4DV1C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv1C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv1C02
2UUCC 1PA4A 1N2FA 2UU9C 4B3TC 1XNQC 1KKGA 4KHPC 1ZB8A 1XMOC 1J5EC 4JI5C 1QWIA 2QL8A 4DV2C 2JMPA 4DUYC 4DCSA 4LFBC 4DR3C 1I94C 4NXNC 3GKUA 4NXMC 1WH9A 4JYAC 2E8FA 3CJEA 4JI6C 4BSZA 1XNRC 4DV6C 1N34C 4DV0C 4DR7C 2VQFC 3T1YC 3I07A 3J7AD 2OPLB 4XX2A 1IBKC 1WF3A 2VQEC 2HJGA 4DUZC 1HH2P 1VLAA 2E8EA 4B3SC 1USPA 2CXCA 4JI3C 2UXDC 4JI2C 2F4VC 4GKJC 4B3MC 1USPB 1NYEA 5IT9D 1XMQC 3EERA 5LMNC 4B3RC 1HR0C 5LMUC 4DR2C 4DV5C 2OPLA 3IEVA 4NOZA 4JI0C 4DR1C 4MTNA 4DR5C 4LFAC 3LUSA 2PT7G 2CY1A 2PN2A 4LF9C 2XR1A 2UXCC 2ONFA 2UUAC 3AF5A 4OX9C 4MH4A 4X66C 4X64C 1IBMC 4DCTA 4JV5C 4DV3C 2E5LC 5FLXD 4LF4C 3OTOC 3R9WA 1N36C 2KZFA 4YHHC 1K0RA 1HNZC 1ML8A 3JAMD 1HNXC 4JI8C 4LF8C 5IWAC 2HHHC 4DR4C 4LF7C 1MKYA 1EGAA 4LFCC 4DR6C 1FJGC 3T1HC 2DYJA 1UKKA 2UUBC 4GKKC 4JI7C 4DCUA 2ZM6C 4X62C 4X65C 1LQLA 3J81D 3R9XA 1IBLC 1N33C 1L2FA 4DV4C 4DCVA 2EGTA 4JI4C 4DV1C 4K0KC 4LF5C 3AF6A 4JI1C 5A2QD 1N32C 3IEUA 2ASBA 4AQYC 1HNWC 2ATWA 2D7VA 1JOSA 5BR8C 3J80D 4DV7C 2YCBA 2UXBC 4LF6C 2E8CA 2BJOA 1ZB9A 4YY3C 2E7GA
chains in the Genus database with same CATH superfamily
1N2FA 4B3TC 1KKGA 3A4IA 1V25A 1QWIA 3TQIA 4GXQA 4DUYC 3PBKA 4DCSA 4R0MA 4LFBC 3E7WA 4RMNA 5K85A 4NXMC 2E0GA 2E8FA 3GPCA 4TPSB 5A19A 4DV0C 3N2QA 5IFIA 2VQFC 1XDXA 3I07A 2DHMA 3C5EA 3H2TA 1IBKC 1MD9A 1HH2P 1VLAA 2E8EA 4L2ZA 5BUQA 1USPA 4B3SC 2UXDC 4JI2C 2D27A 1USPB 4JM1A 5IT9D 1O90A 4I9GA 3CQ1A 4G1IA 5LMUC 4FTFA 5AE2A 4R1LA 2OPLA 4MTNA 5JRHA 3VNRA 4LF9C 1UWDA 2P2QA 4X66C 1IBMC 1RY2A 4D4GA 4HPVA 4JV5C 3NI2A 3R9WA 2KZFA 5A1GA 2D1RA 2HHHC 5AE1A 4DR4C 5BSWA 4LF7C 1MKYA 3A9VA 1FUGA 4G37A 1UKKA 4GKKC 2ZM6C 4X62C 3J81D 3R9XA 1N33C 5KYTA 3IEUA 2OBVA 4BC7A 5BR8C 2PROA 5DV9A 2PG1E 3A26A 4DV7C 2YCBA 1P4EC 5T8TA 1PA4A 3TR3A 4FUTA 1M6XA 2MM9A 3VNSA 3CQ2A 3I08A 1M6XC 4IR7A 1XS3A 2CU6A 5H9UA 3L95X 2P2JA 1N34C 3A25A 5LCIA 2ZZMA 2V7BA 4DR7C 4KTTA 2YX1A 4XX2A 3PESA 1WF3A 1V60A 2M5HA 2CXCA 4GKJC 5BSMA 4B3MC 1NYEA 1XMQC 5LMNC 1RG9A 4NDNA 1HR0C 4RVNA 3TUFA 4DV5C 5BSRA 5BURA 4DR5C 4LFAC 3PROC 5CZVA 2CY1A 3FCEA 2XR1A 2ONFA 3UZ0A 3FCCA 2YWCA 5ADZA 4DV3C 1PG3A 3EQ6A 3CQ3A 5FLXD 4LF4C 3RG2A 1T5DX 1HNXC 3GR1A 1EGAA 5KYVA 2D28C 4DR6C 2QVXX 3A9UA 3IPLA 3GR0A 3KXWA 2Y4NA 4D4IA 4ZLPA 4LE5A 1L2FA 4PZPA 4LF5C 3AF6A 2D1SA 3DLPX 1N32C 2D7VA 1JOSA 1O93A 2D1TA 3L8CA 4OXIA 4DG9A 3IMLA 4D56A 3CW9A 1YJ7A 1AMUA 2UUCC 2KDNA 4ZJZA 1T5HX 4KHPC 4JI5C 1VEHA 2QL8A 3O2EA 3B7WA 2JMPA 1PG4A 5A1IA 3FM7A 5T8SA 1FLOA 1I94C 4NXNC 1O92A 4FUQA 1P7LA 3CJEA 4JYAC 1XNRC 4BSZA 4DV6C 1GPMA 3UX3A 2OPLB 2VZEA 2MMAB 2VQEC 4DUZC 4PHTA 2WP0C 4L4QA 2YWBA 3EERA 3LAXA 4B3RC 5BSTA 4DR2C 2JNVA 3IEVA 4NOZA 4JI0C 1NY8A 2PT7G 4RM2A 2ZZNA 1LCIA 2BH1X 4MH4A 3ETCA 3VNQA 1XRAA 4DCTA 2E5LC 3RV2A 3N54B 3UOWA 4YHHC 1K0RA 1ULTA 1XRBA 3E7XA 4R1MA 4LF8C 1MDBA 5IWAC 5GTDA 4PROC 1O9TA 4ODJA 4LFCC 5BSUA 5K8FA 1FJGC 3T1HC 1V26A 2DYJA 4BCAA 2WD9A 3G7SA 1YGTA 3LNVA 2P2MA 2VSQA 2Z51A 3R44A 4PUHA 4JI7C 1LQLA 1IB8A 1TH5A 4DV4C 2EGTA 2M5OA 2P2FA 4JI4C 4DV1C 4JI1C 5A2QD 4ISBA 1HNWC 5CZXA 2ZTBA 4RM3A 3J80D 4GXRA 2QVZX 4KTVA 2P2BA 1BA3A 3LGXA 2E8CA 1ZB9A 1QM4A 4YY3C 3LNOA 4PUGA 1P4EA 2UU9C 1XNQC 3SO4A 1ZB8A 4OYCA 2MCQA 1XMOC 1J5EC 2P02A 2QVYX 4DV2C 4RLQA 3TDEA 4DR3C 2Y27A 4DG8A 4GS5A 3GKUA 1MDFA 3UX2A 4IZ6A 1WH9A 4JI6C 3S82A 4EATA 3ETOA 3AY0A 3T1YC 3J7AD 1XRCA 2Y4OA 4PUIA 4I9FA 1MXAA 2HJGA 4JI3C 2F4VC 2KZ0A 5E7QA 5KEIA 4RVOA 1PU1A 4DR1C 3LUSA 4G36A 3DAYA 2PN2A 2UXCC 2UUAC 3AF5A 4OX9C 4BBYA 4X64C 1MXBA 4K0BA 3NYRA 3OTOC 4WS9A 2DPLA 1N36C 4L7IA 1HNZC 1ML8A 3JAMD 3UEBA 4JI8C 4RLFA 2QW0X 2OO4A 5AE3A 3DHVA 4WV3A 4U5YD 2UUBC 5BSVA 1MXCA 2NCLA 4D57A 4DCUA 2D1QA 4X65C 1IBLC 4DCVA 4K0KC 5BUSA 2ASBA 4BC9A 1WCJA 3NYQA 4AQYC 3K6RA 2ATWA 3CW8X 2UXBC 2P20A 4LF6C 2BJOA 2AYAA 1XHJA 3NPDA 2E7GA
chains in the Genus database with same CATH topology
1N2FA 4B3TC 1KKGA 3A4IA 1V25A 1QWIA 3TQIA 4GXQA 4DUYC 3PBKA 4DCSA 4R0MA 4LFBC 3E7WA 4RMNA 5K85A 4NXMC 2E0GA 2E8FA 3GPCA 4TPSB 5A19A 4DV0C 3N2QA 5IFIA 2VQFC 3I07A 3C5EA 3H2TA 1IBKC 1MD9A 1HH2P 1VLAA 2E8EA 4L2ZA 5BUQA 1USPA 4B3SC 2UXDC 4JI2C 2D27A 1USPB 4JM1A 5IT9D 1O90A 4I9GA 4G1IA 5LMUC 4FTFA 5AE2A 4R1LA 2OPLA 4MTNA 5JRHA 3VNRA 4LF9C 2P2QA 4X66C 1IBMC 1RY2A 4D4GA 4HPVA 4JV5C 3NI2A 3R9WA 2KZFA 5A1GA 2D1RA 2HHHC 5AE1A 4DR4C 5BSWA 4LF7C 1MKYA 3A9VA 1FUGA 4G37A 1UKKA 4GKKC 2ZM6C 4X62C 3J81D 3R9XA 1N33C 5KYTA 3IEUA 2OBVA 4BC7A 5BR8C 2PROA 5DV9A 4DV7C 2YCBA 5T8TA 1PA4A 4FUTA 3VNSA 3I08A 4IR7A 5H9UA 3L95X 2P2JA 1N34C 2V7BA 4DR7C 4KTTA 4XX2A 3PESA 1WF3A 2CXCA 4GKJC 5BSMA 4B3MC 1NYEA 1XMQC 5LMNC 1RG9A 4NDNA 1HR0C 4RVNA 3TUFA 4DV5C 5BSRA 5BURA 4DR5C 4LFAC 3PROC 5CZVA 2CY1A 3FCEA 2XR1A 2ONFA 3UZ0A 3FCCA 2YWCA 5ADZA 4DV3C 1PG3A 3EQ6A 5FLXD 4LF4C 3RG2A 1T5DX 1HNXC 3GR1A 1EGAA 5KYVA 2D28C 4DR6C 2QVXX 3A9UA 3IPLA 3GR0A 3KXWA 2Y4NA 4D4IA 4ZLPA 4LE5A 1L2FA 4PZPA 4LF5C 3AF6A 2D1SA 3DLPX 1N32C 2D7VA 1JOSA 1O93A 2D1TA 3L8CA 4OXIA 4DG9A 3IMLA 4D56A 3CW9A 1YJ7A 1AMUA 2UUCC 4ZJZA 1T5HX 4KHPC 4JI5C 2QL8A 3B7WA 2JMPA 1PG4A 5A1IA 5T8SA 1I94C 4NXNC 1O92A 4FUQA 1P7LA 3CJEA 4JYAC 1XNRC 4BSZA 4DV6C 1GPMA 2OPLB 2VZEA 2VQEC 4DUZC 4PHTA 2WP0C 4L4QA 2YWBA 3EERA 3LAXA 4B3RC 5BSTA 4DR2C 3IEVA 4NOZA 4JI0C 2PT7G 4RM2A 1LCIA 2BH1X 4MH4A 3ETCA 3VNQA 1XRAA 4DCTA 2E5LC 3RV2A 3N54B 3UOWA 4YHHC 1K0RA 1ULTA 1XRBA 3E7XA 4R1MA 4LF8C 1MDBA 5IWAC 5GTDA 4PROC 1O9TA 4ODJA 4LFCC 5BSUA 5K8FA 1FJGC 3T1HC 1V26A 2DYJA 4BCAA 2WD9A 3G7SA 3LNVA 2P2MA 2VSQA 3R44A 4JI7C 1LQLA 4DV4C 2EGTA 4JI4C 2P2FA 4DV1C 4JI1C 5A2QD 4ISBA 1HNWC 5CZXA 4RM3A 3J80D 4GXRA 2QVZX 4KTVA 2P2BA 1BA3A 3LGXA 2E8CA 1ZB9A 1QM4A 4YY3C 2UU9C 1XNQC 3SO4A 1ZB8A 4OYCA 1XMOC 1J5EC 2P02A 2QVYX 4DV2C 4RLQA 3TDEA 4DR3C 2Y27A 4DG8A 4GS5A 3GKUA 1MDFA 4IZ6A 1WH9A 4JI6C 3S82A 4EATA 3ETOA 3T1YC 3J7AD 1XRCA 2Y4OA 4I9FA 1MXAA 2HJGA 4JI3C 2F4VC 5E7QA 5KEIA 4RVOA 4DR1C 3LUSA 4G36A 3DAYA 2PN2A 2UXCC 2UUAC 3AF5A 4OX9C 4BBYA 4X64C 1MXBA 4K0BA 3NYRA 3OTOC 4WS9A 2DPLA 1N36C 4L7IA 1HNZC 1ML8A 3JAMD 4JI8C 4RLFA 2QW0X 2OO4A 5AE3A 3DHVA 4WV3A 4U5YD 2UUBC 5BSVA 1MXCA 4D57A 4DCUA 2D1QA 4X65C 1IBLC 4DCVA 4K0KC 5BUSA 2ASBA 4BC9A 3NYQA 4AQYC 2ATWA 3CW8X 2UXBC 2P20A 4LF6C 2BJOA 2AYAA 3NPDA 2E7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC C;  1PA4 A;  1N2F A;  2UU9 C;  4B3T C;  1XNQ C;  1KKG A;  4KHP C;  1ZB8 A;  1XMO C;  1J5E C;  4JI5 C;  1QWI A;  2QL8 A;  4DV2 C;  2JMP A;  4DUY C;  4DCS A;  4LFB C;  4DR3 C;  1I94 C;  4NXN C;  3GKU A;  4NXM C;  1WH9 A;  4JYA C;  2E8F A;  3CJE A;  4JI6 C;  4BSZ A;  1XNR C;  4DV6 C;  1N34 C;  4DV0 C;  4DR7 C;  2VQF C;  3T1Y C;  3I07 A;  3J7A D;  2OPL B;  4XX2 A;  1IBK C;  1WF3 A;  2VQE C;  2HJG A;  4DUZ C;  1HH2 P;  1VLA A;  2E8E A;  4B3S C;  1USP A;  2CXC A;  4JI3 C;  2UXD C;  4JI2 C;  2F4V C;  4GKJ C;  4B3M C;  1USP B;  1NYE A;  5IT9 D;  1XMQ C;  3EER A;  5LMN C;  4B3R C;  1HR0 C;  5LMU C;  4DR2 C;  4DV5 C;  2OPL A;  3IEV A;  4NOZ A;  4JI0 C;  4DR1 C;  4MTN A;  4DR5 C;  4LFA C;  3LUS A;  2PT7 G;  2CY1 A;  2PN2 A;  4LF9 C;  2XR1 A;  2UXC C;  2ONF A;  2UUA C;  3AF5 A;  4OX9 C;  4MH4 A;  4X66 C;  4X64 C;  1IBM C;  4DCT A;  4JV5 C;  4DV3 C;  2E5L C;  5FLX D;  4LF4 C;  3OTO C;  3R9W A;  1N36 C;  2KZF A;  4YHH C;  1K0R A;  1HNZ C;  1ML8 A;  3JAM D;  1HNX C;  4JI8 C;  4LF8 C;  5IWA C;  2HHH C;  4DR4 C;  4LF7 C;  1MKY A;  1EGA A;  4LFC C;  4DR6 C;  1FJG C;  3T1H C;  2DYJ A;  1UKK A;  2UUB C;  4GKK C;  4JI7 C;  4DCU A;  2ZM6 C;  4X62 C;  4X65 C;  1LQL A;  3J81 D;  3R9X A;  1IBL C;  1N33 C;  1L2F A;  4DV4 C;  4DCV A;  2EGT A;  4JI4 C;  4DV1 C;  4K0K C;  4LF5 C;  3AF6 A;  4JI1 C;  5A2Q D;  1N32 C;  3IEU A;  2ASB A;  4AQY C;  1HNW C;  2ATW A;  2D7V A;  1JOS A;  5BR8 C;  3J80 D;  4DV7 C;  2YCB A;  2UXB C;  4LF6 C;  2E8C A;  2BJO A;  1ZB9 A;  4YY3 C;  2E7G A; 
#chains in the Genus database with same CATH topology
 1N2F A;  4B3T C;  1KKG A;  3A4I A;  1V25 A;  1QWI A;  3TQI A;  4GXQ A;  4DUY C;  3PBK A;  4DCS A;  4R0M A;  4LFB C;  3E7W A;  4RMN A;  5K85 A;  4NXM C;  2E0G A;  2E8F A;  3GPC A;  4TPS B;  5A19 A;  4DV0 C;  3N2Q A;  5IFI A;  2VQF C;  1XDX A;  3I07 A;  2DHM A;  3C5E A;  3H2T A;  1IBK C;  1MD9 A;  1HH2 P;  1VLA A;  2E8E A;  4L2Z A;  5BUQ A;  1USP A;  4B3S C;  2UXD C;  4JI2 C;  2D27 A;  1USP B;  4JM1 A;  5IT9 D;  1O90 A;  4I9G A;  3CQ1 A;  4G1I A;  5LMU C;  4FTF A;  5AE2 A;  4R1L A;  2OPL A;  4MTN A;  5JRH A;  3VNR A;  4LF9 C;  1UWD A;  2P2Q A;  4X66 C;  1IBM C;  1RY2 A;  4D4G A;  4HPV A;  4JV5 C;  3NI2 A;  3R9W A;  2KZF A;  5A1G A;  2D1R A;  2HHH C;  5AE1 A;  4DR4 C;  5BSW A;  4LF7 C;  1MKY A;  3A9V A;  1FUG A;  4G37 A;  1UKK A;  4GKK C;  2ZM6 C;  4X62 C;  3J81 D;  3R9X A;  1N33 C;  5KYT A;  3IEU A;  2OBV A;  4BC7 A;  5BR8 C;  2PRO A;  5DV9 A;  2PG1 E;  3A26 A;  4DV7 C;  2YCB A;  1P4E C;  5T8T A;  1PA4 A;  3TR3 A;  4FUT A;  1M6X A;  2MM9 A;  3VNS A;  3CQ2 A;  3I08 A;  1M6X C;  4IR7 A;  1XS3 A;  2CU6 A;  5H9U A;  3L95 X;  2P2J A;  1N34 C;  3A25 A;  5LCI A;  2ZZM A;  2V7B A;  4DR7 C;  4KTT A;  2YX1 A;  4XX2 A;  3PES A;  1WF3 A;  1V60 A;  2M5H A;  2CXC A;  4GKJ C;  5BSM A;  4B3M C;  1NYE A;  1XMQ C;  5LMN C;  1RG9 A;  4NDN A;  1HR0 C;  4RVN A;  3TUF A;  4DV5 C;  5BSR A;  5BUR A;  4DR5 C;  4LFA C;  3PRO C;  5CZV A;  2CY1 A;  3FCE A;  2XR1 A;  2ONF A;  3UZ0 A;  3FCC A;  2YWC A;  5ADZ A;  4DV3 C;  1PG3 A;  3EQ6 A;  3CQ3 A;  5FLX D;  4LF4 C;  3RG2 A;  1T5D X;  1HNX C;  3GR1 A;  1EGA A;  5KYV A;  2D28 C;  4DR6 C;  2QVX X;  3A9U A;  3IPL A;  3GR0 A;  3KXW A;  2Y4N A;  4D4I A;  4ZLP A;  4LE5 A;  1L2F A;  4PZP A;  4LF5 C;  3AF6 A;  2D1S A;  3DLP X;  1N32 C;  2D7V A;  1JOS A;  1O93 A;  2D1T A;  3L8C A;  4OXI A;  4DG9 A;  3IML A;  4D56 A;  3CW9 A;  1YJ7 A;  1AMU A;  2UUC C;  2KDN A;  4ZJZ A;  1T5H X;  4KHP C;  4JI5 C;  1VEH A;  2QL8 A;  3O2E A;  3B7W A;  2JMP A;  1PG4 A;  5A1I A;  3FM7 A;  5T8S A;  1FLO A;  1I94 C;  4NXN C;  1O92 A;  4FUQ A;  1P7L A;  3CJE A;  4JYA C;  1XNR C;  4BSZ A;  4DV6 C;  1GPM A;  3UX3 A;  2OPL B;  2VZE A;  2MMA B;  2VQE C;  4DUZ C;  4PHT A;  2WP0 C;  4L4Q A;  2YWB A;  3EER A;  3LAX A;  4B3R C;  5BST A;  4DR2 C;  2JNV A;  3IEV A;  4NOZ A;  4JI0 C;  1NY8 A;  2PT7 G;  4RM2 A;  2ZZN A;  1LCI A;  2BH1 X;  4MH4 A;  3ETC A;  3VNQ A;  1XRA A;  4DCT A;  2E5L C;  3RV2 A;  3N54 B;  3UOW A;  4YHH C;  1K0R A;  1ULT A;  1XRB A;  3E7X A;  4R1M A;  4LF8 C;  1MDB A;  5IWA C;  5GTD A;  4PRO C;  1O9T A;  4ODJ A;  4LFC C;  5BSU A;  5K8F A;  1FJG C;  3T1H C;  1V26 A;  2DYJ A;  4BCA A;  2WD9 A;  3G7S A;  1YGT A;  3LNV A;  2P2M A;  2VSQ A;  2Z51 A;  3R44 A;  4PUH A;  4JI7 C;  1LQL A;  1IB8 A;  1TH5 A;  4DV4 C;  2EGT A;  2M5O A;  2P2F A;  4JI4 C;  4DV1 C;  4JI1 C;  5A2Q D;  4ISB A;  1HNW C;  5CZX A;  2ZTB A;  4RM3 A;  3J80 D;  4GXR A;  2QVZ X;  4KTV A;  2P2B A;  1BA3 A;  3LGX A;  2E8C A;  1ZB9 A;  1QM4 A;  4YY3 C;  3LNO A;  4PUG A;  1P4E A;  2UU9 C;  1XNQ C;  3SO4 A;  1ZB8 A;  4OYC A;  2MCQ A;  1XMO C;  1J5E C;  2P02 A;  2QVY X;  4DV2 C;  4RLQ A;  3TDE A;  4DR3 C;  2Y27 A;  4DG8 A;  4GS5 A;  3GKU A;  1MDF A;  3UX2 A;  4IZ6 A;  1WH9 A;  4JI6 C;  3S82 A;  4EAT A;  3ETO A;  3AY0 A;  3T1Y C;  3J7A D;  1XRC A;  2Y4O A;  4PUI A;  4I9F A;  1MXA A;  2HJG A;  4JI3 C;  2F4V C;  2KZ0 A;  5E7Q A;  5KEI A;  4RVO A;  1PU1 A;  4DR1 C;  3LUS A;  4G36 A;  3DAY A;  2PN2 A;  2UXC C;  2UUA C;  3AF5 A;  4OX9 C;  4BBY A;  4X64 C;  1MXB A;  4K0B A;  3NYR A;  3OTO C;  4WS9 A;  2DPL A;  1N36 C;  4L7I A;  1HNZ C;  1ML8 A;  3JAM D;  3UEB A;  4JI8 C;  4RLF A;  2QW0 X;  2OO4 A;  5AE3 A;  3DHV A;  4WV3 A;  4U5Y D;  2UUB C;  5BSV A;  1MXC A;  2NCL A;  4D57 A;  4DCU A;  2D1Q A;  4X65 C;  1IBL C;  4DCV A;  4K0K C;  5BUS A;  2ASB A;  4BC9 A;  1WCJ A;  3NYQ A;  4AQY C;  3K6R A;  2ATW A;  3CW8 X;  2UXB C;  2P20 A;  4LF6 C;  2BJO A;  2AYA A;  1XHJ A;  3NPD A;  2E7G A; 
#chains in the Genus database with same CATH homology
 1N2F A;  4B3T C;  1KKG A;  3A4I A;  1V25 A;  1QWI A;  3TQI A;  4GXQ A;  4DUY C;  3PBK A;  4DCS A;  4R0M A;  4LFB C;  3E7W A;  4RMN A;  5K85 A;  4NXM C;  2E0G A;  2E8F A;  3GPC A;  4TPS B;  5A19 A;  4DV0 C;  3N2Q A;  5IFI A;  2VQF C;  3I07 A;  3C5E A;  3H2T A;  1IBK C;  1MD9 A;  1HH2 P;  1VLA A;  2E8E A;  4L2Z A;  5BUQ A;  1USP A;  4B3S C;  2UXD C;  4JI2 C;  2D27 A;  1USP B;  4JM1 A;  5IT9 D;  1O90 A;  4I9G A;  4G1I A;  5LMU C;  4FTF A;  5AE2 A;  4R1L A;  2OPL A;  4MTN A;  5JRH A;  3VNR A;  4LF9 C;  2P2Q A;  4X66 C;  1IBM C;  1RY2 A;  4D4G A;  4HPV A;  4JV5 C;  3NI2 A;  3R9W A;  2KZF A;  5A1G A;  2D1R A;  2HHH C;  5AE1 A;  4DR4 C;  5BSW A;  4LF7 C;  1MKY A;  3A9V A;  1FUG A;  4G37 A;  1UKK A;  4GKK C;  2ZM6 C;  4X62 C;  3J81 D;  3R9X A;  1N33 C;  5KYT A;  3IEU A;  2OBV A;  4BC7 A;  5BR8 C;  2PRO A;  5DV9 A;  4DV7 C;  2YCB A;  5T8T A;  1PA4 A;  4FUT A;  3VNS A;  3I08 A;  4IR7 A;  5H9U A;  3L95 X;  2P2J A;  1N34 C;  2V7B A;  4DR7 C;  4KTT A;  4XX2 A;  3PES A;  1WF3 A;  2CXC A;  4GKJ C;  5BSM A;  4B3M C;  1NYE A;  1XMQ C;  5LMN C;  1RG9 A;  4NDN A;  1HR0 C;  4RVN A;  3TUF A;  4DV5 C;  5BSR A;  5BUR A;  4DR5 C;  4LFA C;  3PRO C;  5CZV A;  2CY1 A;  3FCE A;  2XR1 A;  2ONF A;  3UZ0 A;  3FCC A;  2YWC A;  5ADZ A;  4DV3 C;  1PG3 A;  3EQ6 A;  5FLX D;  4LF4 C;  3RG2 A;  1T5D X;  1HNX C;  3GR1 A;  1EGA A;  5KYV A;  2D28 C;  4DR6 C;  2QVX X;  3A9U A;  3IPL A;  3GR0 A;  3KXW A;  2Y4N A;  4D4I A;  4ZLP A;  4LE5 A;  1L2F A;  4PZP A;  4LF5 C;  3AF6 A;  2D1S A;  3DLP X;  1N32 C;  2D7V A;  1JOS A;  1O93 A;  2D1T A;  3L8C A;  4OXI A;  4DG9 A;  3IML A;  4D56 A;  3CW9 A;  1YJ7 A;  1AMU A;  2UUC C;  4ZJZ A;  1T5H X;  4KHP C;  4JI5 C;  2QL8 A;  3B7W A;  2JMP A;  1PG4 A;  5A1I A;  5T8S A;  1I94 C;  4NXN C;  1O92 A;  4FUQ A;  1P7L A;  3CJE A;  4JYA C;  1XNR C;  4BSZ A;  4DV6 C;  1GPM A;  2OPL B;  2VZE A;  2VQE C;  4DUZ C;  4PHT A;  2WP0 C;  4L4Q A;  2YWB A;  3EER A;  3LAX A;  4B3R C;  5BST A;  4DR2 C;  3IEV A;  4NOZ A;  4JI0 C;  2PT7 G;  4RM2 A;  1LCI A;  2BH1 X;  4MH4 A;  3ETC A;  3VNQ A;  1XRA A;  4DCT A;  2E5L C;  3RV2 A;  3N54 B;  3UOW A;  4YHH C;  1K0R A;  1ULT A;  1XRB A;  3E7X A;  4R1M A;  4LF8 C;  1MDB A;  5IWA C;  5GTD A;  4PRO C;  1O9T A;  4ODJ A;  4LFC C;  5BSU A;  5K8F A;  1FJG C;  3T1H C;  1V26 A;  2DYJ A;  4BCA A;  2WD9 A;  3G7S A;  3LNV A;  2P2M A;  2VSQ A;  3R44 A;  4JI7 C;  1LQL A;  4DV4 C;  2EGT A;  4JI4 C;  2P2F A;  4DV1 C;  4JI1 C;  5A2Q D;  4ISB A;  1HNW C;  5CZX A;  4RM3 A;  3J80 D;  4GXR A;  2QVZ X;  4KTV A;  2P2B A;  1BA3 A;  3LGX A;  2E8C A;  1ZB9 A;  1QM4 A;  4YY3 C;  2UU9 C;  1XNQ C;  3SO4 A;  1ZB8 A;  4OYC A;  1XMO C;  1J5E C;  2P02 A;  2QVY X;  4DV2 C;  4RLQ A;  3TDE A;  4DR3 C;  2Y27 A;  4DG8 A;  4GS5 A;  3GKU A;  1MDF A;  4IZ6 A;  1WH9 A;  4JI6 C;  3S82 A;  4EAT A;  3ETO A;  3T1Y C;  3J7A D;  1XRC A;  2Y4O A;  4I9F A;  1MXA A;  2HJG A;  4JI3 C;  2F4V C;  5E7Q A;  5KEI A;  4RVO A;  4DR1 C;  3LUS A;  4G36 A;  3DAY A;  2PN2 A;  2UXC C;  2UUA C;  3AF5 A;  4OX9 C;  4BBY A;  4X64 C;  1MXB A;  4K0B A;  3NYR A;  3OTO C;  4WS9 A;  2DPL A;  1N36 C;  4L7I A;  1HNZ C;  1ML8 A;  3JAM D;  4JI8 C;  4RLF A;  2QW0 X;  2OO4 A;  5AE3 A;  3DHV A;  4WV3 A;  4U5Y D;  2UUB C;  5BSV A;  1MXC A;  4D57 A;  4DCU A;  2D1Q A;  4X65 C;  1IBL C;  4DCV A;  4K0K C;  5BUS A;  2ASB A;  4BC9 A;  3NYQ A;  4AQY C;  2ATW A;  3CW8 X;  2UXB C;  2P20 A;  4LF6 C;  2BJO A;  2AYA A;  3NPD A;  2E7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...