4DV1C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv1C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv1C02
3IEUA 3I07A 2UXBC 4JI5C 4DV7C 5BR8C 2E8EA 1IBLC 2HHHC 1HH2P 1HNXC 1N33C 2E8CA 2E8FA 4AQYC 3JAMD 3LUSA 4DR6C 3EERA 4LF6C 1ZB8A 1WH9A 4DR7C 3GKUA 4JI2C 1I94C 3IEVA 4K0KC 2D7VA 4DR4C 4YY3C 5LMUC 4MH4A 4DV0C 4DV1C 4NXNC 2F4VC 3CJEA 4DCTA 4JYAC 4DR2C 3J7AD 2YCBA 1WF3A 5A2QD 2ZM6C 4YHHC 2E7GA 4DCSA 2EGTA 1IBKC 4B3MC 4X65C 1EGAA 1JOSA 2ASBA 4BSZA 4DV2C 2UUCC 2ATWA 5LMNC 1J5EC 1HNZC 4DR3C 4GKJC 1MKYA 3J80D 4B3RC 2UXDC 2PN2A 2PT7G 3AF6A 4DV3C 4DCUA 1USPA 3AF5A 1XMOC 1UKKA 4LF9C 2JMPA 2UXCC 4OX9C 4JI7C 1USPB 1ML8A 4MTNA 4JI3C 4DR5C 1KKGA 4LF4C 2ONFA 2VQEC 4LF5C 3R9XA 4LF8C 1XNRC 4LFBC 4DV4C 1N2FA 1HR0C 1HNWC 1K0RA 4DUYC 1QWIA 1FJGC 1PA4A 4LFCC 2XR1A 2HJGA 4DCVA 4DUZC 5FLXD 2UUBC 4JI4C 2UU9C 1L2FA 4LF7C 2UUAC 1LQLA 1N34C 4LFAC 1N36C 2DYJA 4GKKC 4XX2A 4X66C 2BJOA 2OPLA 3T1YC 1XMQC 4DR1C 4JI1C 1IBMC 4JI6C 3R9WA 2OPLB 5IWAC 2QL8A 1XNQC 2KZFA 1N32C 4DV6C 4X62C 2CXCA 1ZB9A 4B3TC 2CY1A 4X64C 5IT9D 4NXMC 3J81D 4JV5C 4KHPC 4B3SC 3T1HC 4JI8C 2VQFC 1NYEA 3OTOC 4DV5C 1VLAA 4NOZA 2E5LC 4JI0C
chains in the Genus database with same CATH superfamily
2M5HA 2KDNA 3IEUA 4D4IA 3O2EA 1YGTA 3N54B 1O93A 1N33C 2ZZNA 2E8FA 4OYCA 2YX1A 3LUSA 2D1SA 3EERA 4K0KC 5KYVA 4ZJZA 1VEHA 4DR4C 4YY3C 5LMUC 2P02A 4DV1C 4NXNC 3CJEA 4JYAC 1RG9A 2QW0X 5ADZA 3E7WA 2AYAA 4DCSA 2EGTA 4X65C 3A25A 2P2BA 2ASBA 4R1LA 4DG8A 1MD9A 1P4EC 2D1TA 4GKJC 1MKYA 3TR3A 4B3RC 2P2MA 4DV3C 5BUSA 2OO4A 3IPLA 1UKKA 1YJ7A 4KTVA 4PHTA 3UOWA 4DR5C 1MXCA 2ONFA 4PZPA 4LF5C 4R1MA 1MXAA 4DV4C 4IR7A 4BBYA 1HR0C 1HNWC 4FTFA 5A19A 3FM7A 1PA4A 4ZLPA 1XHJA 3DHVA 1N34C 3GPCA 4I9GA 1XRCA 5BURA 2DYJA 3NYQA 4X66C 1AMUA 3B7WA 5T8SA 4RLFA 2VSQA 4NDNA 2KZFA 3L95X 4X62C 5AE3A 1XRAA 4X64C 4D56A 2DHMA 2E0GA 4I9FA 1P7LA 3OTOC 1VLAA 2UXBC 4JI5C 5BR8C 1IBLC 3G7SA 5BSWA 4AQYC 3A26A 4PUIA 4L4QA 1V60A 1WH9A 3IEVA 1O9TA 2D7VA 2Y27A 4MH4A 1RY2A 4DR2C 3C5EA 4R0MA 1WF3A 5A2QD 4G37A 1MDFA 2ZM6C 4YHHC 4RMNA 2P20A 4GXRA 1IBKC 4B3MC 3LAXA 4FUTA 4FUQA 3VNSA 4OXIA 1NY8A 4PUHA 5A1GA 4BCAA 1HNZC 2MMAB 1LCIA 2PN2A 3AF6A 1XDXA 4JM1A 4LF9C 3RV2A 2JMPA 2UXCC 4JI7C 1ML8A 4MTNA 5GTDA 4RVOA 2PROA 3SO4A 4LF8C 4LFBC 2MM9A 5IFIA 5CZVA 2D27A 3CQ1A 4EATA 4RM3A 3AY0A 5K8FA 4LFCC 2XR1A 2HJGA 4DCVA 2UUBC 2UU9C 1L2FA 4LF7C 2UUAC 1LQLA 1N36C 1PG3A 2OPLA 5BSTA 1XMQC 5DV9A 2DPLA 4JI1C 4DG9A 3TQIA 4WS9A 3CQ2A 2YWCA 4PUGA 1ZB9A 4B3TC 1T5HX 3PROC 3NYRA 5IT9D 4NXMC 1M6XA 3J81D 4HPVA 2OBVA 3VNQA 3T1HC 2VQFC 5LCIA 5LMNC 4NOZA 2E5LC 1HNXC 4BC9A 4DV7C 3LNOA 2E8EA 5H9UA 1HH2P 1BA3A 3NI2A 2ZTBA 3GR0A 3EQ6A 4WV3A 2D1RA 4KTTA 4DR6C 4DR7C 4JI2C 5BUQA 1FUGA 5CZXA 3J7AD 3DAYA 2P2JA 3RG2A 1V26A 3E7XA 1O92A 2Z51A 3CW9A 2P2QA 4BSZA 1T5DX 3NPDA 4DV2C 1MDBA 1J5EC 3J80D 4L2ZA 2NCLA 2WD9A 5JRHA 1USPA 3IMLA 1XMOC 3UX2A 3UZ0A 4OX9C 3KXWA 3TDEA 4JI3C 1KKGA 4GXQA 3UEBA 1N2FA 2PG1E 1K0RA 3UX3A 4RVNA 2D1QA 4DUZC 5FLXD 4JI4C 4ODJA 3GR1A 1PU1A 1M6XC 4GKKC 1MXBA 3ETCA 2JNVA 3T1YC 4DR1C 4JI6C 3S82A 1IBMC 2OPLB 2P2FA 5IWAC 2QL8A 5E7QA 5A1IA 1N32C 1GPMA 4G36A 1UWDA 2CXCA 1XS3A 2QVXX 1O90A 1NYEA 3H2TA 3I07A 2HHHC 2ZZMA 3CW8X 1ULTA 1TH5A 2E8CA 3JAMD 4G1IA 2WP0C 3PESA 5BSRA 3PBKA 5T8TA 4LF6C 1ZB8A 1V25A 3GKUA 5KEIA 1I94C 4IZ6A 3VNRA 2QVZX 4DV0C 4U5YD 2F4VC 4DCTA 2YCBA 4L7IA 3TUFA 2E7GA 3N2QA 4GS5A 2D28C 3DLPX 1EGAA 1XRBA 3CQ3A 1JOSA 2YWBA 4D4GA 5BSMA 2UUCC 2ATWA 4DR3C 2M5OA 2UXDC 5K85A 2PT7G 5KYTA 4DCUA 3AF5A 3R44A 1USPB 2VZEA 4LF4C 2VQEC 1P4EA 1PG4A 3R9XA 1XNRC 4D57A 3K6RA 2QVYX 4K0BA 4TPSB 4DUYC 3A4IA 5BSUA 1QWIA 1FJGC 4LFAC 3I08A 3LGXA 4XX2A 4RLQA 3A9UA 2BJOA 4RM2A 2MCQA 5AE1A 3R9WA 5AE2A 3L8CA 2V7BA 1XNQC 3A9VA 3FCCA 4LE5A 4DV6C 4BC7A 3ETOA 2Y4OA 2CY1A 4PROC 1FLOA 3FCEA 2Y4NA 2CU6A 1QM4A 2BH1X 4JV5C 4KHPC 2KZ0A 4ISBA 4B3SC 5BSVA 1IB8A 4JI8C 4DV5C 3LNVA 1WCJA 4JI0C
chains in the Genus database with same CATH topology
3IEUA 4D4IA 3N54B 1O93A 1N33C 2E8FA 4OYCA 3LUSA 2D1SA 3EERA 4K0KC 5KYVA 4ZJZA 4DR4C 4YY3C 5LMUC 2P02A 4DV1C 4NXNC 3CJEA 4JYAC 1RG9A 2QW0X 5ADZA 3E7WA 2AYAA 4DCSA 2EGTA 4X65C 2P2BA 2ASBA 4R1LA 4DG8A 1MD9A 2D1TA 4GKJC 1MKYA 4B3RC 2P2MA 4DV3C 5BUSA 2OO4A 3IPLA 1UKKA 1YJ7A 4KTVA 4PHTA 3UOWA 4DR5C 1MXCA 2ONFA 4PZPA 4LF5C 4R1MA 1MXAA 4DV4C 4IR7A 4BBYA 1HR0C 1HNWC 4FTFA 5A19A 1PA4A 4ZLPA 3DHVA 1N34C 3GPCA 4I9GA 1XRCA 5BURA 2DYJA 3NYQA 4X66C 1AMUA 3B7WA 5T8SA 4RLFA 2VSQA 4NDNA 2KZFA 3L95X 4X62C 5AE3A 1XRAA 4X64C 4D56A 2E0GA 4I9FA 1P7LA 3OTOC 1VLAA 2UXBC 4JI5C 5BR8C 1IBLC 3G7SA 5BSWA 4AQYC 4L4QA 1WH9A 3IEVA 1O9TA 2D7VA 2Y27A 4MH4A 1RY2A 4DR2C 3C5EA 4R0MA 1WF3A 5A2QD 4G37A 1MDFA 2ZM6C 4YHHC 4RMNA 2P20A 4GXRA 1IBKC 4B3MC 3LAXA 4FUTA 4FUQA 3VNSA 4OXIA 5A1GA 4BCAA 1HNZC 1LCIA 2PN2A 3AF6A 4JM1A 4LF9C 3RV2A 2JMPA 2UXCC 4JI7C 1ML8A 4MTNA 5GTDA 4RVOA 2PROA 3SO4A 4LF8C 4LFBC 5IFIA 5CZVA 2D27A 4EATA 4RM3A 5K8FA 4LFCC 2XR1A 2HJGA 4DCVA 2UUBC 2UU9C 1L2FA 4LF7C 2UUAC 1LQLA 1N36C 1PG3A 2OPLA 5BSTA 1XMQC 5DV9A 2DPLA 4JI1C 4DG9A 3TQIA 4WS9A 2YWCA 1ZB9A 4B3TC 1T5HX 3PROC 3NYRA 5IT9D 4NXMC 3J81D 4HPVA 2OBVA 3VNQA 3T1HC 2VQFC 5LMNC 4NOZA 2E5LC 1HNXC 4BC9A 4DV7C 2E8EA 5H9UA 1HH2P 1BA3A 3NI2A 3GR0A 3EQ6A 4WV3A 2D1RA 4KTTA 4DR6C 4DR7C 4JI2C 5BUQA 1FUGA 5CZXA 3J7AD 3DAYA 2P2JA 3RG2A 1V26A 3E7XA 1O92A 3CW9A 2P2QA 4BSZA 1T5DX 3NPDA 4DV2C 1MDBA 1J5EC 3J80D 4L2ZA 2WD9A 5JRHA 1USPA 3IMLA 1XMOC 3UZ0A 4OX9C 3KXWA 3TDEA 4JI3C 1KKGA 4GXQA 1N2FA 1K0RA 4RVNA 2D1QA 4DUZC 5FLXD 4JI4C 4ODJA 3GR1A 4GKKC 1MXBA 3ETCA 3T1YC 4DR1C 4JI6C 3S82A 1IBMC 2OPLB 2P2FA 5IWAC 2QL8A 5E7QA 5A1IA 1N32C 1GPMA 4G36A 2CXCA 2QVXX 1O90A 1NYEA 3H2TA 3I07A 2HHHC 3CW8X 1ULTA 2E8CA 3JAMD 4G1IA 2WP0C 3PESA 5BSRA 3PBKA 5T8TA 4LF6C 1ZB8A 1V25A 3GKUA 5KEIA 1I94C 4IZ6A 3VNRA 2QVZX 4DV0C 4U5YD 2F4VC 4DCTA 2YCBA 4L7IA 3TUFA 2E7GA 3N2QA 4GS5A 2D28C 3DLPX 1EGAA 1XRBA 1JOSA 2YWBA 4D4GA 5BSMA 2UUCC 2ATWA 4DR3C 2UXDC 5K85A 2PT7G 5KYTA 4DCUA 3AF5A 3R44A 1USPB 2VZEA 4LF4C 2VQEC 1PG4A 3R9XA 1XNRC 4D57A 2QVYX 4K0BA 4TPSB 4DUYC 3A4IA 5BSUA 1QWIA 1FJGC 4LFAC 3I08A 3LGXA 4XX2A 4RLQA 3A9UA 2BJOA 4RM2A 5AE1A 3R9WA 5AE2A 3L8CA 2V7BA 1XNQC 3A9VA 3FCCA 4LE5A 4DV6C 4BC7A 3ETOA 2Y4OA 2CY1A 4PROC 3FCEA 2Y4NA 1QM4A 2BH1X 4JV5C 4KHPC 4ISBA 4B3SC 5BSVA 4JI8C 4DV5C 3LNVA 4JI0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEU A;  3I07 A;  2UXB C;  4JI5 C;  4DV7 C;  5BR8 C;  2E8E A;  1IBL C;  2HHH C;  1HH2 P;  1HNX C;  1N33 C;  2E8C A;  2E8F A;  4AQY C;  3JAM D;  3LUS A;  4DR6 C;  3EER A;  4LF6 C;  1ZB8 A;  1WH9 A;  4DR7 C;  3GKU A;  4JI2 C;  1I94 C;  3IEV A;  4K0K C;  2D7V A;  4DR4 C;  4YY3 C;  5LMU C;  4MH4 A;  4DV0 C;  4DV1 C;  4NXN C;  2F4V C;  3CJE A;  4DCT A;  4JYA C;  4DR2 C;  3J7A D;  2YCB A;  1WF3 A;  5A2Q D;  2ZM6 C;  4YHH C;  2E7G A;  4DCS A;  2EGT A;  1IBK C;  4B3M C;  4X65 C;  1EGA A;  1JOS A;  2ASB A;  4BSZ A;  4DV2 C;  2UUC C;  2ATW A;  5LMN C;  1J5E C;  1HNZ C;  4DR3 C;  4GKJ C;  1MKY A;  3J80 D;  4B3R C;  2UXD C;  2PN2 A;  2PT7 G;  3AF6 A;  4DV3 C;  4DCU A;  1USP A;  3AF5 A;  1XMO C;  1UKK A;  4LF9 C;  2JMP A;  2UXC C;  4OX9 C;  4JI7 C;  1USP B;  1ML8 A;  4MTN A;  4JI3 C;  4DR5 C;  1KKG A;  4LF4 C;  2ONF A;  2VQE C;  4LF5 C;  3R9X A;  4LF8 C;  1XNR C;  4LFB C;  4DV4 C;  1N2F A;  1HR0 C;  1HNW C;  1K0R A;  4DUY C;  1QWI A;  1FJG C;  1PA4 A;  4LFC C;  2XR1 A;  2HJG A;  4DCV A;  4DUZ C;  5FLX D;  2UUB C;  4JI4 C;  2UU9 C;  1L2F A;  4LF7 C;  2UUA C;  1LQL A;  1N34 C;  4LFA C;  1N36 C;  2DYJ A;  4GKK C;  4XX2 A;  4X66 C;  2BJO A;  2OPL A;  3T1Y C;  1XMQ C;  4DR1 C;  4JI1 C;  1IBM C;  4JI6 C;  3R9W A;  2OPL B;  5IWA C;  2QL8 A;  1XNQ C;  2KZF A;  1N32 C;  4DV6 C;  4X62 C;  2CXC A;  1ZB9 A;  4B3T C;  2CY1 A;  4X64 C;  5IT9 D;  4NXM C;  3J81 D;  4JV5 C;  4KHP C;  4B3S C;  3T1H C;  4JI8 C;  2VQF C;  1NYE A;  3OTO C;  4DV5 C;  1VLA A;  4NOZ A;  2E5L C;  4JI0 C; 
#chains in the Genus database with same CATH topology
 2M5H A;  2KDN A;  3IEU A;  4D4I A;  3O2E A;  1YGT A;  3N54 B;  1O93 A;  1N33 C;  2ZZN A;  2E8F A;  4OYC A;  2YX1 A;  3LUS A;  2D1S A;  3EER A;  4K0K C;  5KYV A;  4ZJZ A;  1VEH A;  4DR4 C;  4YY3 C;  5LMU C;  2P02 A;  4DV1 C;  4NXN C;  3CJE A;  4JYA C;  1RG9 A;  2QW0 X;  5ADZ A;  3E7W A;  2AYA A;  4DCS A;  2EGT A;  4X65 C;  3A25 A;  2P2B A;  2ASB A;  4R1L A;  4DG8 A;  1MD9 A;  1P4E C;  2D1T A;  4GKJ C;  1MKY A;  3TR3 A;  4B3R C;  2P2M A;  4DV3 C;  5BUS A;  2OO4 A;  3IPL A;  1UKK A;  1YJ7 A;  4KTV A;  4PHT A;  3UOW A;  4DR5 C;  1MXC A;  2ONF A;  4PZP A;  4LF5 C;  4R1M A;  1MXA A;  4DV4 C;  4IR7 A;  4BBY A;  1HR0 C;  1HNW C;  4FTF A;  5A19 A;  3FM7 A;  1PA4 A;  4ZLP A;  1XHJ A;  3DHV A;  1N34 C;  3GPC A;  4I9G A;  1XRC A;  5BUR A;  2DYJ A;  3NYQ A;  4X66 C;  1AMU A;  3B7W A;  5T8S A;  4RLF A;  2VSQ A;  4NDN A;  2KZF A;  3L95 X;  4X62 C;  5AE3 A;  1XRA A;  4X64 C;  4D56 A;  2DHM A;  2E0G A;  4I9F A;  1P7L A;  3OTO C;  1VLA A;  2UXB C;  4JI5 C;  5BR8 C;  1IBL C;  3G7S A;  5BSW A;  4AQY C;  3A26 A;  4PUI A;  4L4Q A;  1V60 A;  1WH9 A;  3IEV A;  1O9T A;  2D7V A;  2Y27 A;  4MH4 A;  1RY2 A;  4DR2 C;  3C5E A;  4R0M A;  1WF3 A;  5A2Q D;  4G37 A;  1MDF A;  2ZM6 C;  4YHH C;  4RMN A;  2P20 A;  4GXR A;  1IBK C;  4B3M C;  3LAX A;  4FUT A;  4FUQ A;  3VNS A;  4OXI A;  1NY8 A;  4PUH A;  5A1G A;  4BCA A;  1HNZ C;  2MMA B;  1LCI A;  2PN2 A;  3AF6 A;  1XDX A;  4JM1 A;  4LF9 C;  3RV2 A;  2JMP A;  2UXC C;  4JI7 C;  1ML8 A;  4MTN A;  5GTD A;  4RVO A;  2PRO A;  3SO4 A;  4LF8 C;  4LFB C;  2MM9 A;  5IFI A;  5CZV A;  2D27 A;  3CQ1 A;  4EAT A;  4RM3 A;  3AY0 A;  5K8F A;  4LFC C;  2XR1 A;  2HJG A;  4DCV A;  2UUB C;  2UU9 C;  1L2F A;  4LF7 C;  2UUA C;  1LQL A;  1N36 C;  1PG3 A;  2OPL A;  5BST A;  1XMQ C;  5DV9 A;  2DPL A;  4JI1 C;  4DG9 A;  3TQI A;  4WS9 A;  3CQ2 A;  2YWC A;  4PUG A;  1ZB9 A;  4B3T C;  1T5H X;  3PRO C;  3NYR A;  5IT9 D;  4NXM C;  1M6X A;  3J81 D;  4HPV A;  2OBV A;  3VNQ A;  3T1H C;  2VQF C;  5LCI A;  5LMN C;  4NOZ A;  2E5L C;  1HNX C;  4BC9 A;  4DV7 C;  3LNO A;  2E8E A;  5H9U A;  1HH2 P;  1BA3 A;  3NI2 A;  2ZTB A;  3GR0 A;  3EQ6 A;  4WV3 A;  2D1R A;  4KTT A;  4DR6 C;  4DR7 C;  4JI2 C;  5BUQ A;  1FUG A;  5CZX A;  3J7A D;  3DAY A;  2P2J A;  3RG2 A;  1V26 A;  3E7X A;  1O92 A;  2Z51 A;  3CW9 A;  2P2Q A;  4BSZ A;  1T5D X;  3NPD A;  4DV2 C;  1MDB A;  1J5E C;  3J80 D;  4L2Z A;  2NCL A;  2WD9 A;  5JRH A;  1USP A;  3IML A;  1XMO C;  3UX2 A;  3UZ0 A;  4OX9 C;  3KXW A;  3TDE A;  4JI3 C;  1KKG A;  4GXQ A;  3UEB A;  1N2F A;  2PG1 E;  1K0R A;  3UX3 A;  4RVN A;  2D1Q A;  4DUZ C;  5FLX D;  4JI4 C;  4ODJ A;  3GR1 A;  1PU1 A;  1M6X C;  4GKK C;  1MXB A;  3ETC A;  2JNV A;  3T1Y C;  4DR1 C;  4JI6 C;  3S82 A;  1IBM C;  2OPL B;  2P2F A;  5IWA C;  2QL8 A;  5E7Q A;  5A1I A;  1N32 C;  1GPM A;  4G36 A;  1UWD A;  2CXC A;  1XS3 A;  2QVX X;  1O90 A;  1NYE A;  3H2T A;  3I07 A;  2HHH C;  2ZZM A;  3CW8 X;  1ULT A;  1TH5 A;  2E8C A;  3JAM D;  4G1I A;  2WP0 C;  3PES A;  5BSR A;  3PBK A;  5T8T A;  4LF6 C;  1ZB8 A;  1V25 A;  3GKU A;  5KEI A;  1I94 C;  4IZ6 A;  3VNR A;  2QVZ X;  4DV0 C;  4U5Y D;  2F4V C;  4DCT A;  2YCB A;  4L7I A;  3TUF A;  2E7G A;  3N2Q A;  4GS5 A;  2D28 C;  3DLP X;  1EGA A;  1XRB A;  3CQ3 A;  1JOS A;  2YWB A;  4D4G A;  5BSM A;  2UUC C;  2ATW A;  4DR3 C;  2M5O A;  2UXD C;  5K85 A;  2PT7 G;  5KYT A;  4DCU A;  3AF5 A;  3R44 A;  1USP B;  2VZE A;  4LF4 C;  2VQE C;  1P4E A;  1PG4 A;  3R9X A;  1XNR C;  4D57 A;  3K6R A;  2QVY X;  4K0B A;  4TPS B;  4DUY C;  3A4I A;  5BSU A;  1QWI A;  1FJG C;  4LFA C;  3I08 A;  3LGX A;  4XX2 A;  4RLQ A;  3A9U A;  2BJO A;  4RM2 A;  2MCQ A;  5AE1 A;  3R9W A;  5AE2 A;  3L8C A;  2V7B A;  1XNQ C;  3A9V A;  3FCC A;  4LE5 A;  4DV6 C;  4BC7 A;  3ETO A;  2Y4O A;  2CY1 A;  4PRO C;  1FLO A;  3FCE A;  2Y4N A;  2CU6 A;  1QM4 A;  2BH1 X;  4JV5 C;  4KHP C;  2KZ0 A;  4ISB A;  4B3S C;  5BSV A;  1IB8 A;  4JI8 C;  4DV5 C;  3LNV A;  1WCJ A;  4JI0 C; 
#chains in the Genus database with same CATH homology
 3IEU A;  4D4I A;  3N54 B;  1O93 A;  1N33 C;  2E8F A;  4OYC A;  3LUS A;  2D1S A;  3EER A;  4K0K C;  5KYV A;  4ZJZ A;  4DR4 C;  4YY3 C;  5LMU C;  2P02 A;  4DV1 C;  4NXN C;  3CJE A;  4JYA C;  1RG9 A;  2QW0 X;  5ADZ A;  3E7W A;  2AYA A;  4DCS A;  2EGT A;  4X65 C;  2P2B A;  2ASB A;  4R1L A;  4DG8 A;  1MD9 A;  2D1T A;  4GKJ C;  1MKY A;  4B3R C;  2P2M A;  4DV3 C;  5BUS A;  2OO4 A;  3IPL A;  1UKK A;  1YJ7 A;  4KTV A;  4PHT A;  3UOW A;  4DR5 C;  1MXC A;  2ONF A;  4PZP A;  4LF5 C;  4R1M A;  1MXA A;  4DV4 C;  4IR7 A;  4BBY A;  1HR0 C;  1HNW C;  4FTF A;  5A19 A;  1PA4 A;  4ZLP A;  3DHV A;  1N34 C;  3GPC A;  4I9G A;  1XRC A;  5BUR A;  2DYJ A;  3NYQ A;  4X66 C;  1AMU A;  3B7W A;  5T8S A;  4RLF A;  2VSQ A;  4NDN A;  2KZF A;  3L95 X;  4X62 C;  5AE3 A;  1XRA A;  4X64 C;  4D56 A;  2E0G A;  4I9F A;  1P7L A;  3OTO C;  1VLA A;  2UXB C;  4JI5 C;  5BR8 C;  1IBL C;  3G7S A;  5BSW A;  4AQY C;  4L4Q A;  1WH9 A;  3IEV A;  1O9T A;  2D7V A;  2Y27 A;  4MH4 A;  1RY2 A;  4DR2 C;  3C5E A;  4R0M A;  1WF3 A;  5A2Q D;  4G37 A;  1MDF A;  2ZM6 C;  4YHH C;  4RMN A;  2P20 A;  4GXR A;  1IBK C;  4B3M C;  3LAX A;  4FUT A;  4FUQ A;  3VNS A;  4OXI A;  5A1G A;  4BCA A;  1HNZ C;  1LCI A;  2PN2 A;  3AF6 A;  4JM1 A;  4LF9 C;  3RV2 A;  2JMP A;  2UXC C;  4JI7 C;  1ML8 A;  4MTN A;  5GTD A;  4RVO A;  2PRO A;  3SO4 A;  4LF8 C;  4LFB C;  5IFI A;  5CZV A;  2D27 A;  4EAT A;  4RM3 A;  5K8F A;  4LFC C;  2XR1 A;  2HJG A;  4DCV A;  2UUB C;  2UU9 C;  1L2F A;  4LF7 C;  2UUA C;  1LQL A;  1N36 C;  1PG3 A;  2OPL A;  5BST A;  1XMQ C;  5DV9 A;  2DPL A;  4JI1 C;  4DG9 A;  3TQI A;  4WS9 A;  2YWC A;  1ZB9 A;  4B3T C;  1T5H X;  3PRO C;  3NYR A;  5IT9 D;  4NXM C;  3J81 D;  4HPV A;  2OBV A;  3VNQ A;  3T1H C;  2VQF C;  5LMN C;  4NOZ A;  2E5L C;  1HNX C;  4BC9 A;  4DV7 C;  2E8E A;  5H9U A;  1HH2 P;  1BA3 A;  3NI2 A;  3GR0 A;  3EQ6 A;  4WV3 A;  2D1R A;  4KTT A;  4DR6 C;  4DR7 C;  4JI2 C;  5BUQ A;  1FUG A;  5CZX A;  3J7A D;  3DAY A;  2P2J A;  3RG2 A;  1V26 A;  3E7X A;  1O92 A;  3CW9 A;  2P2Q A;  4BSZ A;  1T5D X;  3NPD A;  4DV2 C;  1MDB A;  1J5E C;  3J80 D;  4L2Z A;  2WD9 A;  5JRH A;  1USP A;  3IML A;  1XMO C;  3UZ0 A;  4OX9 C;  3KXW A;  3TDE A;  4JI3 C;  1KKG A;  4GXQ A;  1N2F A;  1K0R A;  4RVN A;  2D1Q A;  4DUZ C;  5FLX D;  4JI4 C;  4ODJ A;  3GR1 A;  4GKK C;  1MXB A;  3ETC A;  3T1Y C;  4DR1 C;  4JI6 C;  3S82 A;  1IBM C;  2OPL B;  2P2F A;  5IWA C;  2QL8 A;  5E7Q A;  5A1I A;  1N32 C;  1GPM A;  4G36 A;  2CXC A;  2QVX X;  1O90 A;  1NYE A;  3H2T A;  3I07 A;  2HHH C;  3CW8 X;  1ULT A;  2E8C A;  3JAM D;  4G1I A;  2WP0 C;  3PES A;  5BSR A;  3PBK A;  5T8T A;  4LF6 C;  1ZB8 A;  1V25 A;  3GKU A;  5KEI A;  1I94 C;  4IZ6 A;  3VNR A;  2QVZ X;  4DV0 C;  4U5Y D;  2F4V C;  4DCT A;  2YCB A;  4L7I A;  3TUF A;  2E7G A;  3N2Q A;  4GS5 A;  2D28 C;  3DLP X;  1EGA A;  1XRB A;  1JOS A;  2YWB A;  4D4G A;  5BSM A;  2UUC C;  2ATW A;  4DR3 C;  2UXD C;  5K85 A;  2PT7 G;  5KYT A;  4DCU A;  3AF5 A;  3R44 A;  1USP B;  2VZE A;  4LF4 C;  2VQE C;  1PG4 A;  3R9X A;  1XNR C;  4D57 A;  2QVY X;  4K0B A;  4TPS B;  4DUY C;  3A4I A;  5BSU A;  1QWI A;  1FJG C;  4LFA C;  3I08 A;  3LGX A;  4XX2 A;  4RLQ A;  3A9U A;  2BJO A;  4RM2 A;  5AE1 A;  3R9W A;  5AE2 A;  3L8C A;  2V7B A;  1XNQ C;  3A9V A;  3FCC A;  4LE5 A;  4DV6 C;  4BC7 A;  3ETO A;  2Y4O A;  2CY1 A;  4PRO C;  3FCE A;  2Y4N A;  1QM4 A;  2BH1 X;  4JV5 C;  4KHP C;  4ISB A;  4B3S C;  5BSV A;  4JI8 C;  4DV5 C;  3LNV A;  4JI0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...