4DV1C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv1C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv1C02
1ML8A 4DUYC 2EGTA 5A2QD 3AF6A 4JI5C 3R9WA 4DV6C 4DV1C 2UU9C 1XMQC 3JAMD 4LF8C 4JI7C 4DR3C 2E8CA 5IT9D 4LFAC 2CY1A 3LUSA 1HNXC 2YCBA 1HNWC 4MH4A 3J7AD 1PA4A 1UKKA 4LF5C 1KKGA 4DUZC 2UXDC 1QWIA 4OX9C 3R9XA 4DR5C 1JOSA 1IBKC 1N33C 1USPB 4NOZA 2OPLA 4JYAC 2D7VA 2UUBC 2UUCC 1HH2P 4NXMC 4YHHC 3I07A 4YY3C 2ZM6C 1HR0C 1USPA 4LFCC 1ZB9A 4X62C 4B3TC 4LF4C 4MTNA 1NYEA 2ONFA 1HNZC 4LF6C 1MKYA 1XMOC 1ZB8A 3GKUA 2JMPA 3IEVA 4JV5C 2E5LC 2OPLB 2VQEC 1FJGC 2UXBC 4JI6C 4DV4C 4LF7C 3T1HC 2E8FA 4DV5C 1N36C 4JI0C 4DV7C 4DV0C 1XNRC 3EERA 2HHHC 1J5EC 4DR7C 4B3MC 1I94C 2BJOA 3CJEA 4DCSA 5IWAC 3T1YC 5LMNC 4K0KC 2PN2A 2UXCC 1WH9A 4JI8C 1N34C 2UUAC 1N2FA 2E8EA 4DCVA 3J80D 4B3SC 4DR2C 4DR4C 1WF3A 1L2FA 4JI1C 3J81D 1LQLA 5LMUC 5FLXD 4DCUA 2PT7G 4XX2A 4LF9C 4DV2C 2F4VC 5BR8C 1N32C 1VLAA 4JI2C 4X65C 2VQFC 1IBLC 2ASBA 1K0RA 2QL8A 4LFBC 2E7GA 2DYJA 4DR1C 4KHPC 4NXNC 2KZFA 1IBMC 2HJGA 4BSZA 3AF5A 2ATWA 4JI4C 3OTOC 4DCTA 2XR1A 4B3RC 3IEUA 4DV3C 4JI3C 4GKJC 4DR6C 4AQYC 2CXCA 4X66C 4X64C 4GKKC 1XNQC 1EGAA
chains in the Genus database with same CATH superfamily
5A2QD 4JI5C 3R9WA 4DG9A 4WV3A 4PUIA 4LF8C 5CZXA 5IT9D 2CY1A 1UKKA 4RLQA 3PROC 5ADZA 2PG1E 1O93A 1P4EC 3LNOA 1UWDA 2P20A 1JOSA 3N2QA 2OPLA 4KTTA 4ODJA 3A9UA 4ZLPA 5KYVA 3I07A 2ZM6C 1USPA 2KDNA 2D27A 3IPLA 4X62C 1NYEA 2ONFA 5DV9A 1WCJA 4FUTA 3FCEA 3GKUA 3E7XA 1O9TA 4JV5C 2E5LC 5BSWA 5IFIA 2OPLB 1PG4A 4LF7C 3T1HC 1XNRC 5AE2A 3EERA 1I94C 3LGXA 5K8FA 3E7WA 1P4EA 4K0KC 3KXWA 1MXBA 3A26A 3UZ0A 3L95X 4JI8C 4B3SC 2CU6A 4RLFA 4TPSB 1FLOA 1LQLA 2MM9A 4PUGA 1VLAA 3VNQA 2QL8A 3PESA 4LFBC 2E7GA 3VNRA 1V25A 2M5HA 2P2MA 3TQIA 3OTOC 5BSTA 4DCTA 4B3RC 4R1MA 4AQYC 3CW9A 3PBKA 4G37A 1EGAA 5A1GA 4D4GA 4DUYC 2EGTA 3N54B 3AF6A 4L4QA 1GPMA 1XMQC 3VNSA 3S82A 4OXIA 4JI7C 4G36A 4DR3C 4D57A 2D28C 3UX3A 3J7AD 4LF5C 1KKGA 2QVYX 5A1IA 1QWIA 4OX9C 1N33C 1P7LA 2M5OA 4NOZA 4BC7A 2P2QA 4JYAC 2D7VA 3TR3A 4GS5A 1FUGA 1HR0C 3CQ2A 3B7WA 4HPVA 4MTNA 4LF4C 4LF6C 5E7QA 4FTFA 4I9FA 3IEVA 3L8CA 5T8TA 4IR7A 4RM2A 1TH5A 2UXBC 1MDBA 2E8FA 3CQ1A 4JI0C 2VSQA 3H2TA 2ZZNA 2HHHC 3CQ3A 4DR7C 2JNVA 4B3MC 2BJOA 3CJEA 4DCSA 3ETOA 3NYRA 5AE1A 3DLPX 1XS3A 3DAYA 1WH9A 3FCCA 1N34C 1AMUA 4R1LA 5H9UA 5JRHA 1WF3A 1L2FA 2V7BA 4FUQA 5LCIA 2KZ0A 5FLXD 4LF9C 1N32C 5BR8C 4X65C 2VQFC 5BUQA 4PHTA 2P2BA 4KHPC 2KZFA 3I08A 4GXRA 2D1QA 1O90A 4G1IA 2XR1A 3G7SA 1MXAA 5BSRA 3LNVA 1XNQC 5GTDA 3DHVA 1ML8A 2AYAA 3RG2A 5A19A 4DV1C 5BSMA 2ZZMA 5BURA 3LUSA 4BC9A 4KTVA 3NI2A 4MH4A 1PA4A 4D56A 2MCQA 2P2FA 1V26A 4DUZC 1VEHA 3UEBA 3R9XA 1IBKC 2YX1A 1MXCA 2UUBC 2UUCC 1HH2P 3GR0A 3A4IA 4YHHC 2OO4A 1XHJA 2QW0X 1ZB9A 2NCLA 5K85A 2DHMA 1RY2A 1HNZC 1MKYA 4BCAA 1XMOC 1ULTA 2JMPA 2Y27A 4LE5A 5BSVA 2YWBA 2VQEC 1FJGC 4DV4C 4DV7C 4DV0C 1YJ7A 3AY0A 4U5YD 3NYQA 5IWAC 3T1YC 5LMNC 4K0BA 4RMNA 4DCVA 4BBYA 4D4IA 3CW8X 4DR4C 4ISBA 4EATA 4WS9A 2P02A 4PUHA 4RM3A 1MD9A 5LMUC 4DCUA 2PT7G 3NPDA 2PROA 1PG3A 2F4VC 3RV2A 4RVOA 2ASBA 1K0RA 2QVZX 4IZ6A 4NXNC 3GR1A 5KEIA 1XDXA 2D1TA 4I9GA 1IBMC 1XRAA 4BSZA 3AF5A 1T5HX 3A25A 4JI4C 3IEUA 4JI3C 4GKJC 4DR6C 2D1SA 2CXCA 4X64C 3TUFA 5KYTA 3GPCA 4DV6C 2UU9C 3JAMD 2YWCA 2E8CA 4LFAC 1HNXC 2YCBA 1HNWC 4PZPA 2UXDC 3SO4A 4DR5C 1LCIA 2WP0C 2Y4OA 1USPB 2QVXX 5BSUA 5BUSA 4NXMC 4R0MA 1QM4A 4YY3C 2E0GA 4LFCC 3A9VA 4B3TC 2D1RA 3O2EA 4PROC 4ZJZA 1M6XC 1ZB8A 4JM1A 3K6RA 2OBVA 1PU1A 1V60A 1NY8A 1RG9A 4JI6C 3FM7A 4RVNA 4DV5C 4NDNA 1N36C 3TDEA 1YGTA 4L2ZA 1J5EC 3IMLA 3UOWA 2PN2A 3ETCA 3LAXA 2UXCC 2WD9A 2P2JA 2Y4NA 1BA3A 2UUAC 1N2FA 3R44A 2E8EA 3J80D 4DR2C 4JI1C 3J81D 2ZTBA 4XX2A 2Z51A 4DV2C 3EQ6A 2DPLA 2BH1X 1M6XA 2VZEA 4JI2C 1IBLC 3UX2A 2DYJA 4DR1C 3C5EA 4DG8A 1XRCA 1O92A 2HJGA 2MMAB 4OYCA 2ATWA 1XRBA 5AE3A 4GXQA 4DV3C 4L7IA 1MDFA 4X66C 1T5DX 4GKKC 1IB8A 5T8SA 5CZVA
chains in the Genus database with same CATH topology
5A2QD 4JI5C 3R9WA 4DG9A 4WV3A 4LF8C 5CZXA 5IT9D 2CY1A 1UKKA 4RLQA 3PROC 5ADZA 1O93A 2P20A 1JOSA 3N2QA 2OPLA 4KTTA 4ODJA 3A9UA 4ZLPA 5KYVA 3I07A 2ZM6C 1USPA 2D27A 3IPLA 4X62C 1NYEA 2ONFA 5DV9A 4FUTA 3FCEA 3GKUA 3E7XA 1O9TA 4JV5C 2E5LC 5BSWA 5IFIA 2OPLB 1PG4A 4LF7C 3T1HC 1XNRC 5AE2A 3EERA 1I94C 3LGXA 5K8FA 3E7WA 4K0KC 3KXWA 1MXBA 3UZ0A 3L95X 4JI8C 4B3SC 4RLFA 4TPSB 1LQLA 1VLAA 3VNQA 2QL8A 3PESA 4LFBC 2E7GA 3VNRA 1V25A 2P2MA 3TQIA 3OTOC 5BSTA 4DCTA 4B3RC 4R1MA 4AQYC 3CW9A 3PBKA 4G37A 1EGAA 5A1GA 4D4GA 4DUYC 2EGTA 3N54B 3AF6A 4L4QA 1GPMA 1XMQC 3VNSA 3S82A 4OXIA 4JI7C 4G36A 4DR3C 4D57A 2D28C 3J7AD 4LF5C 1KKGA 2QVYX 5A1IA 1QWIA 4OX9C 1N33C 1P7LA 4NOZA 4BC7A 2P2QA 4JYAC 2D7VA 4GS5A 1FUGA 1HR0C 3B7WA 4HPVA 4MTNA 4LF4C 4LF6C 5E7QA 4FTFA 4I9FA 3IEVA 3L8CA 5T8TA 4IR7A 4RM2A 2UXBC 1MDBA 2E8FA 4JI0C 2VSQA 3H2TA 2HHHC 4DR7C 4B3MC 2BJOA 3CJEA 4DCSA 3ETOA 3NYRA 5AE1A 3DLPX 3DAYA 1WH9A 3FCCA 1N34C 1AMUA 4R1LA 5H9UA 5JRHA 1WF3A 1L2FA 2V7BA 4FUQA 5FLXD 4LF9C 1N32C 5BR8C 4X65C 2VQFC 5BUQA 4PHTA 2P2BA 4KHPC 2KZFA 3I08A 4GXRA 2D1QA 1O90A 4G1IA 2XR1A 3G7SA 1MXAA 5BSRA 3LNVA 1XNQC 5GTDA 3DHVA 1ML8A 2AYAA 3RG2A 5A19A 4DV1C 5BSMA 5BURA 3LUSA 4BC9A 4KTVA 3NI2A 4MH4A 1PA4A 4D56A 2P2FA 1V26A 4DUZC 3R9XA 1IBKC 1MXCA 2UUBC 2UUCC 1HH2P 3GR0A 3A4IA 4YHHC 2OO4A 2QW0X 1ZB9A 5K85A 1RY2A 1HNZC 1MKYA 4BCAA 1XMOC 1ULTA 2JMPA 2Y27A 4LE5A 5BSVA 2YWBA 2VQEC 1FJGC 4DV4C 4DV7C 4DV0C 1YJ7A 4U5YD 3NYQA 5IWAC 3T1YC 5LMNC 4K0BA 4RMNA 4DCVA 4BBYA 4D4IA 3CW8X 4DR4C 4ISBA 4EATA 4WS9A 2P02A 4RM3A 1MD9A 5LMUC 4DCUA 2PT7G 3NPDA 2PROA 1PG3A 2F4VC 3RV2A 4RVOA 2ASBA 1K0RA 2QVZX 4IZ6A 4NXNC 3GR1A 5KEIA 2D1TA 4I9GA 1IBMC 1XRAA 4BSZA 3AF5A 1T5HX 4JI4C 3IEUA 4JI3C 4GKJC 4DR6C 2D1SA 2CXCA 4X64C 3TUFA 5KYTA 3GPCA 4DV6C 2UU9C 3JAMD 2YWCA 2E8CA 4LFAC 1HNXC 2YCBA 1HNWC 4PZPA 2UXDC 3SO4A 4DR5C 1LCIA 2WP0C 2Y4OA 1USPB 2QVXX 5BSUA 5BUSA 4NXMC 4R0MA 1QM4A 4YY3C 2E0GA 4LFCC 3A9VA 4B3TC 2D1RA 4PROC 4ZJZA 1ZB8A 4JM1A 2OBVA 1RG9A 4JI6C 4RVNA 4DV5C 4NDNA 1N36C 3TDEA 4L2ZA 1J5EC 3IMLA 3UOWA 2PN2A 3ETCA 3LAXA 2UXCC 2WD9A 2P2JA 2Y4NA 1BA3A 2UUAC 1N2FA 3R44A 2E8EA 3J80D 4DR2C 4JI1C 3J81D 4XX2A 4DV2C 3EQ6A 2DPLA 2BH1X 2VZEA 4JI2C 1IBLC 2DYJA 4DR1C 3C5EA 4DG8A 1XRCA 1O92A 2HJGA 4OYCA 2ATWA 1XRBA 5AE3A 4GXQA 4DV3C 4L7IA 1MDFA 4X66C 1T5DX 4GKKC 5T8SA 5CZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML8 A;  4DUY C;  2EGT A;  5A2Q D;  3AF6 A;  4JI5 C;  3R9W A;  4DV6 C;  4DV1 C;  2UU9 C;  1XMQ C;  3JAM D;  4LF8 C;  4JI7 C;  4DR3 C;  2E8C A;  5IT9 D;  4LFA C;  2CY1 A;  3LUS A;  1HNX C;  2YCB A;  1HNW C;  4MH4 A;  3J7A D;  1PA4 A;  1UKK A;  4LF5 C;  1KKG A;  4DUZ C;  2UXD C;  1QWI A;  4OX9 C;  3R9X A;  4DR5 C;  1JOS A;  1IBK C;  1N33 C;  1USP B;  4NOZ A;  2OPL A;  4JYA C;  2D7V A;  2UUB C;  2UUC C;  1HH2 P;  4NXM C;  4YHH C;  3I07 A;  4YY3 C;  2ZM6 C;  1HR0 C;  1USP A;  4LFC C;  1ZB9 A;  4X62 C;  4B3T C;  4LF4 C;  4MTN A;  1NYE A;  2ONF A;  1HNZ C;  4LF6 C;  1MKY A;  1XMO C;  1ZB8 A;  3GKU A;  2JMP A;  3IEV A;  4JV5 C;  2E5L C;  2OPL B;  2VQE C;  1FJG C;  2UXB C;  4JI6 C;  4DV4 C;  4LF7 C;  3T1H C;  2E8F A;  4DV5 C;  1N36 C;  4JI0 C;  4DV7 C;  4DV0 C;  1XNR C;  3EER A;  2HHH C;  1J5E C;  4DR7 C;  4B3M C;  1I94 C;  2BJO A;  3CJE A;  4DCS A;  5IWA C;  3T1Y C;  5LMN C;  4K0K C;  2PN2 A;  2UXC C;  1WH9 A;  4JI8 C;  1N34 C;  2UUA C;  1N2F A;  2E8E A;  4DCV A;  3J80 D;  4B3S C;  4DR2 C;  4DR4 C;  1WF3 A;  1L2F A;  4JI1 C;  3J81 D;  1LQL A;  5LMU C;  5FLX D;  4DCU A;  2PT7 G;  4XX2 A;  4LF9 C;  4DV2 C;  2F4V C;  5BR8 C;  1N32 C;  1VLA A;  4JI2 C;  4X65 C;  2VQF C;  1IBL C;  2ASB A;  1K0R A;  2QL8 A;  4LFB C;  2E7G A;  2DYJ A;  4DR1 C;  4KHP C;  4NXN C;  2KZF A;  1IBM C;  2HJG A;  4BSZ A;  3AF5 A;  2ATW A;  4JI4 C;  3OTO C;  4DCT A;  2XR1 A;  4B3R C;  3IEU A;  4DV3 C;  4JI3 C;  4GKJ C;  4DR6 C;  4AQY C;  2CXC A;  4X66 C;  4X64 C;  4GKK C;  1XNQ C;  1EGA A; 
#chains in the Genus database with same CATH topology
 5A2Q D;  4JI5 C;  3R9W A;  4DG9 A;  4WV3 A;  4PUI A;  4LF8 C;  5CZX A;  5IT9 D;  2CY1 A;  1UKK A;  4RLQ A;  3PRO C;  5ADZ A;  2PG1 E;  1O93 A;  1P4E C;  3LNO A;  1UWD A;  2P20 A;  1JOS A;  3N2Q A;  2OPL A;  4KTT A;  4ODJ A;  3A9U A;  4ZLP A;  5KYV A;  3I07 A;  2ZM6 C;  1USP A;  2KDN A;  2D27 A;  3IPL A;  4X62 C;  1NYE A;  2ONF A;  5DV9 A;  1WCJ A;  4FUT A;  3FCE A;  3GKU A;  3E7X A;  1O9T A;  4JV5 C;  2E5L C;  5BSW A;  5IFI A;  2OPL B;  1PG4 A;  4LF7 C;  3T1H C;  1XNR C;  5AE2 A;  3EER A;  1I94 C;  3LGX A;  5K8F A;  3E7W A;  1P4E A;  4K0K C;  3KXW A;  1MXB A;  3A26 A;  3UZ0 A;  3L95 X;  4JI8 C;  4B3S C;  2CU6 A;  4RLF A;  4TPS B;  1FLO A;  1LQL A;  2MM9 A;  4PUG A;  1VLA A;  3VNQ A;  2QL8 A;  3PES A;  4LFB C;  2E7G A;  3VNR A;  1V25 A;  2M5H A;  2P2M A;  3TQI A;  3OTO C;  5BST A;  4DCT A;  4B3R C;  4R1M A;  4AQY C;  3CW9 A;  3PBK A;  4G37 A;  1EGA A;  5A1G A;  4D4G A;  4DUY C;  2EGT A;  3N54 B;  3AF6 A;  4L4Q A;  1GPM A;  1XMQ C;  3VNS A;  3S82 A;  4OXI A;  4JI7 C;  4G36 A;  4DR3 C;  4D57 A;  2D28 C;  3UX3 A;  3J7A D;  4LF5 C;  1KKG A;  2QVY X;  5A1I A;  1QWI A;  4OX9 C;  1N33 C;  1P7L A;  2M5O A;  4NOZ A;  4BC7 A;  2P2Q A;  4JYA C;  2D7V A;  3TR3 A;  4GS5 A;  1FUG A;  1HR0 C;  3CQ2 A;  3B7W A;  4HPV A;  4MTN A;  4LF4 C;  4LF6 C;  5E7Q A;  4FTF A;  4I9F A;  3IEV A;  3L8C A;  5T8T A;  4IR7 A;  4RM2 A;  1TH5 A;  2UXB C;  1MDB A;  2E8F A;  3CQ1 A;  4JI0 C;  2VSQ A;  3H2T A;  2ZZN A;  2HHH C;  3CQ3 A;  4DR7 C;  2JNV A;  4B3M C;  2BJO A;  3CJE A;  4DCS A;  3ETO A;  3NYR A;  5AE1 A;  3DLP X;  1XS3 A;  3DAY A;  1WH9 A;  3FCC A;  1N34 C;  1AMU A;  4R1L A;  5H9U A;  5JRH A;  1WF3 A;  1L2F A;  2V7B A;  4FUQ A;  5LCI A;  2KZ0 A;  5FLX D;  4LF9 C;  1N32 C;  5BR8 C;  4X65 C;  2VQF C;  5BUQ A;  4PHT A;  2P2B A;  4KHP C;  2KZF A;  3I08 A;  4GXR A;  2D1Q A;  1O90 A;  4G1I A;  2XR1 A;  3G7S A;  1MXA A;  5BSR A;  3LNV A;  1XNQ C;  5GTD A;  3DHV A;  1ML8 A;  2AYA A;  3RG2 A;  5A19 A;  4DV1 C;  5BSM A;  2ZZM A;  5BUR A;  3LUS A;  4BC9 A;  4KTV A;  3NI2 A;  4MH4 A;  1PA4 A;  4D56 A;  2MCQ A;  2P2F A;  1V26 A;  4DUZ C;  1VEH A;  3UEB A;  3R9X A;  1IBK C;  2YX1 A;  1MXC A;  2UUB C;  2UUC C;  1HH2 P;  3GR0 A;  3A4I A;  4YHH C;  2OO4 A;  1XHJ A;  2QW0 X;  1ZB9 A;  2NCL A;  5K85 A;  2DHM A;  1RY2 A;  1HNZ C;  1MKY A;  4BCA A;  1XMO C;  1ULT A;  2JMP A;  2Y27 A;  4LE5 A;  5BSV A;  2YWB A;  2VQE C;  1FJG C;  4DV4 C;  4DV7 C;  4DV0 C;  1YJ7 A;  3AY0 A;  4U5Y D;  3NYQ A;  5IWA C;  3T1Y C;  5LMN C;  4K0B A;  4RMN A;  4DCV A;  4BBY A;  4D4I A;  3CW8 X;  4DR4 C;  4ISB A;  4EAT A;  4WS9 A;  2P02 A;  4PUH A;  4RM3 A;  1MD9 A;  5LMU C;  4DCU A;  2PT7 G;  3NPD A;  2PRO A;  1PG3 A;  2F4V C;  3RV2 A;  4RVO A;  2ASB A;  1K0R A;  2QVZ X;  4IZ6 A;  4NXN C;  3GR1 A;  5KEI A;  1XDX A;  2D1T A;  4I9G A;  1IBM C;  1XRA A;  4BSZ A;  3AF5 A;  1T5H X;  3A25 A;  4JI4 C;  3IEU A;  4JI3 C;  4GKJ C;  4DR6 C;  2D1S A;  2CXC A;  4X64 C;  3TUF A;  5KYT A;  3GPC A;  4DV6 C;  2UU9 C;  3JAM D;  2YWC A;  2E8C A;  4LFA C;  1HNX C;  2YCB A;  1HNW C;  4PZP A;  2UXD C;  3SO4 A;  4DR5 C;  1LCI A;  2WP0 C;  2Y4O A;  1USP B;  2QVX X;  5BSU A;  5BUS A;  4NXM C;  4R0M A;  1QM4 A;  4YY3 C;  2E0G A;  4LFC C;  3A9V A;  4B3T C;  2D1R A;  3O2E A;  4PRO C;  4ZJZ A;  1M6X C;  1ZB8 A;  4JM1 A;  3K6R A;  2OBV A;  1PU1 A;  1V60 A;  1NY8 A;  1RG9 A;  4JI6 C;  3FM7 A;  4RVN A;  4DV5 C;  4NDN A;  1N36 C;  3TDE A;  1YGT A;  4L2Z A;  1J5E C;  3IML A;  3UOW A;  2PN2 A;  3ETC A;  3LAX A;  2UXC C;  2WD9 A;  2P2J A;  2Y4N A;  1BA3 A;  2UUA C;  1N2F A;  3R44 A;  2E8E A;  3J80 D;  4DR2 C;  4JI1 C;  3J81 D;  2ZTB A;  4XX2 A;  2Z51 A;  4DV2 C;  3EQ6 A;  2DPL A;  2BH1 X;  1M6X A;  2VZE A;  4JI2 C;  1IBL C;  3UX2 A;  2DYJ A;  4DR1 C;  3C5E A;  4DG8 A;  1XRC A;  1O92 A;  2HJG A;  2MMA B;  4OYC A;  2ATW A;  1XRB A;  5AE3 A;  4GXQ A;  4DV3 C;  4L7I A;  1MDF A;  4X66 C;  1T5D X;  4GKK C;  1IB8 A;  5T8S A;  5CZV A; 
#chains in the Genus database with same CATH homology
 5A2Q D;  4JI5 C;  3R9W A;  4DG9 A;  4WV3 A;  4LF8 C;  5CZX A;  5IT9 D;  2CY1 A;  1UKK A;  4RLQ A;  3PRO C;  5ADZ A;  1O93 A;  2P20 A;  1JOS A;  3N2Q A;  2OPL A;  4KTT A;  4ODJ A;  3A9U A;  4ZLP A;  5KYV A;  3I07 A;  2ZM6 C;  1USP A;  2D27 A;  3IPL A;  4X62 C;  1NYE A;  2ONF A;  5DV9 A;  4FUT A;  3FCE A;  3GKU A;  3E7X A;  1O9T A;  4JV5 C;  2E5L C;  5BSW A;  5IFI A;  2OPL B;  1PG4 A;  4LF7 C;  3T1H C;  1XNR C;  5AE2 A;  3EER A;  1I94 C;  3LGX A;  5K8F A;  3E7W A;  4K0K C;  3KXW A;  1MXB A;  3UZ0 A;  3L95 X;  4JI8 C;  4B3S C;  4RLF A;  4TPS B;  1LQL A;  1VLA A;  3VNQ A;  2QL8 A;  3PES A;  4LFB C;  2E7G A;  3VNR A;  1V25 A;  2P2M A;  3TQI A;  3OTO C;  5BST A;  4DCT A;  4B3R C;  4R1M A;  4AQY C;  3CW9 A;  3PBK A;  4G37 A;  1EGA A;  5A1G A;  4D4G A;  4DUY C;  2EGT A;  3N54 B;  3AF6 A;  4L4Q A;  1GPM A;  1XMQ C;  3VNS A;  3S82 A;  4OXI A;  4JI7 C;  4G36 A;  4DR3 C;  4D57 A;  2D28 C;  3J7A D;  4LF5 C;  1KKG A;  2QVY X;  5A1I A;  1QWI A;  4OX9 C;  1N33 C;  1P7L A;  4NOZ A;  4BC7 A;  2P2Q A;  4JYA C;  2D7V A;  4GS5 A;  1FUG A;  1HR0 C;  3B7W A;  4HPV A;  4MTN A;  4LF4 C;  4LF6 C;  5E7Q A;  4FTF A;  4I9F A;  3IEV A;  3L8C A;  5T8T A;  4IR7 A;  4RM2 A;  2UXB C;  1MDB A;  2E8F A;  4JI0 C;  2VSQ A;  3H2T A;  2HHH C;  4DR7 C;  4B3M C;  2BJO A;  3CJE A;  4DCS A;  3ETO A;  3NYR A;  5AE1 A;  3DLP X;  3DAY A;  1WH9 A;  3FCC A;  1N34 C;  1AMU A;  4R1L A;  5H9U A;  5JRH A;  1WF3 A;  1L2F A;  2V7B A;  4FUQ A;  5FLX D;  4LF9 C;  1N32 C;  5BR8 C;  4X65 C;  2VQF C;  5BUQ A;  4PHT A;  2P2B A;  4KHP C;  2KZF A;  3I08 A;  4GXR A;  2D1Q A;  1O90 A;  4G1I A;  2XR1 A;  3G7S A;  1MXA A;  5BSR A;  3LNV A;  1XNQ C;  5GTD A;  3DHV A;  1ML8 A;  2AYA A;  3RG2 A;  5A19 A;  4DV1 C;  5BSM A;  5BUR A;  3LUS A;  4BC9 A;  4KTV A;  3NI2 A;  4MH4 A;  1PA4 A;  4D56 A;  2P2F A;  1V26 A;  4DUZ C;  3R9X A;  1IBK C;  1MXC A;  2UUB C;  2UUC C;  1HH2 P;  3GR0 A;  3A4I A;  4YHH C;  2OO4 A;  2QW0 X;  1ZB9 A;  5K85 A;  1RY2 A;  1HNZ C;  1MKY A;  4BCA A;  1XMO C;  1ULT A;  2JMP A;  2Y27 A;  4LE5 A;  5BSV A;  2YWB A;  2VQE C;  1FJG C;  4DV4 C;  4DV7 C;  4DV0 C;  1YJ7 A;  4U5Y D;  3NYQ A;  5IWA C;  3T1Y C;  5LMN C;  4K0B A;  4RMN A;  4DCV A;  4BBY A;  4D4I A;  3CW8 X;  4DR4 C;  4ISB A;  4EAT A;  4WS9 A;  2P02 A;  4RM3 A;  1MD9 A;  5LMU C;  4DCU A;  2PT7 G;  3NPD A;  2PRO A;  1PG3 A;  2F4V C;  3RV2 A;  4RVO A;  2ASB A;  1K0R A;  2QVZ X;  4IZ6 A;  4NXN C;  3GR1 A;  5KEI A;  2D1T A;  4I9G A;  1IBM C;  1XRA A;  4BSZ A;  3AF5 A;  1T5H X;  4JI4 C;  3IEU A;  4JI3 C;  4GKJ C;  4DR6 C;  2D1S A;  2CXC A;  4X64 C;  3TUF A;  5KYT A;  3GPC A;  4DV6 C;  2UU9 C;  3JAM D;  2YWC A;  2E8C A;  4LFA C;  1HNX C;  2YCB A;  1HNW C;  4PZP A;  2UXD C;  3SO4 A;  4DR5 C;  1LCI A;  2WP0 C;  2Y4O A;  1USP B;  2QVX X;  5BSU A;  5BUS A;  4NXM C;  4R0M A;  1QM4 A;  4YY3 C;  2E0G A;  4LFC C;  3A9V A;  4B3T C;  2D1R A;  4PRO C;  4ZJZ A;  1ZB8 A;  4JM1 A;  2OBV A;  1RG9 A;  4JI6 C;  4RVN A;  4DV5 C;  4NDN A;  1N36 C;  3TDE A;  4L2Z A;  1J5E C;  3IML A;  3UOW A;  2PN2 A;  3ETC A;  3LAX A;  2UXC C;  2WD9 A;  2P2J A;  2Y4N A;  1BA3 A;  2UUA C;  1N2F A;  3R44 A;  2E8E A;  3J80 D;  4DR2 C;  4JI1 C;  3J81 D;  4XX2 A;  4DV2 C;  3EQ6 A;  2DPL A;  2BH1 X;  2VZE A;  4JI2 C;  1IBL C;  2DYJ A;  4DR1 C;  3C5E A;  4DG8 A;  1XRC A;  1O92 A;  2HJG A;  4OYC A;  2ATW A;  1XRB A;  5AE3 A;  4GXQ A;  4DV3 C;  4L7I A;  1MDF A;  4X66 C;  1T5D X;  4GKK C;  5T8S A;  5CZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...