4DV3C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv3C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv3C02
4DCSA 3LUSA 4OX9C 1EGAA 1XNQC 2UXBC 1HNWC 3J81D 1I94C 1PA4A 2E5LC 2UUAC 1MKYA 1USPA 2XR1A 2YCBA 1FJGC 4LF4C 4DR1C 4B3TC 2D7VA 1N32C 4DCVA 4YY3C 5LMNC 4DCTA 3R9WA 5IT9D 4MH4A 2ASBA 2E8FA 4DV7C 2ATWA 1XNRC 4DV4C 4GKJC 4LF5C 4XX2A 2UUBC 4YHHC 4DR7C 3EERA 4X64C 4DCUA 2KZFA 4JI3C 4LFAC 1HNZC 4NXMC 4LF9C 2UUCC 2UU9C 2E7GA 3GKUA 2VQEC 4X66C 1USPB 2PT7G 4DR2C 4JV5C 4X65C 5BR8C 3AF6A 4DR6C 1ML8A 4JI1C 4NXNC 1N33C 4DUYC 4AQYC 2F4VC 1LQLA 2ONFA 1XMQC 3J80D 4KHPC 4GKKC 4K0KC 3J7AD 1ZB8A 1WF3A 2DYJA 4DV2C 4LFBC 3OTOC 5IWAC 4JI7C 4DV5C 5FLXD 2HHHC 4JI8C 3CJEA 1KKGA 1VLAA 2E8CA 2BJOA 2OPLB 1L2FA 2QL8A 4DV3C 1HH2P 1N2FA 1ZB9A 1UKKA 3IEVA 2CY1A 5A2QD 1JOSA 1IBMC 1K0RA 2VQFC 4B3MC 2JMPA 4JI4C 4LF8C 2OPLA 1N36C 1HNXC 2PN2A 2E8EA 3JAMD 1XMOC 4X62C 4LFCC 3AF5A 4DR5C 4DV6C 4LF6C 4DR4C 1J5EC 1HR0C 4LF7C 1IBKC 3R9XA 2UXCC 2ZM6C 1N34C 4DR3C 4DV1C 4DUZC 4NOZA 4B3RC 1QWIA 5LMUC 1WH9A 2EGTA 3T1YC 2CXCA 4MTNA 4DV0C 4JI2C 3T1HC 4JI6C 3IEUA 2HJGA 4JI5C 2UXDC 4JI0C 1NYEA 4BSZA 4B3SC 1IBLC 3I07A 4JYAC
chains in the Genus database with same CATH superfamily
3LNOA 2M5HA 4I9GA 4OX9C 1EGAA 5T8SA 1HNWC 3R44A 4WV3A 1PA4A 1ULTA 2D1SA 3VNRA 3S82A 4PZPA 1FJGC 2M5OA 5A1GA 4B3TC 2PROA 4RVOA 5LMNC 4R0MA 1T5HX 4RM3A 2ASBA 2Y4NA 4DV7C 5BSMA 5A19A 4LF5C 3UEBA 4DR7C 3A9VA 4G1IA 4X66C 3DLPX 2Y27A 1XS3A 3GPCA 4OXIA 3UX2A 2PT7G 4JV5C 3AF6A 4DR6C 1ML8A 4R1LA 4JI1C 3ETOA 4NXNC 3PESA 3UZ0A 3EQ6A 2VSQA 1XRAA 5IWAC 5A1IA 2HHHC 5K85A 5AE3A 1XRCA 2P2BA 2P2FA 4L4QA 2ZZNA 1UWDA 4DV3C 1ZB9A 1XDXA 1UKKA 2CY1A 2QVYX 1IBMC 2DHMA 2JMPA 4K0BA 4DG8A 4LF8C 4U5YD 1PU1A 1XMOC 4LE5A 3CQ1A 2MCQA 1WCJA 3A25A 4LF7C 2D1QA 4PUHA 4RM2A 2QVXX 2CXCA 3K6RA 4MTNA 4DV0C 4PHTA 3T1HC 3FM7A 4RMNA 5GTDA 2QVZX 2D1RA 4JI5C 2UXDC 4NDNA 2OBVA 4I9FA 4JYAC 1O93A 4WS9A 5KYTA 1I94C 3UX3A 4TPSB 5BUQA 3FCEA 4DR1C 4DCVA 3CQ3A 3RV2A 4ISBA 4BC9A 4ZJZA 1FUGA 2YWBA 4MH4A 5KEIA 1V26A 2E8FA 3VNSA 1FLOA 1XNRC 3PROC 3RG2A 4BCAA 4RLFA 1MDFA 4YHHC 3EERA 4ODJA 4BC7A 4X64C 4DCUA 2KZFA 3NYQA 4LFAC 3TR3A 3TUFA 4NXMC 2KDNA 1MD9A 4D4GA 4L2ZA 1RY2A 3E7XA 4X65C 1GPMA 4G37A 4PUGA 1MXBA 4D57A 4DUYC 2F4VC 2ONFA 3J7AD 5ADZA 1WF3A 2DYJA 2PG1E 4JI7C 3L95X 2CU6A 2Y4OA 1P7LA 5JRHA 1MXCA 3FCCA 5BSRA 1JOSA 3NYRA 2VQFC 4JI4C 1N36C 4X62C 2NCLA 4LFCC 3LNVA 4DV6C 5BUSA 3N2QA 5H9UA 3TDEA 4GXRA 4RVNA 2JNVA 4DUZC 3IMLA 3LGXA 4NOZA 1T5DX 1WH9A 2OO4A 2EGTA 1PG3A 3CQ2A 4JI6C 2HJGA 3IPLA 4JI0C 2Z51A 1IBLC 1RG9A 4DCSA 3GR0A 1P4EC 5KYVA 1XNQC 4EATA 3J81D 2UUAC 2P2JA 4LF4C 1PG4A 2D7VA 1N32C 4KTVA 4YY3C 4DCTA 3R9WA 1MDBA 2YX1A 4FUQA 3A9UA 5DV9A 4GKJC 3C5EA 3KXWA 1AMUA 3O2EA 3E7WA 2MM9A 1HNZC 1VEHA 4LF9C 1O90A 2E7GA 3GKUA 1USPB 4HPVA 2QW0X 4DR2C 3A26A 3AY0A 2KZ0A 4IZ6A 2V7BA 1N33C 4AQYC 4RLQA 1LQLA 2AYAA 3J80D 1ZB8A 3G7SA 4DV2C 2MMAB 3OTOC 4DV5C 2P20A 3CJEA 1KKGA 4G36A 2P2QA 2BJOA 2OPLB 1L2FA 1BA3A 5CZXA 5A2QD 5AE2A 4B3MC 4DG9A 4JM1A 5CZVA 5E7QA 2D27A 3L8CA 1J5EC 3UOWA 1HR0C 1IBKC 2UXCC 5BSUA 2D1TA 5LCIA 1O9TA 5LMUC 4D56A 3T1YC 4R1MA 2VZEA 4JI2C 1V25A 2ZZMA 1NYEA 3I07A 1MXAA 3LUSA 2UXBC 4GXQA 3CW9A 2E5LC 1TH5A 2D28C 1MKYA 1USPA 2BH1X 2XR1A 2YCBA 3LAXA 4FTFA 4FUTA 1YGTA 1IB8A 2P2MA 5BSTA 5IT9D 2WP0C 3NPDA 1LCIA 2ATWA 4DV4C 4XX2A 1NY8A 2UUBC 4JI3C 4D4IA 2UUCC 1XRBA 2UU9C 3N54B 2VQEC 4BBYA 2WD9A 5BR8C 1XHJA 5BSWA 3B7WA 3DAYA 1M6XC 4OYCA 3DHVA 5AE1A 5K8FA 1XMQC 4IR7A 1YJ7A 2ZTBA 4KHPC 1M6XA 4GKKC 4K0KC 5BURA 1QM4A 4LFBC 3TQIA 5FLXD 4JI8C 1VLAA 2E8CA 2QL8A 4KTTA 1HH2P 1N2FA 3ETCA 1P4EA 3IEVA 1K0RA 5BSVA 3PBKA 3I08A 1V60A 3NI2A 2E0GA 4L7IA 2OPLA 1HNXC 3CW8X 2PN2A 2E8EA 3JAMD 4ZLPA 5T8TA 2P02A 3AF5A 2DPLA 4PROC 4DR5C 4PUIA 4LF6C 4DR4C 2YWCA 3R9XA 2ZM6C 1N34C 4DR3C 3A4IA 3GR1A 4GS5A 3H2TA 4DV1C 4B3RC 1QWIA 3SO4A 5IFIA 3VNQA 3IEUA 1O92A 4BSZA 4B3SC
chains in the Genus database with same CATH topology
4I9GA 4OX9C 1EGAA 5T8SA 1HNWC 3R44A 4WV3A 1PA4A 1ULTA 2D1SA 3VNRA 3S82A 4PZPA 1FJGC 5A1GA 4B3TC 2PROA 4RVOA 5LMNC 4R0MA 1T5HX 4RM3A 2ASBA 2Y4NA 4DV7C 5BSMA 5A19A 4LF5C 4DR7C 3A9VA 4G1IA 4X66C 3DLPX 2Y27A 3GPCA 4OXIA 2PT7G 4JV5C 3AF6A 4DR6C 1ML8A 4R1LA 4JI1C 3ETOA 4NXNC 3PESA 3UZ0A 3EQ6A 2VSQA 1XRAA 5IWAC 5A1IA 2HHHC 5K85A 5AE3A 1XRCA 2P2BA 2P2FA 4L4QA 4DV3C 1ZB9A 1UKKA 2CY1A 2QVYX 1IBMC 2JMPA 4K0BA 4DG8A 4LF8C 4U5YD 1XMOC 4LE5A 4LF7C 2D1QA 4RM2A 2QVXX 2CXCA 4MTNA 4DV0C 4PHTA 3T1HC 4RMNA 5GTDA 2QVZX 2D1RA 4JI5C 2UXDC 4NDNA 2OBVA 4I9FA 4JYAC 1O93A 4WS9A 5KYTA 1I94C 4TPSB 5BUQA 3FCEA 4DR1C 4DCVA 3RV2A 4ISBA 4BC9A 4ZJZA 1FUGA 2YWBA 4MH4A 5KEIA 1V26A 2E8FA 3VNSA 1XNRC 3PROC 3RG2A 4BCAA 4RLFA 1MDFA 4YHHC 3EERA 4ODJA 4BC7A 4X64C 4DCUA 2KZFA 3NYQA 4LFAC 3TUFA 4NXMC 1MD9A 4D4GA 4L2ZA 1RY2A 3E7XA 4X65C 1GPMA 4G37A 1MXBA 4D57A 4DUYC 2F4VC 2ONFA 3J7AD 5ADZA 1WF3A 2DYJA 4JI7C 3L95X 2Y4OA 1P7LA 5JRHA 1MXCA 3FCCA 5BSRA 1JOSA 3NYRA 2VQFC 4JI4C 1N36C 4X62C 4LFCC 3LNVA 4DV6C 5BUSA 3N2QA 5H9UA 3TDEA 4GXRA 4RVNA 3IMLA 3LGXA 4NOZA 1T5DX 4DUZC 1WH9A 2OO4A 2EGTA 1PG3A 4JI6C 2HJGA 3IPLA 4JI0C 1IBLC 1RG9A 4DCSA 3GR0A 5KYVA 1XNQC 4EATA 3J81D 2UUAC 2P2JA 4LF4C 1PG4A 2D7VA 1N32C 4KTVA 4YY3C 4DCTA 3R9WA 1MDBA 4FUQA 3A9UA 5DV9A 4GKJC 3C5EA 3KXWA 1AMUA 3E7WA 1HNZC 4LF9C 1O90A 2E7GA 3GKUA 1USPB 4HPVA 2QW0X 4DR2C 4IZ6A 2V7BA 1N33C 4AQYC 4RLQA 1LQLA 2AYAA 3J80D 1ZB8A 3G7SA 4DV2C 3OTOC 4DV5C 2P20A 3CJEA 1KKGA 4G36A 2P2QA 2BJOA 2OPLB 1L2FA 1BA3A 5CZXA 5A2QD 5AE2A 4B3MC 4DG9A 4JM1A 5CZVA 5E7QA 2D27A 3L8CA 1J5EC 3UOWA 1HR0C 1IBKC 2UXCC 5BSUA 2D1TA 1O9TA 5LMUC 4D56A 3T1YC 4R1MA 2VZEA 4JI2C 1V25A 1NYEA 3I07A 1MXAA 3LUSA 2UXBC 4GXQA 3CW9A 2E5LC 2D28C 1MKYA 1USPA 2BH1X 2XR1A 2YCBA 3LAXA 4FTFA 4FUTA 2P2MA 5BSTA 5IT9D 2WP0C 3NPDA 1LCIA 2ATWA 4DV4C 4XX2A 2UUBC 4JI3C 4D4IA 2UUCC 1XRBA 2UU9C 3N54B 2VQEC 4BBYA 2WD9A 5BR8C 5BSWA 3B7WA 3DAYA 4OYCA 3DHVA 5AE1A 5K8FA 1XMQC 4IR7A 1YJ7A 4KHPC 4GKKC 4K0KC 5BURA 1QM4A 4LFBC 3TQIA 5FLXD 4JI8C 1VLAA 2E8CA 2QL8A 4KTTA 1HH2P 1N2FA 3ETCA 3IEVA 1K0RA 5BSVA 3PBKA 3I08A 3NI2A 2E0GA 4L7IA 2OPLA 1HNXC 3CW8X 2PN2A 2E8EA 3JAMD 4ZLPA 5T8TA 2P02A 3AF5A 2DPLA 4PROC 4DR5C 4LF6C 4DR4C 2YWCA 3R9XA 2ZM6C 1N34C 4DR3C 3A4IA 3GR1A 4GS5A 3H2TA 4DV1C 4B3RC 1QWIA 3SO4A 5IFIA 3VNQA 3IEUA 1O92A 4BSZA 4B3SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DCS A;  3LUS A;  4OX9 C;  1EGA A;  1XNQ C;  2UXB C;  1HNW C;  3J81 D;  1I94 C;  1PA4 A;  2E5L C;  2UUA C;  1MKY A;  1USP A;  2XR1 A;  2YCB A;  1FJG C;  4LF4 C;  4DR1 C;  4B3T C;  2D7V A;  1N32 C;  4DCV A;  4YY3 C;  5LMN C;  4DCT A;  3R9W A;  5IT9 D;  4MH4 A;  2ASB A;  2E8F A;  4DV7 C;  2ATW A;  1XNR C;  4DV4 C;  4GKJ C;  4LF5 C;  4XX2 A;  2UUB C;  4YHH C;  4DR7 C;  3EER A;  4X64 C;  4DCU A;  2KZF A;  4JI3 C;  4LFA C;  1HNZ C;  4NXM C;  4LF9 C;  2UUC C;  2UU9 C;  2E7G A;  3GKU A;  2VQE C;  4X66 C;  1USP B;  2PT7 G;  4DR2 C;  4JV5 C;  4X65 C;  5BR8 C;  3AF6 A;  4DR6 C;  1ML8 A;  4JI1 C;  4NXN C;  1N33 C;  4DUY C;  4AQY C;  2F4V C;  1LQL A;  2ONF A;  1XMQ C;  3J80 D;  4KHP C;  4GKK C;  4K0K C;  3J7A D;  1ZB8 A;  1WF3 A;  2DYJ A;  4DV2 C;  4LFB C;  3OTO C;  5IWA C;  4JI7 C;  4DV5 C;  5FLX D;  2HHH C;  4JI8 C;  3CJE A;  1KKG A;  1VLA A;  2E8C A;  2BJO A;  2OPL B;  1L2F A;  2QL8 A;  4DV3 C;  1HH2 P;  1N2F A;  1ZB9 A;  1UKK A;  3IEV A;  2CY1 A;  5A2Q D;  1JOS A;  1IBM C;  1K0R A;  2VQF C;  4B3M C;  2JMP A;  4JI4 C;  4LF8 C;  2OPL A;  1N36 C;  1HNX C;  2PN2 A;  2E8E A;  3JAM D;  1XMO C;  4X62 C;  4LFC C;  3AF5 A;  4DR5 C;  4DV6 C;  4LF6 C;  4DR4 C;  1J5E C;  1HR0 C;  4LF7 C;  1IBK C;  3R9X A;  2UXC C;  2ZM6 C;  1N34 C;  4DR3 C;  4DV1 C;  4DUZ C;  4NOZ A;  4B3R C;  1QWI A;  5LMU C;  1WH9 A;  2EGT A;  3T1Y C;  2CXC A;  4MTN A;  4DV0 C;  4JI2 C;  3T1H C;  4JI6 C;  3IEU A;  2HJG A;  4JI5 C;  2UXD C;  4JI0 C;  1NYE A;  4BSZ A;  4B3S C;  1IBL C;  3I07 A;  4JYA C; 
#chains in the Genus database with same CATH topology
 3LNO A;  2M5H A;  4I9G A;  4OX9 C;  1EGA A;  5T8S A;  1HNW C;  3R44 A;  4WV3 A;  1PA4 A;  1ULT A;  2D1S A;  3VNR A;  3S82 A;  4PZP A;  1FJG C;  2M5O A;  5A1G A;  4B3T C;  2PRO A;  4RVO A;  5LMN C;  4R0M A;  1T5H X;  4RM3 A;  2ASB A;  2Y4N A;  4DV7 C;  5BSM A;  5A19 A;  4LF5 C;  3UEB A;  4DR7 C;  3A9V A;  4G1I A;  4X66 C;  3DLP X;  2Y27 A;  1XS3 A;  3GPC A;  4OXI A;  3UX2 A;  2PT7 G;  4JV5 C;  3AF6 A;  4DR6 C;  1ML8 A;  4R1L A;  4JI1 C;  3ETO A;  4NXN C;  3PES A;  3UZ0 A;  3EQ6 A;  2VSQ A;  1XRA A;  5IWA C;  5A1I A;  2HHH C;  5K85 A;  5AE3 A;  1XRC A;  2P2B A;  2P2F A;  4L4Q A;  2ZZN A;  1UWD A;  4DV3 C;  1ZB9 A;  1XDX A;  1UKK A;  2CY1 A;  2QVY X;  1IBM C;  2DHM A;  2JMP A;  4K0B A;  4DG8 A;  4LF8 C;  4U5Y D;  1PU1 A;  1XMO C;  4LE5 A;  3CQ1 A;  2MCQ A;  1WCJ A;  3A25 A;  4LF7 C;  2D1Q A;  4PUH A;  4RM2 A;  2QVX X;  2CXC A;  3K6R A;  4MTN A;  4DV0 C;  4PHT A;  3T1H C;  3FM7 A;  4RMN A;  5GTD A;  2QVZ X;  2D1R A;  4JI5 C;  2UXD C;  4NDN A;  2OBV A;  4I9F A;  4JYA C;  1O93 A;  4WS9 A;  5KYT A;  1I94 C;  3UX3 A;  4TPS B;  5BUQ A;  3FCE A;  4DR1 C;  4DCV A;  3CQ3 A;  3RV2 A;  4ISB A;  4BC9 A;  4ZJZ A;  1FUG A;  2YWB A;  4MH4 A;  5KEI A;  1V26 A;  2E8F A;  3VNS A;  1FLO A;  1XNR C;  3PRO C;  3RG2 A;  4BCA A;  4RLF A;  1MDF A;  4YHH C;  3EER A;  4ODJ A;  4BC7 A;  4X64 C;  4DCU A;  2KZF A;  3NYQ A;  4LFA C;  3TR3 A;  3TUF A;  4NXM C;  2KDN A;  1MD9 A;  4D4G A;  4L2Z A;  1RY2 A;  3E7X A;  4X65 C;  1GPM A;  4G37 A;  4PUG A;  1MXB A;  4D57 A;  4DUY C;  2F4V C;  2ONF A;  3J7A D;  5ADZ A;  1WF3 A;  2DYJ A;  2PG1 E;  4JI7 C;  3L95 X;  2CU6 A;  2Y4O A;  1P7L A;  5JRH A;  1MXC A;  3FCC A;  5BSR A;  1JOS A;  3NYR A;  2VQF C;  4JI4 C;  1N36 C;  4X62 C;  2NCL A;  4LFC C;  3LNV A;  4DV6 C;  5BUS A;  3N2Q A;  5H9U A;  3TDE A;  4GXR A;  4RVN A;  2JNV A;  4DUZ C;  3IML A;  3LGX A;  4NOZ A;  1T5D X;  1WH9 A;  2OO4 A;  2EGT A;  1PG3 A;  3CQ2 A;  4JI6 C;  2HJG A;  3IPL A;  4JI0 C;  2Z51 A;  1IBL C;  1RG9 A;  4DCS A;  3GR0 A;  1P4E C;  5KYV A;  1XNQ C;  4EAT A;  3J81 D;  2UUA C;  2P2J A;  4LF4 C;  1PG4 A;  2D7V A;  1N32 C;  4KTV A;  4YY3 C;  4DCT A;  3R9W A;  1MDB A;  2YX1 A;  4FUQ A;  3A9U A;  5DV9 A;  4GKJ C;  3C5E A;  3KXW A;  1AMU A;  3O2E A;  3E7W A;  2MM9 A;  1HNZ C;  1VEH A;  4LF9 C;  1O90 A;  2E7G A;  3GKU A;  1USP B;  4HPV A;  2QW0 X;  4DR2 C;  3A26 A;  3AY0 A;  2KZ0 A;  4IZ6 A;  2V7B A;  1N33 C;  4AQY C;  4RLQ A;  1LQL A;  2AYA A;  3J80 D;  1ZB8 A;  3G7S A;  4DV2 C;  2MMA B;  3OTO C;  4DV5 C;  2P20 A;  3CJE A;  1KKG A;  4G36 A;  2P2Q A;  2BJO A;  2OPL B;  1L2F A;  1BA3 A;  5CZX A;  5A2Q D;  5AE2 A;  4B3M C;  4DG9 A;  4JM1 A;  5CZV A;  5E7Q A;  2D27 A;  3L8C A;  1J5E C;  3UOW A;  1HR0 C;  1IBK C;  2UXC C;  5BSU A;  2D1T A;  5LCI A;  1O9T A;  5LMU C;  4D56 A;  3T1Y C;  4R1M A;  2VZE A;  4JI2 C;  1V25 A;  2ZZM A;  1NYE A;  3I07 A;  1MXA A;  3LUS A;  2UXB C;  4GXQ A;  3CW9 A;  2E5L C;  1TH5 A;  2D28 C;  1MKY A;  1USP A;  2BH1 X;  2XR1 A;  2YCB A;  3LAX A;  4FTF A;  4FUT A;  1YGT A;  1IB8 A;  2P2M A;  5BST A;  5IT9 D;  2WP0 C;  3NPD A;  1LCI A;  2ATW A;  4DV4 C;  4XX2 A;  1NY8 A;  2UUB C;  4JI3 C;  4D4I A;  2UUC C;  1XRB A;  2UU9 C;  3N54 B;  2VQE C;  4BBY A;  2WD9 A;  5BR8 C;  1XHJ A;  5BSW A;  3B7W A;  3DAY A;  1M6X C;  4OYC A;  3DHV A;  5AE1 A;  5K8F A;  1XMQ C;  4IR7 A;  1YJ7 A;  2ZTB A;  4KHP C;  1M6X A;  4GKK C;  4K0K C;  5BUR A;  1QM4 A;  4LFB C;  3TQI A;  5FLX D;  4JI8 C;  1VLA A;  2E8C A;  2QL8 A;  4KTT A;  1HH2 P;  1N2F A;  3ETC A;  1P4E A;  3IEV A;  1K0R A;  5BSV A;  3PBK A;  3I08 A;  1V60 A;  3NI2 A;  2E0G A;  4L7I A;  2OPL A;  1HNX C;  3CW8 X;  2PN2 A;  2E8E A;  3JAM D;  4ZLP A;  5T8T A;  2P02 A;  3AF5 A;  2DPL A;  4PRO C;  4DR5 C;  4PUI A;  4LF6 C;  4DR4 C;  2YWC A;  3R9X A;  2ZM6 C;  1N34 C;  4DR3 C;  3A4I A;  3GR1 A;  4GS5 A;  3H2T A;  4DV1 C;  4B3R C;  1QWI A;  3SO4 A;  5IFI A;  3VNQ A;  3IEU A;  1O92 A;  4BSZ A;  4B3S C; 
#chains in the Genus database with same CATH homology
 4I9G A;  4OX9 C;  1EGA A;  5T8S A;  1HNW C;  3R44 A;  4WV3 A;  1PA4 A;  1ULT A;  2D1S A;  3VNR A;  3S82 A;  4PZP A;  1FJG C;  5A1G A;  4B3T C;  2PRO A;  4RVO A;  5LMN C;  4R0M A;  1T5H X;  4RM3 A;  2ASB A;  2Y4N A;  4DV7 C;  5BSM A;  5A19 A;  4LF5 C;  4DR7 C;  3A9V A;  4G1I A;  4X66 C;  3DLP X;  2Y27 A;  3GPC A;  4OXI A;  2PT7 G;  4JV5 C;  3AF6 A;  4DR6 C;  1ML8 A;  4R1L A;  4JI1 C;  3ETO A;  4NXN C;  3PES A;  3UZ0 A;  3EQ6 A;  2VSQ A;  1XRA A;  5IWA C;  5A1I A;  2HHH C;  5K85 A;  5AE3 A;  1XRC A;  2P2B A;  2P2F A;  4L4Q A;  4DV3 C;  1ZB9 A;  1UKK A;  2CY1 A;  2QVY X;  1IBM C;  2JMP A;  4K0B A;  4DG8 A;  4LF8 C;  4U5Y D;  1XMO C;  4LE5 A;  4LF7 C;  2D1Q A;  4RM2 A;  2QVX X;  2CXC A;  4MTN A;  4DV0 C;  4PHT A;  3T1H C;  4RMN A;  5GTD A;  2QVZ X;  2D1R A;  4JI5 C;  2UXD C;  4NDN A;  2OBV A;  4I9F A;  4JYA C;  1O93 A;  4WS9 A;  5KYT A;  1I94 C;  4TPS B;  5BUQ A;  3FCE A;  4DR1 C;  4DCV A;  3RV2 A;  4ISB A;  4BC9 A;  4ZJZ A;  1FUG A;  2YWB A;  4MH4 A;  5KEI A;  1V26 A;  2E8F A;  3VNS A;  1XNR C;  3PRO C;  3RG2 A;  4BCA A;  4RLF A;  1MDF A;  4YHH C;  3EER A;  4ODJ A;  4BC7 A;  4X64 C;  4DCU A;  2KZF A;  3NYQ A;  4LFA C;  3TUF A;  4NXM C;  1MD9 A;  4D4G A;  4L2Z A;  1RY2 A;  3E7X A;  4X65 C;  1GPM A;  4G37 A;  1MXB A;  4D57 A;  4DUY C;  2F4V C;  2ONF A;  3J7A D;  5ADZ A;  1WF3 A;  2DYJ A;  4JI7 C;  3L95 X;  2Y4O A;  1P7L A;  5JRH A;  1MXC A;  3FCC A;  5BSR A;  1JOS A;  3NYR A;  2VQF C;  4JI4 C;  1N36 C;  4X62 C;  4LFC C;  3LNV A;  4DV6 C;  5BUS A;  3N2Q A;  5H9U A;  3TDE A;  4GXR A;  4RVN A;  3IML A;  3LGX A;  4NOZ A;  1T5D X;  4DUZ C;  1WH9 A;  2OO4 A;  2EGT A;  1PG3 A;  4JI6 C;  2HJG A;  3IPL A;  4JI0 C;  1IBL C;  1RG9 A;  4DCS A;  3GR0 A;  5KYV A;  1XNQ C;  4EAT A;  3J81 D;  2UUA C;  2P2J A;  4LF4 C;  1PG4 A;  2D7V A;  1N32 C;  4KTV A;  4YY3 C;  4DCT A;  3R9W A;  1MDB A;  4FUQ A;  3A9U A;  5DV9 A;  4GKJ C;  3C5E A;  3KXW A;  1AMU A;  3E7W A;  1HNZ C;  4LF9 C;  1O90 A;  2E7G A;  3GKU A;  1USP B;  4HPV A;  2QW0 X;  4DR2 C;  4IZ6 A;  2V7B A;  1N33 C;  4AQY C;  4RLQ A;  1LQL A;  2AYA A;  3J80 D;  1ZB8 A;  3G7S A;  4DV2 C;  3OTO C;  4DV5 C;  2P20 A;  3CJE A;  1KKG A;  4G36 A;  2P2Q A;  2BJO A;  2OPL B;  1L2F A;  1BA3 A;  5CZX A;  5A2Q D;  5AE2 A;  4B3M C;  4DG9 A;  4JM1 A;  5CZV A;  5E7Q A;  2D27 A;  3L8C A;  1J5E C;  3UOW A;  1HR0 C;  1IBK C;  2UXC C;  5BSU A;  2D1T A;  1O9T A;  5LMU C;  4D56 A;  3T1Y C;  4R1M A;  2VZE A;  4JI2 C;  1V25 A;  1NYE A;  3I07 A;  1MXA A;  3LUS A;  2UXB C;  4GXQ A;  3CW9 A;  2E5L C;  2D28 C;  1MKY A;  1USP A;  2BH1 X;  2XR1 A;  2YCB A;  3LAX A;  4FTF A;  4FUT A;  2P2M A;  5BST A;  5IT9 D;  2WP0 C;  3NPD A;  1LCI A;  2ATW A;  4DV4 C;  4XX2 A;  2UUB C;  4JI3 C;  4D4I A;  2UUC C;  1XRB A;  2UU9 C;  3N54 B;  2VQE C;  4BBY A;  2WD9 A;  5BR8 C;  5BSW A;  3B7W A;  3DAY A;  4OYC A;  3DHV A;  5AE1 A;  5K8F A;  1XMQ C;  4IR7 A;  1YJ7 A;  4KHP C;  4GKK C;  4K0K C;  5BUR A;  1QM4 A;  4LFB C;  3TQI A;  5FLX D;  4JI8 C;  1VLA A;  2E8C A;  2QL8 A;  4KTT A;  1HH2 P;  1N2F A;  3ETC A;  3IEV A;  1K0R A;  5BSV A;  3PBK A;  3I08 A;  3NI2 A;  2E0G A;  4L7I A;  2OPL A;  1HNX C;  3CW8 X;  2PN2 A;  2E8E A;  3JAM D;  4ZLP A;  5T8T A;  2P02 A;  3AF5 A;  2DPL A;  4PRO C;  4DR5 C;  4LF6 C;  4DR4 C;  2YWC A;  3R9X A;  2ZM6 C;  1N34 C;  4DR3 C;  3A4I A;  3GR1 A;  4GS5 A;  3H2T A;  4DV1 C;  4B3R C;  1QWI A;  3SO4 A;  5IFI A;  3VNQ A;  3IEU A;  1O92 A;  4BSZ A;  4B3S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...