4DV3C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv3C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv3C02
5LMUC 4JI4C 2HJGA 1IBMC 1IBKC 2F4VC 4DR1C 2VQFC 2ASBA 2VQEC 4BSZA 3IEUA 1N2FA 2E8CA 4X64C 4YHHC 1N36C 4LF4C 4LF8C 5IWAC 1USPB 1N33C 4JI6C 2UXCC 2UXDC 4JI7C 2ATWA 1LQLA 1QWIA 4LFBC 5BR8C 2OPLA 4JI3C 2UXBC 4DR4C 1HNZC 2UUAC 1MKYA 2PT7G 5LMNC 1JOSA 4DR3C 3T1HC 1WF3A 1XNRC 1K0RA 3J80D 1I94C 2CY1A 5FLXD 4DCVA 4AQYC 2QL8A 4DV4C 4LF5C 4B3TC 4DR6C 4DR7C 1J5EC 2YCBA 4GKKC 3I07A 1UKKA 4JI0C 2KZFA 1HH2P 4JI1C 2UUBC 2E8EA 1L2FA 4MH4A 3AF6A 4DR2C 1WH9A 2D7VA 4B3SC 2ONFA 1HNWC 4LF7C 4JV5C 1ML8A 4X66C 4NOZA 4GKJC 4DV7C 1KKGA 1EGAA 3JAMD 4JI5C 1USPA 4JYAC 4DCTA 1N34C 2BJOA 4DV2C 1N32C 2UUCC 4NXNC 3LUSA 4DV1C 4JI2C 4DUZC 4LF6C 2EGTA 2CXCA 2E8FA 3R9WA 4DV5C 1IBLC 4DV0C 4DV6C 4MTNA 2E7GA 2PN2A 5A2QD 1HR0C 4OX9C 1VLAA 4DR5C 2OPLB 4DV3C 4YY3C 4X62C 4NXMC 1XMQC 4LFCC 2E5LC 3GKUA 4LF9C 1XMOC 3IEVA 3J7AD 4DUYC 4JI8C 4K0KC 1NYEA 1ZB8A 4KHPC 5IT9D 3AF5A 4DCUA 4B3MC 1FJGC 3J81D 2UU9C 1HNXC 3R9XA 2JMPA 2ZM6C 1ZB9A 2HHHC 4XX2A 2DYJA 4X65C 1PA4A 1XNQC 4B3RC 3EERA 3T1YC 2XR1A 3OTOC 4DCSA 3CJEA 4LFAC
chains in the Genus database with same CATH superfamily
3CQ3A 3CQ1A 1IBKC 2VSQA 5BSUA 2ASBA 1V25A 4BSZA 2PROA 3IEUA 2E8CA 4RVNA 4X64C 1N36C 3RV2A 3DHVA 4LF4C 5IFIA 5IWAC 1QWIA 4LFBC 3B7WA 3FCCA 2VZEA 2UXBC 1HNZC 3ETOA 4D4GA 2UUAC 5LMNC 2QVYX 4ISBA 1V26A 4R0MA 3PBKA 4R1MA 3KXWA 2CY1A 4DCVA 4NDNA 3UX3A 3GR1A 4DR6C 4DR7C 1J5EC 4GKKC 1UKKA 4JI0C 4JI1C 4MH4A 4DR2C 2ONFA 2P2FA 3NPDA 1AMUA 1ULTA 5BUSA 4GKJC 1RG9A 4JI5C 2D27A 2M5HA 4BC7A 4RLQA 1TH5A 2BJOA 1MDBA 3FCEA 4DV2C 2CU6A 2WD9A 4HPVA 4D4IA 4DUZC 1MXBA 3K6RA 3N54B 3NYQA 2P2MA 3E7WA 3O2EA 4DV5C 4ZJZA 4DV6C 2E0GA 4OX9C 2KDNA 1VLAA 4ODJA 2OPLB 3GKUA 4LF9C 1T5HX 2BH1X 4JI8C 2QW0X 3AF5A 1HNXC 2JMPA 1MXCA 3NI2A 4K0BA 1MDFA 4B3RC 3EERA 1YJ7A 4DG8A 2D1RA 1FLOA 2P2BA 3TUFA 5BUQA 1MXAA 2F4VC 3A25A 5ADZA 3LNOA 4PUHA 2PG1E 3I08A 2NCLA 4I9GA 1N33C 2UXDC 2UXCC 1LQLA 5T8TA 5BR8C 2OPLA 4JI3C 3VNSA 1XRCA 3G7SA 1T5DX 4ZLPA 5H9UA 1WF3A 4EATA 2YWCA 1I94C 5FLXD 1P4EC 4AQYC 2D1TA 2WP0C 4U5YD 4PZPA 4LF5C 4B3TC 3LAXA 1O90A 5A19A 4G36A 2KZFA 4BCAA 2UUBC 1L2FA 5CZXA 3UOWA 4RM2A 5E7QA 4B3SC 2Z51A 3A9UA 4RM3A 2QVXX 5DV9A 4G1IA 4LF7C 4JV5C 4X66C 1GPMA 5A1GA 3UZ0A 4DCTA 5GTDA 3TR3A 5T8SA 1V60A 3GR0A 4JI2C 4FUQA 2EGTA 1WCJA 3GPCA 2D1SA 4PHTA 2V7BA 3R9WA 1IBLC 1LCIA 5A2QD 1M6XC 3NYRA 1HR0C 4FTFA 1IB8A 4DR5C 1XDXA 3DLPX 3L95X 5AE3A 3VNRA 3UX2A 3IEVA 4BC9A 4RLFA 4G37A 4K0KC 1ZB8A 3A26A 3J81D 5AE2A 3R9XA 1ZB9A 2DYJA 4X65C 1PA4A 5BSTA 1XNQC 5KYVA 4WS9A 4LFAC 5LMUC 4KTTA 2AYAA 3FM7A 1IBMC 1QM4A 4L7IA 2VQEC 1N2FA 4LF8C 4GS5A 5A1IA 1USPB 2D1QA 4JI6C 3IPLA 4JI7C 2ATWA 4L2ZA 1XRBA 1PG4A 5BSVA 5AE1A 2DHMA 1MKYA 1JOSA 4DR3C 4FUTA 3SO4A 1XNRC 3TDEA 2YX1A 2Y4NA 1PU1A 4BBYA 4I9FA 3ETCA 3A4IA 3CW9A 3N2QA 2Y4OA 2YCBA 1HH2P 2E8EA 5CZVA 3PROC 1WH9A 2D7VA 5BSWA 4JM1A 1USPA 2OO4A 3LGXA 1N34C 1XHJA 2QVZX 3TQIA 4NXNC 3E7XA 4DG9A 1P4EA 3CQ2A 4OYCA 3RG2A 5K8FA 3LNVA 2MM9A 2E7GA 4RMNA 4DV3C 3EQ6A 4IZ6A 1XMQC 2E5LC 4PUGA 5BURA 1FUGA 4DUYC 1NY8A 2KZ0A 1NYEA 4KHPC 5IT9D 1RY2A 5BSRA 1FJGC 4PUIA 5K85A 3H2TA 4KTVA 4XX2A 2HHHC 3C5EA 4IR7A 3T1YC 1XRAA 3OTOC 3PESA 1M6XA 4JI4C 2HJGA 5KEIA 4DR1C 2VQFC 4YHHC 1O92A 1UWDA 3A9VA 4GXRA 4DR4C 3AY0A 2PT7G 4GXQA 3T1HC 1K0RA 1P7LA 1VEHA 3J80D 4D57A 3DAYA 2JNVA 1YGTA 2QL8A 4L4QA 4DV4C 2MMAB 3R44A 4LE5A 3I07A 3S82A 5KYTA 2D28C 3UEBA 2ZZMA 3AF6A 1O9TA 1HNWC 1BA3A 4PROC 1ML8A 2ZTBA 4NOZA 4DV7C 2MCQA 1KKGA 1EGAA 3JAMD 1O93A 4JYAC 2Y27A 1PG3A 4WV3A 3VNQA 1N32C 2UUCC 3LUSA 4DV1C 4R1LA 4LF6C 2CXCA 5LCIA 4RVOA 2P20A 2E8FA 4DV0C 4MTNA 2PN2A 2M5OA 2YWBA 4D56A 3IMLA 2P2QA 1MD9A 4YY3C 4NXMC 4X62C 4LFCC 1XMOC 5BSMA 3J7AD 2P2JA 4DCUA 4B3MC 3L8CA 3CW8X 2OBVA 2UU9C 2P02A 2ZM6C 2ZZNA 2DPLA 1XS3A 4TPSB 4OXIA 2XR1A 4DCSA 3CJEA 5JRHA
chains in the Genus database with same CATH topology
1IBKC 2VSQA 5BSUA 2ASBA 1V25A 4BSZA 4X64C 2PROA 2E8CA 3IEUA 4RVNA 1N36C 3RV2A 3DHVA 4LF4C 5IFIA 5IWAC 1QWIA 4LFBC 3B7WA 3FCCA 2VZEA 2UXBC 1HNZC 3ETOA 4D4GA 2UUAC 5LMNC 2QVYX 4ISBA 1V26A 4R0MA 3PBKA 4R1MA 3KXWA 2CY1A 4DCVA 4NDNA 3GR1A 4DR6C 4DR7C 1J5EC 4GKKC 1UKKA 4JI0C 4JI1C 4MH4A 4DR2C 2ONFA 2P2FA 3NPDA 1AMUA 1ULTA 5BUSA 4GKJC 1RG9A 4JI5C 2D27A 4BC7A 4RLQA 2BJOA 1MDBA 3FCEA 4DV2C 2WD9A 4HPVA 4D4IA 4DUZC 1MXBA 3N54B 3NYQA 2P2MA 3E7WA 4DV5C 4ZJZA 4DV6C 2E0GA 4OX9C 1VLAA 4ODJA 2OPLB 3GKUA 4LF9C 1T5HX 2BH1X 4JI8C 2QW0X 3AF5A 1HNXC 2JMPA 1MXCA 3NI2A 4K0BA 1MDFA 4B3RC 3EERA 1YJ7A 4DG8A 2D1RA 2P2BA 3TUFA 5BUQA 1MXAA 2F4VC 5ADZA 3I08A 4I9GA 1N33C 2UXDC 2UXCC 1LQLA 5T8TA 5BR8C 2OPLA 4JI3C 3VNSA 1XRCA 3G7SA 1T5DX 4ZLPA 5H9UA 1WF3A 4EATA 2YWCA 1I94C 5FLXD 4AQYC 2D1TA 2WP0C 4U5YD 4PZPA 4LF5C 4B3TC 3LAXA 1O90A 5A19A 4G36A 2KZFA 4BCAA 2UUBC 1L2FA 5CZXA 3UOWA 4RM2A 5E7QA 4B3SC 3A9UA 4RM3A 2QVXX 5DV9A 4G1IA 4LF7C 4JV5C 4X66C 1GPMA 5A1GA 3UZ0A 4DCTA 5GTDA 5T8SA 3GR0A 4JI2C 4FUQA 2EGTA 3GPCA 2D1SA 4PHTA 2V7BA 3R9WA 1IBLC 1LCIA 5A2QD 1HR0C 3NYRA 4FTFA 4DR5C 3DLPX 3L95X 5AE3A 3VNRA 3IEVA 4BC9A 4RLFA 4G37A 4K0KC 1ZB8A 3J81D 5AE2A 3R9XA 1ZB9A 2DYJA 4X65C 1PA4A 5BSTA 1XNQC 5KYVA 4WS9A 4LFAC 5LMUC 4KTTA 2AYAA 1IBMC 1QM4A 4L7IA 2VQEC 1N2FA 4LF8C 4GS5A 5A1IA 1USPB 2D1QA 4JI6C 3IPLA 4JI7C 2ATWA 4L2ZA 1XRBA 1PG4A 5BSVA 5AE1A 1MKYA 1JOSA 4DR3C 4FUTA 3SO4A 1XNRC 3TDEA 2Y4NA 4BBYA 4I9FA 3ETCA 3A4IA 3CW9A 3N2QA 2Y4OA 2YCBA 1HH2P 2E8EA 5CZVA 3PROC 1WH9A 2D7VA 5BSWA 4JM1A 1USPA 2OO4A 3LGXA 1N34C 2QVZX 3TQIA 4NXNC 3E7XA 4DG9A 4OYCA 3RG2A 5K8FA 3LNVA 2E7GA 4RMNA 4DV3C 3EQ6A 4IZ6A 1XMQC 2E5LC 5BURA 1FUGA 4DUYC 1NYEA 4KHPC 5IT9D 1RY2A 5BSRA 1FJGC 5K85A 3H2TA 4KTVA 4XX2A 2HHHC 3C5EA 4IR7A 3T1YC 1XRAA 3OTOC 3PESA 4JI4C 2HJGA 5KEIA 4DR1C 2VQFC 4YHHC 1O92A 3A9VA 4GXRA 4DR4C 2PT7G 4GXQA 3T1HC 1K0RA 1P7LA 3J80D 4D57A 3DAYA 2QL8A 4L4QA 4DV4C 3R44A 4LE5A 3I07A 3S82A 5KYTA 2D28C 3AF6A 1O9TA 1HNWC 1BA3A 4PROC 1ML8A 4NOZA 4DV7C 1KKGA 1EGAA 3JAMD 1O93A 4JYAC 2Y27A 1PG3A 4WV3A 3VNQA 1N32C 2UUCC 3LUSA 4DV1C 4R1LA 4LF6C 2CXCA 4RVOA 2P20A 2E8FA 4DV0C 4MTNA 2PN2A 2YWBA 4D56A 3IMLA 2P2QA 1MD9A 4YY3C 4NXMC 4X62C 4LFCC 1XMOC 5BSMA 3J7AD 2P2JA 4DCUA 4B3MC 3L8CA 3CW8X 2OBVA 2UU9C 2P02A 2ZM6C 2DPLA 4TPSB 4OXIA 2XR1A 4DCSA 3CJEA 5JRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU C;  4JI4 C;  2HJG A;  1IBM C;  1IBK C;  2F4V C;  4DR1 C;  2VQF C;  2ASB A;  2VQE C;  4BSZ A;  3IEU A;  1N2F A;  2E8C A;  4X64 C;  4YHH C;  1N36 C;  4LF4 C;  4LF8 C;  5IWA C;  1USP B;  1N33 C;  4JI6 C;  2UXC C;  2UXD C;  4JI7 C;  2ATW A;  1LQL A;  1QWI A;  4LFB C;  5BR8 C;  2OPL A;  4JI3 C;  2UXB C;  4DR4 C;  1HNZ C;  2UUA C;  1MKY A;  2PT7 G;  5LMN C;  1JOS A;  4DR3 C;  3T1H C;  1WF3 A;  1XNR C;  1K0R A;  3J80 D;  1I94 C;  2CY1 A;  5FLX D;  4DCV A;  4AQY C;  2QL8 A;  4DV4 C;  4LF5 C;  4B3T C;  4DR6 C;  4DR7 C;  1J5E C;  2YCB A;  4GKK C;  3I07 A;  1UKK A;  4JI0 C;  2KZF A;  1HH2 P;  4JI1 C;  2UUB C;  2E8E A;  1L2F A;  4MH4 A;  3AF6 A;  4DR2 C;  1WH9 A;  2D7V A;  4B3S C;  2ONF A;  1HNW C;  4LF7 C;  4JV5 C;  1ML8 A;  4X66 C;  4NOZ A;  4GKJ C;  4DV7 C;  1KKG A;  1EGA A;  3JAM D;  4JI5 C;  1USP A;  4JYA C;  4DCT A;  1N34 C;  2BJO A;  4DV2 C;  1N32 C;  2UUC C;  4NXN C;  3LUS A;  4DV1 C;  4JI2 C;  4DUZ C;  4LF6 C;  2EGT A;  2CXC A;  2E8F A;  3R9W A;  4DV5 C;  1IBL C;  4DV0 C;  4DV6 C;  4MTN A;  2E7G A;  2PN2 A;  5A2Q D;  1HR0 C;  4OX9 C;  1VLA A;  4DR5 C;  2OPL B;  4DV3 C;  4YY3 C;  4X62 C;  4NXM C;  1XMQ C;  4LFC C;  2E5L C;  3GKU A;  4LF9 C;  1XMO C;  3IEV A;  3J7A D;  4DUY C;  4JI8 C;  4K0K C;  1NYE A;  1ZB8 A;  4KHP C;  5IT9 D;  3AF5 A;  4DCU A;  4B3M C;  1FJG C;  3J81 D;  2UU9 C;  1HNX C;  3R9X A;  2JMP A;  2ZM6 C;  1ZB9 A;  2HHH C;  4XX2 A;  2DYJ A;  4X65 C;  1PA4 A;  1XNQ C;  4B3R C;  3EER A;  3T1Y C;  2XR1 A;  3OTO C;  4DCS A;  3CJE A;  4LFA C; 
#chains in the Genus database with same CATH topology
 3CQ3 A;  3CQ1 A;  1IBK C;  2VSQ A;  5BSU A;  2ASB A;  1V25 A;  4BSZ A;  2PRO A;  3IEU A;  2E8C A;  4RVN A;  4X64 C;  1N36 C;  3RV2 A;  3DHV A;  4LF4 C;  5IFI A;  5IWA C;  1QWI A;  4LFB C;  3B7W A;  3FCC A;  2VZE A;  2UXB C;  1HNZ C;  3ETO A;  4D4G A;  2UUA C;  5LMN C;  2QVY X;  4ISB A;  1V26 A;  4R0M A;  3PBK A;  4R1M A;  3KXW A;  2CY1 A;  4DCV A;  4NDN A;  3UX3 A;  3GR1 A;  4DR6 C;  4DR7 C;  1J5E C;  4GKK C;  1UKK A;  4JI0 C;  4JI1 C;  4MH4 A;  4DR2 C;  2ONF A;  2P2F A;  3NPD A;  1AMU A;  1ULT A;  5BUS A;  4GKJ C;  1RG9 A;  4JI5 C;  2D27 A;  2M5H A;  4BC7 A;  4RLQ A;  1TH5 A;  2BJO A;  1MDB A;  3FCE A;  4DV2 C;  2CU6 A;  2WD9 A;  4HPV A;  4D4I A;  4DUZ C;  1MXB A;  3K6R A;  3N54 B;  3NYQ A;  2P2M A;  3E7W A;  3O2E A;  4DV5 C;  4ZJZ A;  4DV6 C;  2E0G A;  4OX9 C;  2KDN A;  1VLA A;  4ODJ A;  2OPL B;  3GKU A;  4LF9 C;  1T5H X;  2BH1 X;  4JI8 C;  2QW0 X;  3AF5 A;  1HNX C;  2JMP A;  1MXC A;  3NI2 A;  4K0B A;  1MDF A;  4B3R C;  3EER A;  1YJ7 A;  4DG8 A;  2D1R A;  1FLO A;  2P2B A;  3TUF A;  5BUQ A;  1MXA A;  2F4V C;  3A25 A;  5ADZ A;  3LNO A;  4PUH A;  2PG1 E;  3I08 A;  2NCL A;  4I9G A;  1N33 C;  2UXD C;  2UXC C;  1LQL A;  5T8T A;  5BR8 C;  2OPL A;  4JI3 C;  3VNS A;  1XRC A;  3G7S A;  1T5D X;  4ZLP A;  5H9U A;  1WF3 A;  4EAT A;  2YWC A;  1I94 C;  5FLX D;  1P4E C;  4AQY C;  2D1T A;  2WP0 C;  4U5Y D;  4PZP A;  4LF5 C;  4B3T C;  3LAX A;  1O90 A;  5A19 A;  4G36 A;  2KZF A;  4BCA A;  2UUB C;  1L2F A;  5CZX A;  3UOW A;  4RM2 A;  5E7Q A;  4B3S C;  2Z51 A;  3A9U A;  4RM3 A;  2QVX X;  5DV9 A;  4G1I A;  4LF7 C;  4JV5 C;  4X66 C;  1GPM A;  5A1G A;  3UZ0 A;  4DCT A;  5GTD A;  3TR3 A;  5T8S A;  1V60 A;  3GR0 A;  4JI2 C;  4FUQ A;  2EGT A;  1WCJ A;  3GPC A;  2D1S A;  4PHT A;  2V7B A;  3R9W A;  1IBL C;  1LCI A;  5A2Q D;  1M6X C;  3NYR A;  1HR0 C;  4FTF A;  1IB8 A;  4DR5 C;  1XDX A;  3DLP X;  3L95 X;  5AE3 A;  3VNR A;  3UX2 A;  3IEV A;  4BC9 A;  4RLF A;  4G37 A;  4K0K C;  1ZB8 A;  3A26 A;  3J81 D;  5AE2 A;  3R9X A;  1ZB9 A;  2DYJ A;  4X65 C;  1PA4 A;  5BST A;  1XNQ C;  5KYV A;  4WS9 A;  4LFA C;  5LMU C;  4KTT A;  2AYA A;  3FM7 A;  1IBM C;  1QM4 A;  4L7I A;  2VQE C;  1N2F A;  4LF8 C;  4GS5 A;  5A1I A;  1USP B;  2D1Q A;  4JI6 C;  3IPL A;  4JI7 C;  2ATW A;  4L2Z A;  1XRB A;  1PG4 A;  5BSV A;  5AE1 A;  2DHM A;  1MKY A;  1JOS A;  4DR3 C;  4FUT A;  3SO4 A;  1XNR C;  3TDE A;  2YX1 A;  2Y4N A;  1PU1 A;  4BBY A;  4I9F A;  3ETC A;  3A4I A;  3CW9 A;  3N2Q A;  2Y4O A;  2YCB A;  1HH2 P;  2E8E A;  5CZV A;  3PRO C;  1WH9 A;  2D7V A;  5BSW A;  4JM1 A;  1USP A;  2OO4 A;  3LGX A;  1N34 C;  1XHJ A;  2QVZ X;  3TQI A;  4NXN C;  3E7X A;  4DG9 A;  1P4E A;  3CQ2 A;  4OYC A;  3RG2 A;  5K8F A;  3LNV A;  2MM9 A;  2E7G A;  4RMN A;  4DV3 C;  3EQ6 A;  4IZ6 A;  1XMQ C;  2E5L C;  4PUG A;  5BUR A;  1FUG A;  4DUY C;  1NY8 A;  2KZ0 A;  1NYE A;  4KHP C;  5IT9 D;  1RY2 A;  5BSR A;  1FJG C;  4PUI A;  5K85 A;  3H2T A;  4KTV A;  4XX2 A;  2HHH C;  3C5E A;  4IR7 A;  3T1Y C;  1XRA A;  3OTO C;  3PES A;  1M6X A;  4JI4 C;  2HJG A;  5KEI A;  4DR1 C;  2VQF C;  4YHH C;  1O92 A;  1UWD A;  3A9V A;  4GXR A;  4DR4 C;  3AY0 A;  2PT7 G;  4GXQ A;  3T1H C;  1K0R A;  1P7L A;  1VEH A;  3J80 D;  4D57 A;  3DAY A;  2JNV A;  1YGT A;  2QL8 A;  4L4Q A;  4DV4 C;  2MMA B;  3R44 A;  4LE5 A;  3I07 A;  3S82 A;  5KYT A;  2D28 C;  3UEB A;  2ZZM A;  3AF6 A;  1O9T A;  1HNW C;  1BA3 A;  4PRO C;  1ML8 A;  2ZTB A;  4NOZ A;  4DV7 C;  2MCQ A;  1KKG A;  1EGA A;  3JAM D;  1O93 A;  4JYA C;  2Y27 A;  1PG3 A;  4WV3 A;  3VNQ A;  1N32 C;  2UUC C;  3LUS A;  4DV1 C;  4R1L A;  4LF6 C;  2CXC A;  5LCI A;  4RVO A;  2P20 A;  2E8F A;  4DV0 C;  4MTN A;  2PN2 A;  2M5O A;  2YWB A;  4D56 A;  3IML A;  2P2Q A;  1MD9 A;  4YY3 C;  4NXM C;  4X62 C;  4LFC C;  1XMO C;  5BSM A;  3J7A D;  2P2J A;  4DCU A;  4B3M C;  3L8C A;  3CW8 X;  2OBV A;  2UU9 C;  2P02 A;  2ZM6 C;  2ZZN A;  2DPL A;  1XS3 A;  4TPS B;  4OXI A;  2XR1 A;  4DCS A;  3CJE A;  5JRH A; 
#chains in the Genus database with same CATH homology
 1IBK C;  2VSQ A;  5BSU A;  2ASB A;  1V25 A;  4BSZ A;  4X64 C;  2PRO A;  2E8C A;  3IEU A;  4RVN A;  1N36 C;  3RV2 A;  3DHV A;  4LF4 C;  5IFI A;  5IWA C;  1QWI A;  4LFB C;  3B7W A;  3FCC A;  2VZE A;  2UXB C;  1HNZ C;  3ETO A;  4D4G A;  2UUA C;  5LMN C;  2QVY X;  4ISB A;  1V26 A;  4R0M A;  3PBK A;  4R1M A;  3KXW A;  2CY1 A;  4DCV A;  4NDN A;  3GR1 A;  4DR6 C;  4DR7 C;  1J5E C;  4GKK C;  1UKK A;  4JI0 C;  4JI1 C;  4MH4 A;  4DR2 C;  2ONF A;  2P2F A;  3NPD A;  1AMU A;  1ULT A;  5BUS A;  4GKJ C;  1RG9 A;  4JI5 C;  2D27 A;  4BC7 A;  4RLQ A;  2BJO A;  1MDB A;  3FCE A;  4DV2 C;  2WD9 A;  4HPV A;  4D4I A;  4DUZ C;  1MXB A;  3N54 B;  3NYQ A;  2P2M A;  3E7W A;  4DV5 C;  4ZJZ A;  4DV6 C;  2E0G A;  4OX9 C;  1VLA A;  4ODJ A;  2OPL B;  3GKU A;  4LF9 C;  1T5H X;  2BH1 X;  4JI8 C;  2QW0 X;  3AF5 A;  1HNX C;  2JMP A;  1MXC A;  3NI2 A;  4K0B A;  1MDF A;  4B3R C;  3EER A;  1YJ7 A;  4DG8 A;  2D1R A;  2P2B A;  3TUF A;  5BUQ A;  1MXA A;  2F4V C;  5ADZ A;  3I08 A;  4I9G A;  1N33 C;  2UXD C;  2UXC C;  1LQL A;  5T8T A;  5BR8 C;  2OPL A;  4JI3 C;  3VNS A;  1XRC A;  3G7S A;  1T5D X;  4ZLP A;  5H9U A;  1WF3 A;  4EAT A;  2YWC A;  1I94 C;  5FLX D;  4AQY C;  2D1T A;  2WP0 C;  4U5Y D;  4PZP A;  4LF5 C;  4B3T C;  3LAX A;  1O90 A;  5A19 A;  4G36 A;  2KZF A;  4BCA A;  2UUB C;  1L2F A;  5CZX A;  3UOW A;  4RM2 A;  5E7Q A;  4B3S C;  3A9U A;  4RM3 A;  2QVX X;  5DV9 A;  4G1I A;  4LF7 C;  4JV5 C;  4X66 C;  1GPM A;  5A1G A;  3UZ0 A;  4DCT A;  5GTD A;  5T8S A;  3GR0 A;  4JI2 C;  4FUQ A;  2EGT A;  3GPC A;  2D1S A;  4PHT A;  2V7B A;  3R9W A;  1IBL C;  1LCI A;  5A2Q D;  1HR0 C;  3NYR A;  4FTF A;  4DR5 C;  3DLP X;  3L95 X;  5AE3 A;  3VNR A;  3IEV A;  4BC9 A;  4RLF A;  4G37 A;  4K0K C;  1ZB8 A;  3J81 D;  5AE2 A;  3R9X A;  1ZB9 A;  2DYJ A;  4X65 C;  1PA4 A;  5BST A;  1XNQ C;  5KYV A;  4WS9 A;  4LFA C;  5LMU C;  4KTT A;  2AYA A;  1IBM C;  1QM4 A;  4L7I A;  2VQE C;  1N2F A;  4LF8 C;  4GS5 A;  5A1I A;  1USP B;  2D1Q A;  4JI6 C;  3IPL A;  4JI7 C;  2ATW A;  4L2Z A;  1XRB A;  1PG4 A;  5BSV A;  5AE1 A;  1MKY A;  1JOS A;  4DR3 C;  4FUT A;  3SO4 A;  1XNR C;  3TDE A;  2Y4N A;  4BBY A;  4I9F A;  3ETC A;  3A4I A;  3CW9 A;  3N2Q A;  2Y4O A;  2YCB A;  1HH2 P;  2E8E A;  5CZV A;  3PRO C;  1WH9 A;  2D7V A;  5BSW A;  4JM1 A;  1USP A;  2OO4 A;  3LGX A;  1N34 C;  2QVZ X;  3TQI A;  4NXN C;  3E7X A;  4DG9 A;  4OYC A;  3RG2 A;  5K8F A;  3LNV A;  2E7G A;  4RMN A;  4DV3 C;  3EQ6 A;  4IZ6 A;  1XMQ C;  2E5L C;  5BUR A;  1FUG A;  4DUY C;  1NYE A;  4KHP C;  5IT9 D;  1RY2 A;  5BSR A;  1FJG C;  5K85 A;  3H2T A;  4KTV A;  4XX2 A;  2HHH C;  3C5E A;  4IR7 A;  3T1Y C;  1XRA A;  3OTO C;  3PES A;  4JI4 C;  2HJG A;  5KEI A;  4DR1 C;  2VQF C;  4YHH C;  1O92 A;  3A9V A;  4GXR A;  4DR4 C;  2PT7 G;  4GXQ A;  3T1H C;  1K0R A;  1P7L A;  3J80 D;  4D57 A;  3DAY A;  2QL8 A;  4L4Q A;  4DV4 C;  3R44 A;  4LE5 A;  3I07 A;  3S82 A;  5KYT A;  2D28 C;  3AF6 A;  1O9T A;  1HNW C;  1BA3 A;  4PRO C;  1ML8 A;  4NOZ A;  4DV7 C;  1KKG A;  1EGA A;  3JAM D;  1O93 A;  4JYA C;  2Y27 A;  1PG3 A;  4WV3 A;  3VNQ A;  1N32 C;  2UUC C;  3LUS A;  4DV1 C;  4R1L A;  4LF6 C;  2CXC A;  4RVO A;  2P20 A;  2E8F A;  4DV0 C;  4MTN A;  2PN2 A;  2YWB A;  4D56 A;  3IML A;  2P2Q A;  1MD9 A;  4YY3 C;  4NXM C;  4X62 C;  4LFC C;  1XMO C;  5BSM A;  3J7A D;  2P2J A;  4DCU A;  4B3M C;  3L8C A;  3CW8 X;  2OBV A;  2UU9 C;  2P02 A;  2ZM6 C;  2DPL A;  4TPS B;  4OXI A;  2XR1 A;  4DCS A;  3CJE A;  5JRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...