4PHT A;  3IPL A;  3I07 A;  3N2Q A;  4G1I A;  4DR3 C;  4GKK C;  4LE5 A;  2MMA B;  5GTD A;  1N2F A;  2P2M A;  1EGA A;  4FTF A;  5AE1 A;  1NYE A;  2VSQ A;  1ML8 A;  3FCC A;  2E7G A;  4B3M C;  4OXI A;  4IZ6 A;  2UUA C;  4JYA C;  2KZ0 A;  4MTN A;  4HPV A;  4DCT A;  4KTV A;  4G37 A;  4GS5 A;  2HHH C;  2E0G A;  1O93 A;  2D1Q A;  3O2E A;  4DV6 C;  3RG2 A;  1N32 C;  2OO4 A;  3B7W A;  2YWC A;  1M6X A;  3R44 A;  4RM2 A;  2Y27 A;  5LMN C;  5BSW A;  1KKG A;  4LF4 C;  4D57 A;  1BA3 A;  3JAM D;  4AQY C;  4PUG A;  4LF9 C;  2ASB A;  5AE3 A;  4RMN A;  3LNO A;  3CQ1 A;  4X64 C;  3CW9 A;  1V60 A;  1ZB8 A;  3AF5 A;  1MD9 A;  2YWB A;  4R1M A;  2PT7 G;  5JRH A;  4NOZ A;  1UWD A;  1O9T A;  2Y4O A;  3RV2 A;  2NCL A;  1JOS A;  4RM3 A;  3UEB A;  5BR8 C;  3EQ6 A;  1P7L A;  4WS9 A;  3E7X A;  4JV5 C;  4RVN A;  3FCE A;  3J80 D;  1XNR C;  1N34 C;  3UX3 A;  2Y4N A;  5T8S A;  4NXM C;  3OTO C;  1K0R A;  3EER A;  4K0K C;  4GXR A;  4B3R C;  5T8T A;  4X66 C;  5A19 A;  1RY2 A;  4YY3 C;  3C5E A;  1FUG A;  3T1Y C;  3NYR A;  4YHH C;  4PUH A;  1V26 A;  1XMO C;  3LNV A;  2DPL A;  3UX2 A;  5A2Q D;  1FLO A;  4JI0 C;  2KZF A;  3CQ2 A;  1HNZ C;  5IT9 D;  2MM9 A;  5FLX D;  4LF7 C;  2UXC C;  2UUC C;  1O92 A;  5BSR A;  3A26 A;  1QWI A;  2D1R A;  4EAT A;  3I08 A;  1I94 C;  5IFI A;  5BSV A;  4OX9 C;  3N54 B;  3R9W A;  4IR7 A;  2WP0 C;  3GR0 A;  1HNW C;  3TUF A;  2ZZM A;  1XRB A;  3IML A;  4DR4 C;  5KYV A;  2AYA A;  4DR1 C;  5BUQ A;  1L2F A;  3CJE A;  2ONF A;  1VEH A;  1GPM A;  1PU1 A;  4DV4 C;  4PZP A;  1MXA A;  1FJG C;  4L4Q A;  4JM1 A;  2PG1 E;  2UUB C;  3TR3 A;  4K0B A;  1XHJ A;  4RLQ A;  4DCV A;  4LF5 C;  1NY8 A;  4JI3 C;  4GKJ C;  4LFB C;  3KXW A;  3ETO A;  4JI5 C;  4WV3 A;  4LFC C;  4ODJ A;  2D1S A;  4GXQ A;  2ZZN A;  5K85 A;  5IWA C;  2QVX X;  1QM4 A;  2P2Q A;  1RG9 A;  4I9F A;  4L2Z A;  4B3S C;  1P4E C;  1WCJ A;  4D56 A;  1ZB9 A;  4TPS B;  3DHV A;  3AY0 A;  1MXC A;  1IBL C;  4BC9 A;  3IEV A;  3NPD A;  5KEI A;  4KTT A;  3T1H C;  4DG8 A;  4ISB A;  4X62 C;  4ZLP A;  5BST A;  1XNQ C; 
#chains in the Genus database with same CATH homology
 2D7V A;  3S82 A;  3G7S A;  3J81 D;  1V25 A;  2VQF C;  1USP A;  1MXB A;  4RLF A;  1N33 C;  2QVZ X;  1PG4 A;  1J5E C;  1HR0 C;  2VZE A;  2OBV A;  4R1L A;  2P2B A;  3PBK A;  5A1G A;  4U5Y D;  5LMU C;  2UXD C;  1T5D X;  4D4I A;  3LUS A;  2P02 A;  4DR6 C;  4DR2 C;  2UU9 C;  4R0M A;  4MH4 A;  4XX2 A;  1USP B;  3E7W A;  4JI8 C;  4DV2 C;  5KYT A;  4RVO A;  1WF3 A;  3IEU A;  3VNQ A;  4JI6 C;  3A9V A;  3PES A;  3TDE A;  4JI7 C;  4DV1 C;  1O90 A;  4DR5 C;  5DV9 A;  2YCB A;  4FUT A;  2E8C A;  2UXB C;  2HJG A;  5BUS A;  2VQE C;  4DV5 C;  1IBK C;  1XRA A;  4BCA A;  3L95 X;  4DV7 C;  3ETC A;  2QVY X;  3AF6 A;  4LF8 C;  4FUQ A;  2QL8 A;  3CW8 X;  2ZM6 C;  3LGX A;  3A9U A;  2D1T A;  4DCS A;  1T5H X;  5H9U A;  4DG9 A;  4JI4 C;  1LQL A;  2E8F A;  2JMP A;  4DV3 C;  1UKK A;  5BSU A;  1HH2 P;  4D4G A;  3UZ0 A;  2P2F A;  2V7B A;  4DUY C;  4DV0 C;  4BC7 A;  5E7Q A;  3NI2 A;  2QW0 X;  1AMU A;  2WD9 A;  2CXC A;  1PG3 A;  5A1I A;  3J7A D;  2E8E A;  2E5L C;  4LFA C;  1MDB A;  2XR1 A;  4KHP C;  1PA4 A;  3H2T A;  2ATW A;  5AE2 A;  4BSZ A;  3UOW A;  4ZJZ A;  3LAX A;  2P20 A;  5CZV A;  1MDF A;  1LCI A;  2D27 A;  5BUR A;  1VLA A;  3R9X A;  2OPL A;  5ADZ A;  1ULT A;  3GR1 A;  4OYC A;  2BH1 X;  3DAY A;  2BJO A;  4LF6 C;  1MKY A;  4NXN C;  3L8C A;  3VNS A;  3DLP X;  4G36 A;  3NYQ A;  3SO4 A;  1N36 C;  4DCU A;  2F4V C;  4X65 C;  2PRO A;  4NDN A;  1HNX C;  2D28 C;  3A4I A;  5BSM A;  2EGT A;  4L7I A;  2OPL B;  4I9G A;  1YJ7 A;  2CY1 A;  1WH9 A;  4JI2 C;  3VNR A;  4DUZ C;  4B3T C;  4BBY A;  1IBM C;  5CZX A;  3PRO C;  3GKU A;  4PRO C;  2PN2 A;  3GPC A;  2DYJ A;  1XRC A;  2P2J A;  1XMQ C;  4JI1 C;  3TQI A;  5K8F A;  4DR7 C;  4PHT A;  3IPL A;  3I07 A;  3N2Q A;  4G1I A;  4DR3 C;  4GKK C;  4LE5 A;  5GTD A;  1N2F A;  2P2M A;  1EGA A;  4FTF A;  5AE1 A;  1NYE A;  2VSQ A;  1ML8 A;  3FCC A;  2E7G A;  4B3M C;  4OXI A;  4IZ6 A;  2UUA C;  4JYA C;  4MTN A;  4HPV A;  4DCT A;  4KTV A;  4G37 A;  4GS5 A;  2HHH C;  2E0G A;  1O93 A;  2D1Q A;  4DV6 C;  3RG2 A;  1N32 C;  2OO4 A;  3B7W A;  2YWC A;  3R44 A;  4RM2 A;  2Y27 A;  5LMN C;  5BSW A;  1KKG A;  4LF4 C;  4D57 A;  1BA3 A;  3JAM D;  4AQY C;  4LF9 C;  2ASB A;  5AE3 A;  4RMN A;  4X64 C;  3CW9 A;  1ZB8 A;  3AF5 A;  1MD9 A;  2YWB A;  4R1M A;  2PT7 G;  5JRH A;  4NOZ A;  1O9T A;  2Y4O A;  3RV2 A;  1JOS A;  4RM3 A;  5BR8 C;  3EQ6 A;  1P7L A;  4WS9 A;  3E7X A;  4JV5 C;  4RVN A;  3FCE A;  3J80 D;  1XNR C;  1N34 C;  2Y4N A;  5T8S A;  4NXM C;  3OTO C;  1K0R A;  3EER A;  4K0K C;  4GXR A;  4B3R C;  5T8T A;  4X66 C;  5A19 A;  1RY2 A;  4YY3 C;  3C5E A;  1FUG A;  3T1Y C;  3NYR A;  4YHH C;  1V26 A;  1XMO C;  3LNV A;  2DPL A;  5A2Q D;  4JI0 C;  2KZF A;  1HNZ C;  5IT9 D;  5FLX D;  4LF7 C;  2UXC C;  2UUC C;  1O92 A;  5BSR A;  1QWI A;  2D1R A;  4EAT A;  3I08 A;  1I94 C;  5IFI A;  5BSV A;  4OX9 C;  3N54 B;  3R9W A;  4IR7 A;  2WP0 C;  3GR0 A;  1HNW C;  3TUF A;  1XRB A;  3IML A;  4DR4 C;  5KYV A;  2AYA A;  4DR1 C;  5BUQ A;  1L2F A;  3CJE A;  2ONF A;  1GPM A;  4DV4 C;  4PZP A;  1MXA A;  1FJG C;  4L4Q A;  4JM1 A;  2UUB C;  4K0B A;  4RLQ A;  4DCV A;  4LF5 C;  4GKJ C;  4JI3 C;  4LFB C;  3KXW A;  3ETO A;  4JI5 C;  4WV3 A;  4LFC C;  4ODJ A;  2D1S A;  4GXQ A;  5K85 A;  5IWA C;  2QVX X;  1QM4 A;  2P2Q A;  1RG9 A;  4I9F A;  4L2Z A;  4B3S C;  4D56 A;  1ZB9 A;  4TPS B;  3DHV A;  1MXC A;  1IBL C;  4BC9 A;  3IEV A;  3NPD A;  3T1H C;  4KTT A;  5KEI A;  4DG8 A;  4ISB A;  4X62 C;  4ZLP A;  5BST A;  1XNQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...