4JI2C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji2C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji2C02
1IBKC 4DUZC 4DV2C 1NYEA 2DYJA 1HNXC 2UUCC 3J80D 1ZB8A 2UU9C 1N36C 4JI7C 2PT7G 3JAMD 1WF3A 2CXCA 4JI1C 4DR2C 3GKUA 4JI6C 1N2FA 1HR0C 4JI5C 3R9WA 2JMPA 4DV5C 5BR8C 2ASBA 4LFBC 1XNQC 3AF6A 2OPLA 1EGAA 3EERA 4XX2A 2UUAC 2E8CA 4MTNA 1PA4A 4LF6C 1XNRC 4JI0C 1N32C 4YHHC 5LMUC 3J7AD 2D7VA 4OX9C 4LFAC 1WH9A 2VQFC 1FJGC 1XMQC 1ML8A 2BJOA 4DCUA 4GKJC 4DV0C 1HNWC 1USPA 3I07A 4KHPC 4DR1C 1XMOC 5IWAC 3T1HC 1I94C 2KZFA 4B3TC 4DV1C 4JI8C 3R9XA 4X65C 2QL8A 1N33C 3IEVA 5LMNC 3OTOC 1HH2P 1MKYA 1LQLA 2OPLB 4DV3C 4DR3C 4LF8C 4NXNC 3J81D 4NOZA 5IT9D 1IBMC 4YY3C 4X66C 4DR4C 2UXCC 4LF9C 2HJGA 4B3RC 2XR1A 5A2QD 4B3SC 1ZB9A 3CJEA 2ATWA 4MH4A 4BSZA 2F4VC 4DR6C 4X64C 1IBLC 2UXBC 4DCVA 2ZM6C 2VQEC 4GKKC 1KKGA 5FLXD 4LF4C 4LF7C 4LFCC 2UUBC 1K0RA 2PN2A 1VLAA 1UKKA 1J5EC 1N34C 4JI3C 1HNZC 2EGTA 1USPB 1L2FA 4DUYC 4DV4C 4LF5C 3IEUA 2E8FA 4B3MC 4DV7C 4DV6C 2E7GA 4DR7C 3T1YC 4JI4C 1JOSA 4JYAC 4JV5C 3LUSA 2HHHC 3AF5A 4DCTA 4NXMC 4DCSA 4X62C 2YCBA 4AQYC 2UXDC 2ONFA 2E8EA 4K0KC 2E5LC 4DR5C 4JI2C 2CY1A 1QWIA
chains in the Genus database with same CATH superfamily
3PROC 2WD9A 2M5HA 4DUZC 2WP0C 3J80D 3G7SA 4RLFA 3K6RA 4D57A 1WF3A 2CXCA 4FUTA 4DR2C 4RM3A 5KYVA 4DG8A 5BR8C 4RLQA 4PROC 1O93A 2JNVA 4R1LA 1T5HX 5T8TA 1TH5A 2D1RA 4LFAC 1WH9A 2D27A 3ETCA 3CW9A 3IMLA 3S82A 5BURA 4WV3A 2ZTBA 4PHTA 1XS3A 1O9TA 1MXCA 2MMAB 3RG2A 3A26A 4B3TC 2P2BA 2QL8A 3E7XA 4IR7A 3EQ6A 4NXNC 4LF8C 3GR1A 5IT9D 1IBMC 4YY3C 3TQIA 4PUGA 3UX2A 5A1GA 4D4GA 2QW0X 1LCIA 3CJEA 4BSZA 2F4VC 1IBLC 3CQ2A 2P2FA 2VSQA 1KKGA 3NPDA 4ISBA 4ZLPA 2PN2A 1VLAA 1V26A 4JM1A 5CZXA 4B3MC 5CZVA 3DHVA 3I08A 4JYAC 1MXAA 3LUSA 2HHHC 1AMUA 3CW8X 4NXMC 4DCTA 4K0BA 4X62C 5AE1A 4AQYC 2P02A 2UXDC 3VNRA 1WCJA 2NCLA 5JRHA 4OXIA 4I9GA 2OBVA 2QVZX 3LGXA 4DV2C 2DYJA 2UUCC 1PG4A 5A1IA 3PESA 1BA3A 3N54B 5H9UA 4JI6C 2CU6A 5E7QA 1HR0C 4JI5C 2JMPA 4DV5C 1YJ7A 4BCAA 4LFBC 2Y4NA 3DAYA 1MDBA 4RM2A 3AF6A 3EERA 5BSTA 3CQ1A 4BC7A 2UUAC 1UWDA 5ADZA 1XNRC 1P7LA 3B7WA 5A19A 4YHHC 3J7AD 4ZJZA 3C5EA 2V7BA 2DPLA 3E7WA 3N2QA 1QM4A 1XRBA 4GXRA 1XRCA 1VEHA 1USPA 1PG3A 4L2ZA 1XMOC 2PROA 4EATA 5IWAC 3T1HC 3IPLA 4JI8C 3R9XA 4PUIA 3FCEA 1N33C 2AYAA 2OO4A 3IEVA 2MM9A 3FM7A 4L4QA 1MKYA 3UOWA 4L7IA 4DV3C 4DR3C 1XHJA 3J81D 5BSMA 1MXBA 4DR4C 3TUFA 2HJGA 4B3RC 4B3SC 2ATWA 3O2EA 2P2QA 1XDXA 4X64C 5GTDA 2PG1E 2ZM6C 3GR0A 4LF7C 2VZEA 4KTTA 4LFCC 1J5EC 1T5DX 1N34C 3A4IA 3IEUA 1M6XC 2QVYX 4DR7C 2QVXX 1JOSA 4G37A 5IFIA 4I9FA 3AF5A 3LNOA 4BBYA 2YCBA 4GXQA 2ONFA 2YX1A 4FTFA 4RMNA 2Y27A 4DR5C 4RVOA 1EGAA 2CY1A 5BSWA 3VNQA 1IBKC 2P2MA 2KZ0A 2YWBA 5K85A 4KTVA 1IB8A 2PT7G 1ULTA 3JAMD 3TR3A 3GKUA 1N2FA 3NYRA 3R9WA 1O92A 1XNQC 2OPLA 2YWCA 2E8CA 4MTNA 3PBKA 1PA4A 4R1MA 5BUSA 4LF6C 1N32C 5LMUC 2E0GA 1FLOA 4OX9C 2VQFC 1FJGC 5BUQA 5DV9A 2D28C 1ML8A 1RG9A 2BJOA 4GKJC 1NY8A 1HNWC 4WS9A 4KHPC 3I07A 2KZFA 5LCIA 4DV1C 5T8SA 5LMNC 3OTOC 1HH2P 2MCQA 5BSUA 4NOZA 5KEIA 4X66C 2UXCC 4LF9C 3ETOA 2XR1A 5A2QD 3L95X 4DR6C 4G36A 2UXBC 3CQ3A 4DCVA 4GKKC 5FLXD 5KYTA 4LF4C 2UUBC 1UKKA 2D1TA 5BSVA 4JI3C 1HNZC 2EGTA 2P20A 1L2FA 1USPB 4DV4C 4U5YD 1RY2A 4FUQA 2M5OA 3FCCA 2ZZMA 2E7GA 4D56A 1M6XA 1P4EC 4HPVA 5BSRA 4D4IA 3A25A 2DHMA 4K0KC 2E5LC 1V60A 1YGTA 1NYEA 4GS5A 3VNSA 1HNXC 4G1IA 2D1QA 1ZB8A 2UU9C 1N36C 4JI7C 1PU1A 4LE5A 3R44A 4JI1C 3TDEA 3UEBA 1MD9A 2ASBA 4RVNA 4XX2A 2Z51A 3SO4A 3AY0A 4JI0C 2ZZNA 2D7VA 2P2JA 3DLPX 3L8CA 1XMQC 4DCUA 4DV0C 3KXWA 3RV2A 4BC9A 4DR1C 1I94C 4R0MA 2Y4OA 4X65C 3H2TA 5AE2A 4OYCA 4DG9A 1LQLA 2OPLB 5AE3A 4NDNA 4PUHA 1MDFA 3LAXA 3NYQA 3NI2A 4TPSB 1ZB9A 4MH4A 2BH1X 5K8FA 4IZ6A 2VQEC 3LNVA 1K0RA 1GPMA 1FUGA 4PZPA 4DUYC 4LF5C 2E8FA 2KDNA 4DV7C 4DV6C 3A9VA 1O90A 3T1YC 1XRAA 4JI4C 3UZ0A 4JV5C 3UX3A 1P4EA 3GPCA 4DCSA 4ODJA 1V25A 2E8EA 3A9UA 4JI2C 2D1SA 1QWIA
chains in the Genus database with same CATH topology
3PROC 2WD9A 4DUZC 2WP0C 3J80D 3G7SA 4RLFA 4D57A 1WF3A 2CXCA 4FUTA 4DR2C 4RM3A 5KYVA 4DG8A 5BR8C 4RLQA 4PROC 1O93A 4R1LA 1T5HX 5T8TA 2D1RA 4LFAC 1WH9A 2D27A 3ETCA 3CW9A 3IMLA 3S82A 5BURA 4WV3A 4PHTA 1O9TA 1MXCA 3RG2A 4B3TC 2P2BA 2QL8A 3E7XA 4IR7A 3EQ6A 4NXNC 4LF8C 3GR1A 5IT9D 1IBMC 4YY3C 3TQIA 5A1GA 4D4GA 2QW0X 1LCIA 3CJEA 4BSZA 2F4VC 1IBLC 2P2FA 2VSQA 1KKGA 3NPDA 4ISBA 4ZLPA 2PN2A 1VLAA 1V26A 4JM1A 5CZXA 4B3MC 5CZVA 3DHVA 3I08A 4JYAC 1MXAA 3LUSA 2HHHC 1AMUA 3CW8X 4NXMC 4DCTA 4K0BA 4X62C 5AE1A 4AQYC 2P02A 2UXDC 3VNRA 5JRHA 4OXIA 4I9GA 2OBVA 2QVZX 3LGXA 4DV2C 2DYJA 2UUCC 1PG4A 5A1IA 3PESA 1BA3A 3N54B 5H9UA 4JI6C 5E7QA 1HR0C 4JI5C 2JMPA 4DV5C 1YJ7A 4BCAA 4LFBC 2Y4NA 3DAYA 1MDBA 4RM2A 3AF6A 3EERA 5BSTA 4BC7A 2UUAC 5ADZA 1XNRC 1P7LA 3B7WA 5A19A 4YHHC 3J7AD 4ZJZA 3C5EA 2V7BA 2DPLA 3E7WA 3N2QA 1QM4A 1XRBA 4GXRA 1XRCA 1USPA 1PG3A 4L2ZA 1XMOC 2PROA 4EATA 5IWAC 3T1HC 3IPLA 4JI8C 3R9XA 3FCEA 1N33C 2AYAA 2OO4A 3IEVA 4L4QA 1MKYA 3UOWA 4L7IA 4DV3C 4DR3C 3J81D 5BSMA 1MXBA 4DR4C 3TUFA 2HJGA 4B3RC 4B3SC 2ATWA 2P2QA 4X64C 5GTDA 2ZM6C 3GR0A 4LF7C 2VZEA 4KTTA 4LFCC 1J5EC 1T5DX 1N34C 3A4IA 3IEUA 2QVYX 4DR7C 2QVXX 1JOSA 4G37A 5IFIA 4I9FA 3AF5A 4BBYA 2YCBA 4GXQA 2ONFA 4FTFA 4RMNA 2Y27A 4DR5C 4RVOA 1EGAA 2CY1A 5BSWA 3VNQA 1IBKC 2P2MA 2YWBA 5K85A 4KTVA 2PT7G 1ULTA 3JAMD 3GKUA 1N2FA 3NYRA 3R9WA 1O92A 1XNQC 2OPLA 2YWCA 2E8CA 4MTNA 3PBKA 1PA4A 4R1MA 5BUSA 4LF6C 1N32C 5LMUC 2E0GA 4OX9C 2VQFC 1FJGC 5BUQA 5DV9A 2D28C 1ML8A 1RG9A 2BJOA 4GKJC 1HNWC 4WS9A 4KHPC 3I07A 2KZFA 4DV1C 5T8SA 5LMNC 3OTOC 1HH2P 5BSUA 4NOZA 5KEIA 4X66C 2UXCC 4LF9C 3ETOA 2XR1A 5A2QD 3L95X 4DR6C 4G36A 2UXBC 4DCVA 4GKKC 5FLXD 5KYTA 4LF4C 2UUBC 1UKKA 2D1TA 5BSVA 4JI3C 1HNZC 2EGTA 2P20A 1L2FA 1USPB 4DV4C 4U5YD 1RY2A 4FUQA 3FCCA 2E7GA 4D56A 4HPVA 5BSRA 4D4IA 4K0KC 2E5LC 1NYEA 4GS5A 3VNSA 1HNXC 4G1IA 2D1QA 1ZB8A 2UU9C 1N36C 4JI7C 4LE5A 3R44A 4JI1C 3TDEA 1MD9A 2ASBA 4RVNA 4XX2A 3SO4A 4JI0C 2D7VA 2P2JA 3DLPX 3L8CA 1XMQC 4DCUA 4DV0C 3KXWA 3RV2A 4BC9A 4DR1C 1I94C 4R0MA 2Y4OA 4X65C 3H2TA 5AE2A 4OYCA 4DG9A 1LQLA 2OPLB 5AE3A 4NDNA 1MDFA 3LAXA 3NYQA 3NI2A 4TPSB 1ZB9A 4MH4A 2BH1X 5K8FA 4IZ6A 2VQEC 3LNVA 1K0RA 1GPMA 1FUGA 4PZPA 4DUYC 4LF5C 2E8FA 4DV7C 4DV6C 3A9VA 1O90A 3T1YC 1XRAA 4JI4C 3UZ0A 4JV5C 3GPCA 4DCSA 4ODJA 1V25A 2E8EA 3A9UA 4JI2C 2D1SA 1QWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK C;  4DUZ C;  4DV2 C;  1NYE A;  2DYJ A;  1HNX C;  2UUC C;  3J80 D;  1ZB8 A;  2UU9 C;  1N36 C;  4JI7 C;  2PT7 G;  3JAM D;  1WF3 A;  2CXC A;  4JI1 C;  4DR2 C;  3GKU A;  4JI6 C;  1N2F A;  1HR0 C;  4JI5 C;  3R9W A;  2JMP A;  4DV5 C;  5BR8 C;  2ASB A;  4LFB C;  1XNQ C;  3AF6 A;  2OPL A;  1EGA A;  3EER A;  4XX2 A;  2UUA C;  2E8C A;  4MTN A;  1PA4 A;  4LF6 C;  1XNR C;  4JI0 C;  1N32 C;  4YHH C;  5LMU C;  3J7A D;  2D7V A;  4OX9 C;  4LFA C;  1WH9 A;  2VQF C;  1FJG C;  1XMQ C;  1ML8 A;  2BJO A;  4DCU A;  4GKJ C;  4DV0 C;  1HNW C;  1USP A;  3I07 A;  4KHP C;  4DR1 C;  1XMO C;  5IWA C;  3T1H C;  1I94 C;  2KZF A;  4B3T C;  4DV1 C;  4JI8 C;  3R9X A;  4X65 C;  2QL8 A;  1N33 C;  3IEV A;  5LMN C;  3OTO C;  1HH2 P;  1MKY A;  1LQL A;  2OPL B;  4DV3 C;  4DR3 C;  4LF8 C;  4NXN C;  3J81 D;  4NOZ A;  5IT9 D;  1IBM C;  4YY3 C;  4X66 C;  4DR4 C;  2UXC C;  4LF9 C;  2HJG A;  4B3R C;  2XR1 A;  5A2Q D;  4B3S C;  1ZB9 A;  3CJE A;  2ATW A;  4MH4 A;  4BSZ A;  2F4V C;  4DR6 C;  4X64 C;  1IBL C;  2UXB C;  4DCV A;  2ZM6 C;  2VQE C;  4GKK C;  1KKG A;  5FLX D;  4LF4 C;  4LF7 C;  4LFC C;  2UUB C;  1K0R A;  2PN2 A;  1VLA A;  1UKK A;  1J5E C;  1N34 C;  4JI3 C;  1HNZ C;  2EGT A;  1USP B;  1L2F A;  4DUY C;  4DV4 C;  4LF5 C;  3IEU A;  2E8F A;  4B3M C;  4DV7 C;  4DV6 C;  2E7G A;  4DR7 C;  3T1Y C;  4JI4 C;  1JOS A;  4JYA C;  4JV5 C;  3LUS A;  2HHH C;  3AF5 A;  4DCT A;  4NXM C;  4DCS A;  4X62 C;  2YCB A;  4AQY C;  2UXD C;  2ONF A;  2E8E A;  4K0K C;  2E5L C;  4DR5 C;  4JI2 C;  2CY1 A;  1QWI A; 
#chains in the Genus database with same CATH topology
 3PRO C;  2WD9 A;  2M5H A;  4DUZ C;  2WP0 C;  3J80 D;  3G7S A;  4RLF A;  3K6R A;  4D57 A;  1WF3 A;  2CXC A;  4FUT A;  4DR2 C;  4RM3 A;  5KYV A;  4DG8 A;  5BR8 C;  4RLQ A;  4PRO C;  1O93 A;  2JNV A;  4R1L A;  1T5H X;  5T8T A;  1TH5 A;  2D1R A;  4LFA C;  1WH9 A;  2D27 A;  3ETC A;  3CW9 A;  3IML A;  3S82 A;  5BUR A;  4WV3 A;  2ZTB A;  4PHT A;  1XS3 A;  1O9T A;  1MXC A;  2MMA B;  3RG2 A;  3A26 A;  4B3T C;  2P2B A;  2QL8 A;  3E7X A;  4IR7 A;  3EQ6 A;  4NXN C;  4LF8 C;  3GR1 A;  5IT9 D;  1IBM C;  4YY3 C;  3TQI A;  4PUG A;  3UX2 A;  5A1G A;  4D4G A;  2QW0 X;  1LCI A;  3CJE A;  4BSZ A;  2F4V C;  1IBL C;  3CQ2 A;  2P2F A;  2VSQ A;  1KKG A;  3NPD A;  4ISB A;  4ZLP A;  2PN2 A;  1VLA A;  1V26 A;  4JM1 A;  5CZX A;  4B3M C;  5CZV A;  3DHV A;  3I08 A;  4JYA C;  1MXA A;  3LUS A;  2HHH C;  1AMU A;  3CW8 X;  4NXM C;  4DCT A;  4K0B A;  4X62 C;  5AE1 A;  4AQY C;  2P02 A;  2UXD C;  3VNR A;  1WCJ A;  2NCL A;  5JRH A;  4OXI A;  4I9G A;  2OBV A;  2QVZ X;  3LGX A;  4DV2 C;  2DYJ A;  2UUC C;  1PG4 A;  5A1I A;  3PES A;  1BA3 A;  3N54 B;  5H9U A;  4JI6 C;  2CU6 A;  5E7Q A;  1HR0 C;  4JI5 C;  2JMP A;  4DV5 C;  1YJ7 A;  4BCA A;  4LFB C;  2Y4N A;  3DAY A;  1MDB A;  4RM2 A;  3AF6 A;  3EER A;  5BST A;  3CQ1 A;  4BC7 A;  2UUA C;  1UWD A;  5ADZ A;  1XNR C;  1P7L A;  3B7W A;  5A19 A;  4YHH C;  3J7A D;  4ZJZ A;  3C5E A;  2V7B A;  2DPL A;  3E7W A;  3N2Q A;  1QM4 A;  1XRB A;  4GXR A;  1XRC A;  1VEH A;  1USP A;  1PG3 A;  4L2Z A;  1XMO C;  2PRO A;  4EAT A;  5IWA C;  3T1H C;  3IPL A;  4JI8 C;  3R9X A;  4PUI A;  3FCE A;  1N33 C;  2AYA A;  2OO4 A;  3IEV A;  2MM9 A;  3FM7 A;  4L4Q A;  1MKY A;  3UOW A;  4L7I A;  4DV3 C;  4DR3 C;  1XHJ A;  3J81 D;  5BSM A;  1MXB A;  4DR4 C;  3TUF A;  2HJG A;  4B3R C;  4B3S C;  2ATW A;  3O2E A;  2P2Q A;  1XDX A;  4X64 C;  5GTD A;  2PG1 E;  2ZM6 C;  3GR0 A;  4LF7 C;  2VZE A;  4KTT A;  4LFC C;  1J5E C;  1T5D X;  1N34 C;  3A4I A;  3IEU A;  1M6X C;  2QVY X;  4DR7 C;  2QVX X;  1JOS A;  4G37 A;  5IFI A;  4I9F A;  3AF5 A;  3LNO A;  4BBY A;  2YCB A;  4GXQ A;  2ONF A;  2YX1 A;  4FTF A;  4RMN A;  2Y27 A;  4DR5 C;  4RVO A;  1EGA A;  2CY1 A;  5BSW A;  3VNQ A;  1IBK C;  2P2M A;  2KZ0 A;  2YWB A;  5K85 A;  4KTV A;  1IB8 A;  2PT7 G;  1ULT A;  3JAM D;  3TR3 A;  3GKU A;  1N2F A;  3NYR A;  3R9W A;  1O92 A;  1XNQ C;  2OPL A;  2YWC A;  2E8C A;  4MTN A;  3PBK A;  1PA4 A;  4R1M A;  5BUS A;  4LF6 C;  1N32 C;  5LMU C;  2E0G A;  1FLO A;  4OX9 C;  2VQF C;  1FJG C;  5BUQ A;  5DV9 A;  2D28 C;  1ML8 A;  1RG9 A;  2BJO A;  4GKJ C;  1NY8 A;  1HNW C;  4WS9 A;  4KHP C;  3I07 A;  2KZF A;  5LCI A;  4DV1 C;  5T8S A;  5LMN C;  3OTO C;  1HH2 P;  2MCQ A;  5BSU A;  4NOZ A;  5KEI A;  4X66 C;  2UXC C;  4LF9 C;  3ETO A;  2XR1 A;  5A2Q D;  3L95 X;  4DR6 C;  4G36 A;  2UXB C;  3CQ3 A;  4DCV A;  4GKK C;  5FLX D;  5KYT A;  4LF4 C;  2UUB C;  1UKK A;  2D1T A;  5BSV A;  4JI3 C;  1HNZ C;  2EGT A;  2P20 A;  1L2F A;  1USP B;  4DV4 C;  4U5Y D;  1RY2 A;  4FUQ A;  2M5O A;  3FCC A;  2ZZM A;  2E7G A;  4D56 A;  1M6X A;  1P4E C;  4HPV A;  5BSR A;  4D4I A;  3A25 A;  2DHM A;  4K0K C;  2E5L C;  1V60 A;  1YGT A;  1NYE A;  4GS5 A;  3VNS A;  1HNX C;  4G1I A;  2D1Q A;  1ZB8 A;  2UU9 C;  1N36 C;  4JI7 C;  1PU1 A;  4LE5 A;  3R44 A;  4JI1 C;  3TDE A;  3UEB A;  1MD9 A;  2ASB A;  4RVN A;  4XX2 A;  2Z51 A;  3SO4 A;  3AY0 A;  4JI0 C;  2ZZN A;  2D7V A;  2P2J A;  3DLP X;  3L8C A;  1XMQ C;  4DCU A;  4DV0 C;  3KXW A;  3RV2 A;  4BC9 A;  4DR1 C;  1I94 C;  4R0M A;  2Y4O A;  4X65 C;  3H2T A;  5AE2 A;  4OYC A;  4DG9 A;  1LQL A;  2OPL B;  5AE3 A;  4NDN A;  4PUH A;  1MDF A;  3LAX A;  3NYQ A;  3NI2 A;  4TPS B;  1ZB9 A;  4MH4 A;  2BH1 X;  5K8F A;  4IZ6 A;  2VQE C;  3LNV A;  1K0R A;  1GPM A;  1FUG A;  4PZP A;  4DUY C;  4LF5 C;  2E8F A;  2KDN A;  4DV7 C;  4DV6 C;  3A9V A;  1O90 A;  3T1Y C;  1XRA A;  4JI4 C;  3UZ0 A;  4JV5 C;  3UX3 A;  1P4E A;  3GPC A;  4DCS A;  4ODJ A;  1V25 A;  2E8E A;  3A9U A;  4JI2 C;  2D1S A;  1QWI A; 
#chains in the Genus database with same CATH homology
 3PRO C;  2WD9 A;  4DUZ C;  2WP0 C;  3J80 D;  3G7S A;  4RLF A;  4D57 A;  1WF3 A;  2CXC A;  4FUT A;  4DR2 C;  4RM3 A;  5KYV A;  4DG8 A;  5BR8 C;  4RLQ A;  4PRO C;  1O93 A;  4R1L A;  1T5H X;  5T8T A;  2D1R A;  4LFA C;  1WH9 A;  2D27 A;  3ETC A;  3CW9 A;  3IML A;  3S82 A;  5BUR A;  4WV3 A;  4PHT A;  1O9T A;  1MXC A;  3RG2 A;  4B3T C;  2P2B A;  2QL8 A;  3E7X A;  4IR7 A;  3EQ6 A;  4NXN C;  4LF8 C;  3GR1 A;  5IT9 D;  1IBM C;  4YY3 C;  3TQI A;  5A1G A;  4D4G A;  2QW0 X;  1LCI A;  3CJE A;  4BSZ A;  2F4V C;  1IBL C;  2P2F A;  2VSQ A;  1KKG A;  3NPD A;  4ISB A;  4ZLP A;  2PN2 A;  1VLA A;  1V26 A;  4JM1 A;  5CZX A;  4B3M C;  5CZV A;  3DHV A;  3I08 A;  4JYA C;  1MXA A;  3LUS A;  2HHH C;  1AMU A;  3CW8 X;  4NXM C;  4DCT A;  4K0B A;  4X62 C;  5AE1 A;  4AQY C;  2P02 A;  2UXD C;  3VNR A;  5JRH A;  4OXI A;  4I9G A;  2OBV A;  2QVZ X;  3LGX A;  4DV2 C;  2DYJ A;  2UUC C;  1PG4 A;  5A1I A;  3PES A;  1BA3 A;  3N54 B;  5H9U A;  4JI6 C;  5E7Q A;  1HR0 C;  4JI5 C;  2JMP A;  4DV5 C;  1YJ7 A;  4BCA A;  4LFB C;  2Y4N A;  3DAY A;  1MDB A;  4RM2 A;  3AF6 A;  3EER A;  5BST A;  4BC7 A;  2UUA C;  5ADZ A;  1XNR C;  1P7L A;  3B7W A;  5A19 A;  4YHH C;  3J7A D;  4ZJZ A;  3C5E A;  2V7B A;  2DPL A;  3E7W A;  3N2Q A;  1QM4 A;  1XRB A;  4GXR A;  1XRC A;  1USP A;  1PG3 A;  4L2Z A;  1XMO C;  2PRO A;  4EAT A;  5IWA C;  3T1H C;  3IPL A;  4JI8 C;  3R9X A;  3FCE A;  1N33 C;  2AYA A;  2OO4 A;  3IEV A;  4L4Q A;  1MKY A;  3UOW A;  4L7I A;  4DV3 C;  4DR3 C;  3J81 D;  5BSM A;  1MXB A;  4DR4 C;  3TUF A;  2HJG A;  4B3R C;  4B3S C;  2ATW A;  2P2Q A;  4X64 C;  5GTD A;  2ZM6 C;  3GR0 A;  4LF7 C;  2VZE A;  4KTT A;  4LFC C;  1J5E C;  1T5D X;  1N34 C;  3A4I A;  3IEU A;  2QVY X;  4DR7 C;  2QVX X;  1JOS A;  4G37 A;  5IFI A;  4I9F A;  3AF5 A;  4BBY A;  2YCB A;  4GXQ A;  2ONF A;  4FTF A;  4RMN A;  2Y27 A;  4DR5 C;  4RVO A;  1EGA A;  2CY1 A;  5BSW A;  3VNQ A;  1IBK C;  2P2M A;  2YWB A;  5K85 A;  4KTV A;  2PT7 G;  1ULT A;  3JAM D;  3GKU A;  1N2F A;  3NYR A;  3R9W A;  1O92 A;  1XNQ C;  2OPL A;  2YWC A;  2E8C A;  4MTN A;  3PBK A;  1PA4 A;  4R1M A;  5BUS A;  4LF6 C;  1N32 C;  5LMU C;  2E0G A;  4OX9 C;  2VQF C;  1FJG C;  5BUQ A;  5DV9 A;  2D28 C;  1ML8 A;  1RG9 A;  2BJO A;  4GKJ C;  1HNW C;  4WS9 A;  4KHP C;  3I07 A;  2KZF A;  4DV1 C;  5T8S A;  5LMN C;  3OTO C;  1HH2 P;  5BSU A;  4NOZ A;  5KEI A;  4X66 C;  2UXC C;  4LF9 C;  3ETO A;  2XR1 A;  5A2Q D;  3L95 X;  4DR6 C;  4G36 A;  2UXB C;  4DCV A;  4GKK C;  5FLX D;  5KYT A;  4LF4 C;  2UUB C;  1UKK A;  2D1T A;  5BSV A;  4JI3 C;  1HNZ C;  2EGT A;  2P20 A;  1L2F A;  1USP B;  4DV4 C;  4U5Y D;  1RY2 A;  4FUQ A;  3FCC A;  2E7G A;  4D56 A;  4HPV A;  5BSR A;  4D4I A;  4K0K C;  2E5L C;  1NYE A;  4GS5 A;  3VNS A;  1HNX C;  4G1I A;  2D1Q A;  1ZB8 A;  2UU9 C;  1N36 C;  4JI7 C;  4LE5 A;  3R44 A;  4JI1 C;  3TDE A;  1MD9 A;  2ASB A;  4RVN A;  4XX2 A;  3SO4 A;  4JI0 C;  2D7V A;  2P2J A;  3DLP X;  3L8C A;  1XMQ C;  4DCU A;  4DV0 C;  3KXW A;  3RV2 A;  4BC9 A;  4DR1 C;  1I94 C;  4R0M A;  2Y4O A;  4X65 C;  3H2T A;  5AE2 A;  4OYC A;  4DG9 A;  1LQL A;  2OPL B;  5AE3 A;  4NDN A;  1MDF A;  3LAX A;  3NYQ A;  3NI2 A;  4TPS B;  1ZB9 A;  4MH4 A;  2BH1 X;  5K8F A;  4IZ6 A;  2VQE C;  3LNV A;  1K0R A;  1GPM A;  1FUG A;  4PZP A;  4DUY C;  4LF5 C;  2E8F A;  4DV7 C;  4DV6 C;  3A9V A;  1O90 A;  3T1Y C;  1XRA A;  4JI4 C;  3UZ0 A;  4JV5 C;  3GPC A;  4DCS A;  4ODJ A;  1V25 A;  2E8E A;  3A9U A;  4JI2 C;  2D1S A;  1QWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...