4DV3C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv3C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv3C02
1J5EC 1NYEA 1LQLA 2PN2A 4MH4A 1IBMC 1FJGC 4DV6C 4DV7C 4DR7C 1HNWC 4X64C 4DR3C 1ZB9A 1PA4A 5LMNC 5IT9D 2UXDC 1N33C 1UKKA 1WH9A 4LFCC 4LF8C 2E5LC 4JI8C 2EGTA 4LF6C 3R9WA 4LF4C 4DR5C 2F4VC 5FLXD 1K0RA 4DV5C 1EGAA 4DV0C 4KHPC 4OX9C 5LMUC 2JMPA 3IEUA 5BR8C 4JI7C 1XMQC 1HH2P 4GKKC 4B3MC 4DV1C 2ONFA 2KZFA 4DR4C 4B3RC 4K0KC 4DV3C 2OPLA 4NXMC 3J81D 3IEVA 2D7VA 3AF5A 2E8EA 1HNZC 2VQEC 5IWAC 4DUYC 4JI3C 4JI1C 1QWIA 3I07A 4DCUA 2CY1A 4NXNC 4BSZA 2UUBC 4NOZA 4JI4C 1N2FA 2DYJA 1ML8A 4DUZC 4GKJC 2CXCA 4X65C 4DR6C 3OTOC 1HR0C 4JI5C 4AQYC 1WF3A 3T1HC 4LFAC 1XNQC 1IBKC 1HNXC 3J80D 3LUSA 3EERA 4B3TC 4LF5C 4DR1C 4YY3C 3JAMD 2UUAC 4YHHC 1N36C 4LF7C 4JV5C 1MKYA 1I94C 3J7AD 4DCVA 2E7GA 4LF9C 3GKUA 4LFBC 3CJEA 3R9XA 1USPB 2ASBA 2QL8A 2UUCC 2XR1A 2VQFC 1ZB8A 4X62C 2UU9C 4JI0C 4JYAC 4B3SC 1IBLC 2UXBC 2PT7G 4DCSA 4JI2C 2UXCC 3AF6A 3T1YC 4X66C 4XX2A 2ATWA 4DCTA 2BJOA 4MTNA 4JI6C 1N32C 4DV2C 1KKGA 4DR2C 1USPA 2ZM6C 1XMOC 2YCBA 1JOSA 2OPLB 2HHHC 1VLAA 1XNRC 4DV4C 5A2QD 1L2FA 2HJGA 1N34C 2E8FA 2E8CA
chains in the Genus database with same CATH superfamily
1NYEA 1LQLA 1MDFA 4DV6C 3A4IA 1HNWC 4RLQA 1MXCA 1V60A 1WH9A 4LE5A 2QVXX 4BBYA 4LF6C 5FLXD 2D1RA 1MXBA 2D27A 4KTVA 4DV0C 4L4QA 5LMUC 2P2QA 2JMPA 3O2EA 4B3MC 1AMUA 3VNQA 3CW8X 2OPLA 4ODJA 2DHMA 3IEVA 2YWCA 2D7VA 1ULTA 3LGXA 4BC7A 4TPSB 1O93A 1TH5A 3C5EA 2P20A 4JI1C 1YJ7A 5T8SA 3I07A 4IZ6A 2CY1A 4NXNC 2MMAB 4BSZA 3L8CA 4K0BA 4JI4C 1ML8A 1P4EA 4ZLPA 2CXCA 2KZ0A 3CQ3A 2YWBA 4DR6C 3H2TA 1FLOA 3S82A 1BA3A 1PU1A 2ZZNA 1WF3A 4LFAC 4I9FA 3J80D 3LUSA 5DV9A 2P2FA 1GPMA 1RG9A 4DG8A 4YY3C 3JAMD 4YHHC 5H9UA 1MKYA 2P2MA 3UX3A 4G1IA 5GTDA 1IB8A 5BSWA 3SO4A 2QL8A 3EQ6A 4JYAC 4X62C 4B3SC 1IBLC 2PT7G 1PG3A 3T1YC 4X66C 2BJOA 2OBVA 2Y4NA 1XRCA 2Y4OA 4ISBA 4I9GA 4RMNA 3NI2A 2JNVA 2HJGA 1VEHA 1N34C 2YX1A 3ETCA 3A25A 1FJGC 3R44A 3UX2A 4FUTA 5IT9D 4GS5A 1UKKA 4D57A 3A26A 5CZXA 3E7XA 2D28C 4JM1A 2NCLA 3KXWA 3FCEA 2EGTA 4FUQA 2VZEA 4U5YD 4LF4C 1EGAA 2ZTBA 4KHPC 2AYAA 2M5HA 1O9TA 5BR8C 4DV1C 4DR4C 2KZFA 3UZ0A 4GXRA 4GXQA 4NXMC 3J81D 5ADZA 3AF5A 4PUGA 2MM9A 4JI3C 5A1GA 1QWIA 3UOWA 2WD9A 5IFIA 1V26A 4DCUA 3K6RA 1XRAA 5BUQA 4D56A 5CZVA 4DUZC 2DYJA 1O92A 3G7SA 3TUFA 4X65C 1WCJA 2QVYX 5AE2A 4OXIA 4PROC 2Z51A 1P4EC 3T1HC 1XNQC 5BSVA 3NPDA 1LCIA 1HNXC 2M5OA 5KYTA 4DR1C 2UUAC 4JV5C 4R1LA 4DCVA 3GR1A 3DAYA 4LFBC 4PZPA 2D1TA 4PUIA 1M6XA 4FTFA 4DCSA 4JI2C 3I08A 3AF6A 2ATWA 3NYQA 4XX2A 4MTNA 2E0GA 1N32C 1M6XC 3GR0A 2D1SA 1XMOC 2YCBA 2HHHC 1VLAA 3IMLA 5T8TA 2PN2A 1IBMC 3N54B 4DV7C 4DR7C 4G37A 5LCIA 1PA4A 1ZB9A 5E7QA 1N33C 3A9UA 5KYVA 2WP0C 2D1QA 4IR7A 4D4IA 4DR5C 2F4VC 3FCCA 2DPLA 4OX9C 5BURA 3VNRA 2KDNA 4JI7C 1XMQC 1HH2P 4GKKC 4B3RC 4K0KC 3LNOA 4RVNA 3CQ2A 2PROA 2E8EA 2VQEC 1T5DX 3E7WA 4DUYC 3ETOA 3DHVA 2BH1X 4NOZA 4GKJC 3PESA 5BSMA 3VNSA 2VSQA 1MXAA 4JI5C 4RLFA 4D4GA 1MD9A 2PG1E 4L7IA 4OYCA 5BSTA 4B3TC 2ZZMA 3GPCA 4RVOA 1I94C 3L95X 5K85A 4DG9A 3B7WA 2V7BA 3CJEA 3R9XA 1USPB 2ASBA 1QM4A 2UUCC 2VQFC 1ZB8A 4JI0C 1NY8A 3LNVA 2UXCC 4HPVA 4JI6C 2P2BA 1RY2A 1XDXA 4DV2C 4DR2C 4WV3A 5AE3A 1JOSA 4R0MA 5A19A 1XNRC 1FUGA 4DV4C 5A2QD 1L2FA 4PUHA 3UEBA 1P7LA 2E8CA 4L2ZA 1J5EC 4MH4A 4PHTA 4X64C 2P2JA 4DR3C 5BSRA 2UXDC 5LMNC 4NDNA 3LAXA 4R1MA 4LFCC 4LF8C 2E5LC 4JI8C 3R9WA 1T5HX 5BUSA 4BC9A 1K0RA 5BSUA 4DV5C 5KEIA 1V25A 3IEUA 2ONFA 4DV3C 3CW9A 2QW0X 3RG2A 2P02A 4RM3A 1HNZC 5IWAC 3FM7A 4WS9A 3NYRA 3TDEA 3N2QA 3PBKA 2UUBC 4ZJZA 4G36A 1N2FA 1XRBA 1PG4A 1MDBA 3OTOC 3PROC 1HR0C 4AQYC 1XHJA 2Y27A 1YGTA 4KTTA 1IBKC 1O90A 1XS3A 3EERA 4LF5C 4EATA 1N36C 4LF7C 3IPLA 4RM2A 2QVZX 3J7AD 3A9VA 2CU6A 2E7GA 4LF9C 4BCAA 3GKUA 2MCQA 5K8FA 2XR1A 2UU9C 2UXBC 3TR3A 5A1IA 5AE1A 1UWDA 3AY0A 4DCTA 2OO4A 1KKGA 1USPA 2ZM6C 3RV2A 3TQIA 2OPLB 5JRHA 3DLPX 3CQ1A 2E8FA
chains in the Genus database with same CATH topology
1NYEA 1LQLA 1MDFA 4DV6C 3A4IA 1HNWC 4RLQA 1MXCA 1WH9A 4LE5A 2QVXX 4BBYA 4LF6C 5FLXD 2D1RA 1MXBA 2D27A 4KTVA 4DV0C 4L4QA 5LMUC 2P2QA 2JMPA 4B3MC 1AMUA 3VNQA 3CW8X 2OPLA 4ODJA 3IEVA 2YWCA 2D7VA 1ULTA 3LGXA 4BC7A 4TPSB 1O93A 3C5EA 2P20A 4JI1C 1YJ7A 5T8SA 3I07A 4IZ6A 2CY1A 4NXNC 4BSZA 3L8CA 4K0BA 4JI4C 1ML8A 4ZLPA 2CXCA 2YWBA 4DR6C 3H2TA 3S82A 1BA3A 1WF3A 4LFAC 4I9FA 3J80D 3LUSA 5DV9A 2P2FA 1GPMA 1RG9A 4DG8A 4YY3C 3JAMD 4YHHC 5H9UA 1MKYA 2P2MA 4G1IA 5GTDA 5BSWA 3SO4A 2QL8A 3EQ6A 4JYAC 4X62C 4B3SC 1IBLC 2PT7G 1PG3A 3T1YC 4X66C 2BJOA 2OBVA 2Y4NA 1XRCA 2Y4OA 4ISBA 4I9GA 4RMNA 3NI2A 2HJGA 1N34C 3ETCA 1FJGC 3R44A 4FUTA 5IT9D 4GS5A 1UKKA 4D57A 5CZXA 3E7XA 2D28C 4JM1A 3KXWA 3FCEA 2EGTA 4FUQA 2VZEA 4U5YD 4LF4C 1EGAA 4KHPC 2AYAA 1O9TA 5BR8C 4DV1C 4DR4C 2KZFA 3UZ0A 4GXRA 4GXQA 4NXMC 3J81D 5ADZA 3AF5A 4JI3C 5A1GA 1QWIA 3UOWA 2WD9A 5IFIA 1V26A 4DCUA 1XRAA 5BUQA 4D56A 5CZVA 4DUZC 2DYJA 1O92A 3G7SA 3TUFA 4X65C 2QVYX 5AE2A 4OXIA 4PROC 3T1HC 1XNQC 5BSVA 3NPDA 1LCIA 1HNXC 5KYTA 4DR1C 2UUAC 4JV5C 4R1LA 4DCVA 3GR1A 3DAYA 4LFBC 4PZPA 2D1TA 4FTFA 4DCSA 4JI2C 3I08A 3AF6A 2ATWA 3NYQA 4XX2A 4MTNA 2E0GA 1N32C 3GR0A 2D1SA 1XMOC 2YCBA 2HHHC 1VLAA 3IMLA 5T8TA 2PN2A 1IBMC 3N54B 4DV7C 4DR7C 4G37A 1PA4A 1ZB9A 5E7QA 1N33C 3A9UA 5KYVA 2WP0C 2D1QA 4IR7A 4D4IA 4DR5C 2F4VC 3FCCA 2DPLA 4OX9C 5BURA 3VNRA 4JI7C 1XMQC 1HH2P 4GKKC 4B3RC 4K0KC 4RVNA 2PROA 2E8EA 2VQEC 1T5DX 3E7WA 4DUYC 3ETOA 3DHVA 2BH1X 4NOZA 4GKJC 3PESA 5BSMA 3VNSA 2VSQA 1MXAA 4JI5C 4RLFA 4D4GA 1MD9A 4L7IA 4OYCA 5BSTA 4B3TC 3GPCA 4RVOA 1I94C 3L95X 5K85A 4DG9A 3B7WA 2V7BA 3CJEA 3R9XA 1USPB 2ASBA 1QM4A 2UUCC 2VQFC 1ZB8A 4JI0C 2UXCC 3LNVA 4HPVA 4JI6C 2P2BA 1RY2A 4DV2C 4DR2C 4WV3A 5AE3A 1JOSA 4R0MA 5A19A 1XNRC 1FUGA 4DV4C 5A2QD 1L2FA 1P7LA 2E8CA 4L2ZA 1J5EC 4MH4A 4PHTA 4X64C 2P2JA 4DR3C 5BSRA 2UXDC 5LMNC 4NDNA 3LAXA 4R1MA 4LFCC 4LF8C 2E5LC 4JI8C 3R9WA 1T5HX 5BUSA 4BC9A 1K0RA 5BSUA 4DV5C 5KEIA 1V25A 3IEUA 2ONFA 4DV3C 3CW9A 2QW0X 3RG2A 2P02A 4RM3A 1HNZC 5IWAC 4WS9A 3NYRA 3TDEA 3N2QA 3PBKA 2UUBC 4ZJZA 4G36A 1N2FA 1XRBA 1PG4A 1MDBA 3OTOC 3PROC 1HR0C 4AQYC 2Y27A 4KTTA 1IBKC 1O90A 3EERA 4LF5C 4EATA 1N36C 4LF7C 3IPLA 4RM2A 2QVZX 3J7AD 3A9VA 2E7GA 4LF9C 4BCAA 3GKUA 5K8FA 2XR1A 2UU9C 2UXBC 5A1IA 5AE1A 4DCTA 2OO4A 1KKGA 1USPA 2ZM6C 3RV2A 3TQIA 2OPLB 5JRHA 3DLPX 2E8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E C;  1NYE A;  1LQL A;  2PN2 A;  4MH4 A;  1IBM C;  1FJG C;  4DV6 C;  4DV7 C;  4DR7 C;  1HNW C;  4X64 C;  4DR3 C;  1ZB9 A;  1PA4 A;  5LMN C;  5IT9 D;  2UXD C;  1N33 C;  1UKK A;  1WH9 A;  4LFC C;  4LF8 C;  2E5L C;  4JI8 C;  2EGT A;  4LF6 C;  3R9W A;  4LF4 C;  4DR5 C;  2F4V C;  5FLX D;  1K0R A;  4DV5 C;  1EGA A;  4DV0 C;  4KHP C;  4OX9 C;  5LMU C;  2JMP A;  3IEU A;  5BR8 C;  4JI7 C;  1XMQ C;  1HH2 P;  4GKK C;  4B3M C;  4DV1 C;  2ONF A;  2KZF A;  4DR4 C;  4B3R C;  4K0K C;  4DV3 C;  2OPL A;  4NXM C;  3J81 D;  3IEV A;  2D7V A;  3AF5 A;  2E8E A;  1HNZ C;  2VQE C;  5IWA C;  4DUY C;  4JI3 C;  4JI1 C;  1QWI A;  3I07 A;  4DCU A;  2CY1 A;  4NXN C;  4BSZ A;  2UUB C;  4NOZ A;  4JI4 C;  1N2F A;  2DYJ A;  1ML8 A;  4DUZ C;  4GKJ C;  2CXC A;  4X65 C;  4DR6 C;  3OTO C;  1HR0 C;  4JI5 C;  4AQY C;  1WF3 A;  3T1H C;  4LFA C;  1XNQ C;  1IBK C;  1HNX C;  3J80 D;  3LUS A;  3EER A;  4B3T C;  4LF5 C;  4DR1 C;  4YY3 C;  3JAM D;  2UUA C;  4YHH C;  1N36 C;  4LF7 C;  4JV5 C;  1MKY A;  1I94 C;  3J7A D;  4DCV A;  2E7G A;  4LF9 C;  3GKU A;  4LFB C;  3CJE A;  3R9X A;  1USP B;  2ASB A;  2QL8 A;  2UUC C;  2XR1 A;  2VQF C;  1ZB8 A;  4X62 C;  2UU9 C;  4JI0 C;  4JYA C;  4B3S C;  1IBL C;  2UXB C;  2PT7 G;  4DCS A;  4JI2 C;  2UXC C;  3AF6 A;  3T1Y C;  4X66 C;  4XX2 A;  2ATW A;  4DCT A;  2BJO A;  4MTN A;  4JI6 C;  1N32 C;  4DV2 C;  1KKG A;  4DR2 C;  1USP A;  2ZM6 C;  1XMO C;  2YCB A;  1JOS A;  2OPL B;  2HHH C;  1VLA A;  1XNR C;  4DV4 C;  5A2Q D;  1L2F A;  2HJG A;  1N34 C;  2E8F A;  2E8C A; 
#chains in the Genus database with same CATH topology
 1NYE A;  1LQL A;  1MDF A;  4DV6 C;  3A4I A;  1HNW C;  4RLQ A;  1MXC A;  1V60 A;  1WH9 A;  4LE5 A;  2QVX X;  4BBY A;  4LF6 C;  5FLX D;  2D1R A;  1MXB A;  2D27 A;  4KTV A;  4DV0 C;  4L4Q A;  5LMU C;  2P2Q A;  2JMP A;  3O2E A;  4B3M C;  1AMU A;  3VNQ A;  3CW8 X;  2OPL A;  4ODJ A;  2DHM A;  3IEV A;  2YWC A;  2D7V A;  1ULT A;  3LGX A;  4BC7 A;  4TPS B;  1O93 A;  1TH5 A;  3C5E A;  2P20 A;  4JI1 C;  1YJ7 A;  5T8S A;  3I07 A;  4IZ6 A;  2CY1 A;  4NXN C;  2MMA B;  4BSZ A;  3L8C A;  4K0B A;  4JI4 C;  1ML8 A;  1P4E A;  4ZLP A;  2CXC A;  2KZ0 A;  3CQ3 A;  2YWB A;  4DR6 C;  3H2T A;  1FLO A;  3S82 A;  1BA3 A;  1PU1 A;  2ZZN A;  1WF3 A;  4LFA C;  4I9F A;  3J80 D;  3LUS A;  5DV9 A;  2P2F A;  1GPM A;  1RG9 A;  4DG8 A;  4YY3 C;  3JAM D;  4YHH C;  5H9U A;  1MKY A;  2P2M A;  3UX3 A;  4G1I A;  5GTD A;  1IB8 A;  5BSW A;  3SO4 A;  2QL8 A;  3EQ6 A;  4JYA C;  4X62 C;  4B3S C;  1IBL C;  2PT7 G;  1PG3 A;  3T1Y C;  4X66 C;  2BJO A;  2OBV A;  2Y4N A;  1XRC A;  2Y4O A;  4ISB A;  4I9G A;  4RMN A;  3NI2 A;  2JNV A;  2HJG A;  1VEH A;  1N34 C;  2YX1 A;  3ETC A;  3A25 A;  1FJG C;  3R44 A;  3UX2 A;  4FUT A;  5IT9 D;  4GS5 A;  1UKK A;  4D57 A;  3A26 A;  5CZX A;  3E7X A;  2D28 C;  4JM1 A;  2NCL A;  3KXW A;  3FCE A;  2EGT A;  4FUQ A;  2VZE A;  4U5Y D;  4LF4 C;  1EGA A;  2ZTB A;  4KHP C;  2AYA A;  2M5H A;  1O9T A;  5BR8 C;  4DV1 C;  4DR4 C;  2KZF A;  3UZ0 A;  4GXR A;  4GXQ A;  4NXM C;  3J81 D;  5ADZ A;  3AF5 A;  4PUG A;  2MM9 A;  4JI3 C;  5A1G A;  1QWI A;  3UOW A;  2WD9 A;  5IFI A;  1V26 A;  4DCU A;  3K6R A;  1XRA A;  5BUQ A;  4D56 A;  5CZV A;  4DUZ C;  2DYJ A;  1O92 A;  3G7S A;  3TUF A;  4X65 C;  1WCJ A;  2QVY X;  5AE2 A;  4OXI A;  4PRO C;  2Z51 A;  1P4E C;  3T1H C;  1XNQ C;  5BSV A;  3NPD A;  1LCI A;  1HNX C;  2M5O A;  5KYT A;  4DR1 C;  2UUA C;  4JV5 C;  4R1L A;  4DCV A;  3GR1 A;  3DAY A;  4LFB C;  4PZP A;  2D1T A;  4PUI A;  1M6X A;  4FTF A;  4DCS A;  4JI2 C;  3I08 A;  3AF6 A;  2ATW A;  3NYQ A;  4XX2 A;  4MTN A;  2E0G A;  1N32 C;  1M6X C;  3GR0 A;  2D1S A;  1XMO C;  2YCB A;  2HHH C;  1VLA A;  3IML A;  5T8T A;  2PN2 A;  1IBM C;  3N54 B;  4DV7 C;  4DR7 C;  4G37 A;  5LCI A;  1PA4 A;  1ZB9 A;  5E7Q A;  1N33 C;  3A9U A;  5KYV A;  2WP0 C;  2D1Q A;  4IR7 A;  4D4I A;  4DR5 C;  2F4V C;  3FCC A;  2DPL A;  4OX9 C;  5BUR A;  3VNR A;  2KDN A;  4JI7 C;  1XMQ C;  1HH2 P;  4GKK C;  4B3R C;  4K0K C;  3LNO A;  4RVN A;  3CQ2 A;  2PRO A;  2E8E A;  2VQE C;  1T5D X;  3E7W A;  4DUY C;  3ETO A;  3DHV A;  2BH1 X;  4NOZ A;  4GKJ C;  3PES A;  5BSM A;  3VNS A;  2VSQ A;  1MXA A;  4JI5 C;  4RLF A;  4D4G A;  1MD9 A;  2PG1 E;  4L7I A;  4OYC A;  5BST A;  4B3T C;  2ZZM A;  3GPC A;  4RVO A;  1I94 C;  3L95 X;  5K85 A;  4DG9 A;  3B7W A;  2V7B A;  3CJE A;  3R9X A;  1USP B;  2ASB A;  1QM4 A;  2UUC C;  2VQF C;  1ZB8 A;  4JI0 C;  1NY8 A;  3LNV A;  2UXC C;  4HPV A;  4JI6 C;  2P2B A;  1RY2 A;  1XDX A;  4DV2 C;  4DR2 C;  4WV3 A;  5AE3 A;  1JOS A;  4R0M A;  5A19 A;  1XNR C;  1FUG A;  4DV4 C;  5A2Q D;  1L2F A;  4PUH A;  3UEB A;  1P7L A;  2E8C A;  4L2Z A;  1J5E C;  4MH4 A;  4PHT A;  4X64 C;  2P2J A;  4DR3 C;  5BSR A;  2UXD C;  5LMN C;  4NDN A;  3LAX A;  4R1M A;  4LFC C;  4LF8 C;  2E5L C;  4JI8 C;  3R9W A;  1T5H X;  5BUS A;  4BC9 A;  1K0R A;  5BSU A;  4DV5 C;  5KEI A;  1V25 A;  3IEU A;  2ONF A;  4DV3 C;  3CW9 A;  2QW0 X;  3RG2 A;  2P02 A;  4RM3 A;  1HNZ C;  5IWA C;  3FM7 A;  4WS9 A;  3NYR A;  3TDE A;  3N2Q A;  3PBK A;  2UUB C;  4ZJZ A;  4G36 A;  1N2F A;  1XRB A;  1PG4 A;  1MDB A;  3OTO C;  3PRO C;  1HR0 C;  4AQY C;  1XHJ A;  2Y27 A;  1YGT A;  4KTT A;  1IBK C;  1O90 A;  1XS3 A;  3EER A;  4LF5 C;  4EAT A;  1N36 C;  4LF7 C;  3IPL A;  4RM2 A;  2QVZ X;  3J7A D;  3A9V A;  2CU6 A;  2E7G A;  4LF9 C;  4BCA A;  3GKU A;  2MCQ A;  5K8F A;  2XR1 A;  2UU9 C;  2UXB C;  3TR3 A;  5A1I A;  5AE1 A;  1UWD A;  3AY0 A;  4DCT A;  2OO4 A;  1KKG A;  1USP A;  2ZM6 C;  3RV2 A;  3TQI A;  2OPL B;  5JRH A;  3DLP X;  3CQ1 A;  2E8F A; 
#chains in the Genus database with same CATH homology
 1NYE A;  1LQL A;  1MDF A;  4DV6 C;  3A4I A;  1HNW C;  4RLQ A;  1MXC A;  1WH9 A;  4LE5 A;  2QVX X;  4BBY A;  4LF6 C;  5FLX D;  2D1R A;  1MXB A;  2D27 A;  4KTV A;  4DV0 C;  4L4Q A;  5LMU C;  2P2Q A;  2JMP A;  4B3M C;  1AMU A;  3VNQ A;  3CW8 X;  2OPL A;  4ODJ A;  3IEV A;  2YWC A;  2D7V A;  1ULT A;  3LGX A;  4BC7 A;  4TPS B;  1O93 A;  3C5E A;  2P20 A;  4JI1 C;  1YJ7 A;  5T8S A;  3I07 A;  4IZ6 A;  2CY1 A;  4NXN C;  4BSZ A;  3L8C A;  4K0B A;  4JI4 C;  1ML8 A;  4ZLP A;  2CXC A;  2YWB A;  4DR6 C;  3H2T A;  3S82 A;  1BA3 A;  1WF3 A;  4LFA C;  4I9F A;  3J80 D;  3LUS A;  5DV9 A;  2P2F A;  1GPM A;  1RG9 A;  4DG8 A;  4YY3 C;  3JAM D;  4YHH C;  5H9U A;  1MKY A;  2P2M A;  4G1I A;  5GTD A;  5BSW A;  3SO4 A;  2QL8 A;  3EQ6 A;  4JYA C;  4X62 C;  4B3S C;  1IBL C;  2PT7 G;  1PG3 A;  3T1Y C;  4X66 C;  2BJO A;  2OBV A;  2Y4N A;  1XRC A;  2Y4O A;  4ISB A;  4I9G A;  4RMN A;  3NI2 A;  2HJG A;  1N34 C;  3ETC A;  1FJG C;  3R44 A;  4FUT A;  5IT9 D;  4GS5 A;  1UKK A;  4D57 A;  5CZX A;  3E7X A;  2D28 C;  4JM1 A;  3KXW A;  3FCE A;  2EGT A;  4FUQ A;  2VZE A;  4U5Y D;  4LF4 C;  1EGA A;  4KHP C;  2AYA A;  1O9T A;  5BR8 C;  4DV1 C;  4DR4 C;  2KZF A;  3UZ0 A;  4GXR A;  4GXQ A;  4NXM C;  3J81 D;  5ADZ A;  3AF5 A;  4JI3 C;  5A1G A;  1QWI A;  3UOW A;  2WD9 A;  5IFI A;  1V26 A;  4DCU A;  1XRA A;  5BUQ A;  4D56 A;  5CZV A;  4DUZ C;  2DYJ A;  1O92 A;  3G7S A;  3TUF A;  4X65 C;  2QVY X;  5AE2 A;  4OXI A;  4PRO C;  3T1H C;  1XNQ C;  5BSV A;  3NPD A;  1LCI A;  1HNX C;  5KYT A;  4DR1 C;  2UUA C;  4JV5 C;  4R1L A;  4DCV A;  3GR1 A;  3DAY A;  4LFB C;  4PZP A;  2D1T A;  4FTF A;  4DCS A;  4JI2 C;  3I08 A;  3AF6 A;  2ATW A;  3NYQ A;  4XX2 A;  4MTN A;  2E0G A;  1N32 C;  3GR0 A;  2D1S A;  1XMO C;  2YCB A;  2HHH C;  1VLA A;  3IML A;  5T8T A;  2PN2 A;  1IBM C;  3N54 B;  4DV7 C;  4DR7 C;  4G37 A;  1PA4 A;  1ZB9 A;  5E7Q A;  1N33 C;  3A9U A;  5KYV A;  2WP0 C;  2D1Q A;  4IR7 A;  4D4I A;  4DR5 C;  2F4V C;  3FCC A;  2DPL A;  4OX9 C;  5BUR A;  3VNR A;  4JI7 C;  1XMQ C;  1HH2 P;  4GKK C;  4B3R C;  4K0K C;  4RVN A;  2PRO A;  2E8E A;  2VQE C;  1T5D X;  3E7W A;  4DUY C;  3ETO A;  3DHV A;  2BH1 X;  4NOZ A;  4GKJ C;  3PES A;  5BSM A;  3VNS A;  2VSQ A;  1MXA A;  4JI5 C;  4RLF A;  4D4G A;  1MD9 A;  4L7I A;  4OYC A;  5BST A;  4B3T C;  3GPC A;  4RVO A;  1I94 C;  3L95 X;  5K85 A;  4DG9 A;  3B7W A;  2V7B A;  3CJE A;  3R9X A;  1USP B;  2ASB A;  1QM4 A;  2UUC C;  2VQF C;  1ZB8 A;  4JI0 C;  2UXC C;  3LNV A;  4HPV A;  4JI6 C;  2P2B A;  1RY2 A;  4DV2 C;  4DR2 C;  4WV3 A;  5AE3 A;  1JOS A;  4R0M A;  5A19 A;  1XNR C;  1FUG A;  4DV4 C;  5A2Q D;  1L2F A;  1P7L A;  2E8C A;  4L2Z A;  1J5E C;  4MH4 A;  4PHT A;  4X64 C;  2P2J A;  4DR3 C;  5BSR A;  2UXD C;  5LMN C;  4NDN A;  3LAX A;  4R1M A;  4LFC C;  4LF8 C;  2E5L C;  4JI8 C;  3R9W A;  1T5H X;  5BUS A;  4BC9 A;  1K0R A;  5BSU A;  4DV5 C;  5KEI A;  1V25 A;  3IEU A;  2ONF A;  4DV3 C;  3CW9 A;  2QW0 X;  3RG2 A;  2P02 A;  4RM3 A;  1HNZ C;  5IWA C;  4WS9 A;  3NYR A;  3TDE A;  3N2Q A;  3PBK A;  2UUB C;  4ZJZ A;  4G36 A;  1N2F A;  1XRB A;  1PG4 A;  1MDB A;  3OTO C;  3PRO C;  1HR0 C;  4AQY C;  2Y27 A;  4KTT A;  1IBK C;  1O90 A;  3EER A;  4LF5 C;  4EAT A;  1N36 C;  4LF7 C;  3IPL A;  4RM2 A;  2QVZ X;  3J7A D;  3A9V A;  2E7G A;  4LF9 C;  4BCA A;  3GKU A;  5K8F A;  2XR1 A;  2UU9 C;  2UXB C;  5A1I A;  5AE1 A;  4DCT A;  2OO4 A;  1KKG A;  1USP A;  2ZM6 C;  3RV2 A;  3TQI A;  2OPL B;  5JRH A;  3DLP X;  2E8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...