4JI2C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji2C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji2C02
1IBMC 4X62C 1USPB 2PN2A 2VQEC 4NXMC 5IWAC 1HH2P 3J7AD 4AQYC 2ONFA 3EERA 1HNWC 1K0RA 2UUAC 2VQFC 1N33C 1LQLA 4DUYC 4LF9C 2DYJA 5IT9D 3IEVA 4JI3C 1MKYA 1PA4A 1ZB9A 1J5EC 4BSZA 4LF7C 4LF6C 3I07A 2JMPA 2OPLB 4DR2C 4JV5C 3IEUA 1N32C 2PT7G 4JI0C 3JAMD 3AF6A 2E5LC 1XNQC 4JI5C 4LFCC 4NXNC 4YY3C 4OX9C 4K0KC 2QL8A 1ML8A 2UU9C 3CJEA 1HNZC 4DUZC 2XR1A 4X64C 1FJGC 4X66C 3GKUA 1XMQC 1UKKA 4DV6C 3R9XA 4DR7C 5FLXD 4JI6C 1I94C 1ZB8A 1WF3A 1N36C 1XNRC 4DV1C 3R9WA 4B3RC 1NYEA 4LFAC 4DV3C 5LMNC 2UXBC 3OTOC 2E7GA 3J80D 1N34C 4DR3C 2E8EA 4DCVA 2F4VC 4DR6C 4DR4C 2E8FA 4LFBC 4JYAC 4GKKC 1VLAA 1IBLC 1N2FA 5LMUC 3J81D 4DV7C 5A2QD 4LF8C 1EGAA 4DCSA 4DV2C 1USPA 1QWIA 4YHHC 2YCBA 4KHPC 4JI8C 4MTNA 2CY1A 1HNXC 4DCTA 4DCUA 4XX2A 4DR5C 2CXCA 3T1HC 4JI4C 4LF4C 5BR8C 4B3TC 2UXCC 3LUSA 1KKGA 2BJOA 2ATWA 4X65C 4JI2C 2UUCC 1HR0C 2ZM6C 4JI1C 2UUBC 4NOZA 4GKJC 2D7VA 2OPLA 4LF5C 4DV0C 2UXDC 2HJGA 2ASBA 1XMOC 4MH4A 1JOSA 4DR1C 4JI7C 2EGTA 4DV5C 1L2FA 4B3MC 1WH9A 4DV4C 1IBKC 3AF5A 2HHHC 4B3SC 2KZFA 3T1YC 2E8CA
chains in the Genus database with same CATH superfamily
2D1QA 5H9UA 1O90A 2D27A 4X62C 2VQEC 4BBYA 4ISBA 2JNVA 4AQYC 3ETCA 3DAYA 2Y4NA 5BUQA 3VNSA 2Y27A 1N33C 5IT9D 3IEVA 3A9VA 4JI3C 1PA4A 1J5EC 4PZPA 1WCJA 2E0GA 3I07A 4I9GA 3JAMD 3CQ2A 4BCAA 1XNQC 4JI5C 4LFCC 3CW8X 4PUGA 4OX9C 5ADZA 4WV3A 4G37A 4GXQA 4WS9A 2XR1A 4X64C 5JRHA 1XRAA 4DV6C 1PG3A 4DR7C 2M5OA 4R0MA 1I94C 1VEHA 4K0BA 5T8SA 3K6RA 1XNRC 5BSVA 4RVOA 5LMNC 2QVZX 2OBVA 4KTTA 4DR3C 3A4IA 3IPLA 3TUFA 2F4VC 4DR6C 4DR4C 2Z51A 4PUHA 5LMUC 2QW0X 4DV7C 4U5YD 2VZEA 4DCSA 1USPA 3RG2A 4D56A 1RY2A 2P2FA 4MTNA 3DLPX 3VNRA 3C5EA 4R1LA 4EATA 1XDXA 4DR5C 3T1HC 5E7QA 2UXCC 4JM1A 2QVXX 1HR0C 3UEBA 4NOZA 3L95X 4LF5C 1IB8A 3NI2A 3FCCA 3UZ0A 4DR1C 5BSWA 2EGTA 2OO4A 2DHMA 1LCIA 4B3SC 2KZFA 3T1YC 3PROC 2DPLA 5IFIA 2ZZNA 2PN2A 5LCIA 1BA3A 4NXMC 5IWAC 2KZ0A 3O2EA 2VQFC 1LQLA 4LF9C 1V60A 5A1GA 4ODJA 1MXAA 4L4QA 3N54B 4BSZA 1V25A 4R1MA 4LE5A 4LF6C 3CQ3A 2OPLB 1N32C 3IEUA 1UWDA 3A26A 4RLFA 3AF6A 3GPCA 5BSRA 4NXNC 2PG1E 1MXBA 2UU9C 4L7IA 4I9FA 4RVNA 3VNQA 3GKUA 1UKKA 3E7WA 3CW9A 3R9XA 5BSUA 1XRCA 3RV2A 5GTDA 2MM9A 3SO4A 4LFAC 4RM3A 1MD9A 3A9UA 3OTOC 3J80D 3AY0A 3H2TA 1N34C 3PBKA 1ULTA 1IBLC 1N2FA 1M6XA 2MMAB 1V26A 5A2QD 2P02A 4PUIA 3B7WA 2KDNA 3FM7A 5AE1A 2CY1A 1P4EA 4DCTA 1XS3A 5KEIA 4IR7A 4DCUA 4XX2A 4JI4C 5BR8C 4PROC 4B3TC 2PROA 1KKGA 1O92A 2UUBC 2D7VA 3DHVA 4DV0C 2ASBA 4MH4A 1AMUA 4JI7C 1T5DX 1L2FA 1WH9A 3CQ1A 3UOWA 3S82A 1RG9A 3TQIA 3UX3A 2AYAA 1USPB 1HH2P 3J7AD 3EERA 1FLOA 4FUTA 1K0RA 1MXCA 4DUYC 1MKYA 3NPDA 4RM2A 4D57A 5T8TA 3EQ6A 4RMNA 4D4IA 5KYVA 2VSQA 4FTFA 1GPMA 2QL8A 1ML8A 5CZVA 1HNZC 4DUZC 1O9TA 1FJGC 4OXIA 4X66C 4ZJZA 1XMQC 1NY8A 4NDNA 3IMLA 1WF3A 4B3RC 4DV1C 1NYEA 1PU1A 5K85A 2WD9A 4IZ6A 2UXBC 2E7GA 2ZZMA 4DG8A 1TH5A 4LFBC 3R44A 4GKKC 2P20A 3G7SA 2P2JA 4LF8C 1EGAA 2ZTBA 2P2QA 1QWIA 1P7LA 4G36A 2YX1A 4BC9A 3KXWA 1HNXC 4BC7A 2CXCA 4LF4C 1FUGA 1YGTA 1O93A 3LUSA 2BJOA 5CZXA 4X65C 2ATWA 4JI2C 2UUCC 4GKJC 5BSTA 3LGXA 2ZM6C 4JI1C 2WP0C 2HJGA 4DG9A 2CU6A 1PG4A 4B3MC 4DV5C 2M5HA 2HHHC 3E7XA 3TR3A 2E8CA 1IBMC 2Y4OA 2YWBA 2ONFA 1YJ7A 1HNWC 5KYTA 2DYJA 3L8CA 1ZB9A 1T5HX 4GXRA 3NYRA 4LF7C 5A19A 2JMPA 3NYQA 4DR2C 4JV5C 4HPVA 2P2MA 2PT7G 4JI0C 4G1IA 4KTVA 2E5LC 3I08A 2D1TA 4OYCA 3FCEA 2MCQA 4K0KC 4YY3C 3CJEA 5BURA 1XHJA 5FLXD 3ETOA 4JI6C 1ZB8A 2QVYX 1XRBA 2D1RA 1N36C 5DV9A 3TDEA 4GS5A 3R9WA 5AE3A 2NCLA 5A1IA 4DV3C 5BSMA 2D1SA 2E8EA 5AE2A 4DCVA 4D4GA 3LNVA 2E8FA 3UX2A 4JYAC 1VLAA 4ZLPA 3J81D 5BUSA 4L2ZA 4DV2C 3PESA 1M6XC 2P2BA 4YHHC 2V7BA 2YCBA 3GR0A 2D28C 4KHPC 4JI8C 3LNOA 4FUQA 1MDBA 4TPSB 3N2QA 3GR1A 1P4EC 1QM4A 2OPLA 4RLQA 2UXDC 1MDFA 1XMOC 1JOSA 4PHTA 3A25A 5K8FA 4DV4C 1IBKC 3AF5A 2YWCA 3LAXA 2BH1X 2UUAC
chains in the Genus database with same CATH topology
2D1QA 5H9UA 1O90A 2D27A 4X62C 2VQEC 4BBYA 4ISBA 4AQYC 3ETCA 3DAYA 2Y4NA 5BUQA 3VNSA 2Y27A 1N33C 5IT9D 3IEVA 3A9VA 4JI3C 1PA4A 1J5EC 4PZPA 2E0GA 3I07A 4I9GA 3JAMD 1XNQC 4BCAA 4JI5C 4LFCC 3CW8X 4OX9C 5ADZA 4WV3A 4G37A 4GXQA 4WS9A 2XR1A 4X64C 5JRHA 1XRAA 4DV6C 1PG3A 4DR7C 4R0MA 1I94C 4K0BA 5T8SA 1XNRC 5BSVA 4RVOA 5LMNC 2QVZX 2OBVA 4KTTA 4DR3C 3A4IA 3IPLA 3TUFA 2F4VC 4DR6C 4DR4C 5LMUC 2QW0X 4DV7C 4U5YD 2VZEA 4DCSA 1USPA 3RG2A 4D56A 1RY2A 2P2FA 4MTNA 3DLPX 3VNRA 3C5EA 4R1LA 4EATA 4DR5C 3T1HC 5E7QA 2UXCC 4JM1A 2QVXX 1HR0C 4NOZA 3L95X 4LF5C 3NI2A 3FCCA 3UZ0A 4DR1C 5BSWA 2EGTA 2OO4A 1LCIA 4B3SC 2KZFA 3T1YC 3PROC 2DPLA 5IFIA 2PN2A 1BA3A 4NXMC 5IWAC 2VQFC 1LQLA 4LF9C 5A1GA 4ODJA 1MXAA 4L4QA 3N54B 4BSZA 1V25A 4R1MA 4LE5A 4LF6C 2OPLB 1N32C 3IEUA 4RLFA 3AF6A 3GPCA 5BSRA 4NXNC 1MXBA 2UU9C 4L7IA 4I9FA 4RVNA 3VNQA 3GKUA 1UKKA 3E7WA 3CW9A 3R9XA 5BSUA 1XRCA 3RV2A 5GTDA 3SO4A 4LFAC 4RM3A 1MD9A 3A9UA 3OTOC 3J80D 1N34C 3H2TA 3PBKA 1ULTA 1IBLC 1N2FA 1V26A 5A2QD 2P02A 3B7WA 5AE1A 2CY1A 4DCTA 5KEIA 4IR7A 4DCUA 4XX2A 4JI4C 5BR8C 4PROC 4B3TC 2PROA 1KKGA 1O92A 2UUBC 2D7VA 3DHVA 4DV0C 2ASBA 4MH4A 1AMUA 4JI7C 1T5DX 1L2FA 1WH9A 3UOWA 3S82A 1RG9A 3TQIA 2AYAA 1USPB 1HH2P 3J7AD 3EERA 4FUTA 1K0RA 1MXCA 4DUYC 1MKYA 3NPDA 4RM2A 4D57A 5T8TA 3EQ6A 4RMNA 4D4IA 5KYVA 2VSQA 4FTFA 1GPMA 2QL8A 1ML8A 5CZVA 1HNZC 4DUZC 1O9TA 1FJGC 4OXIA 4X66C 4ZJZA 1XMQC 4NDNA 3IMLA 1WF3A 4B3RC 4DV1C 1NYEA 5K85A 2WD9A 4IZ6A 2UXBC 2E7GA 4DG8A 4LFBC 3R44A 4GKKC 2P20A 3G7SA 2P2JA 4LF8C 1EGAA 2P2QA 1QWIA 1P7LA 4G36A 4BC9A 3KXWA 1HNXC 4BC7A 2CXCA 4LF4C 1FUGA 1O93A 3LUSA 2BJOA 5CZXA 4X65C 2ATWA 4JI2C 2UUCC 4GKJC 5BSTA 3LGXA 2ZM6C 4JI1C 2WP0C 2HJGA 4DG9A 1PG4A 4B3MC 4DV5C 2HHHC 3E7XA 2E8CA 1IBMC 2Y4OA 2YWBA 2ONFA 1YJ7A 1HNWC 5KYTA 2DYJA 3L8CA 1ZB9A 1T5HX 4GXRA 3NYRA 4LF7C 5A19A 2JMPA 3NYQA 4DR2C 4JV5C 4HPVA 2P2MA 2PT7G 4JI0C 4G1IA 4KTVA 2E5LC 3I08A 2D1TA 4OYCA 3FCEA 4K0KC 4YY3C 3CJEA 5BURA 5FLXD 3ETOA 4JI6C 1ZB8A 2QVYX 1XRBA 2D1RA 1N36C 5DV9A 3TDEA 4GS5A 3R9WA 5AE3A 5A1IA 4DV3C 5BSMA 2D1SA 2E8EA 5AE2A 4DCVA 4D4GA 3LNVA 2E8FA 4JYAC 1VLAA 4ZLPA 3J81D 5BUSA 4L2ZA 4DV2C 3PESA 2P2BA 4YHHC 2V7BA 2YCBA 3GR0A 2D28C 4KHPC 4JI8C 4FUQA 1MDBA 4TPSB 3N2QA 3GR1A 1QM4A 2OPLA 4RLQA 2UXDC 1MDFA 1XMOC 1JOSA 4PHTA 5K8FA 4DV4C 1IBKC 3AF5A 2YWCA 3LAXA 2BH1X 2UUAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM C;  4X62 C;  1USP B;  2PN2 A;  2VQE C;  4NXM C;  5IWA C;  1HH2 P;  3J7A D;  4AQY C;  2ONF A;  3EER A;  1HNW C;  1K0R A;  2UUA C;  2VQF C;  1N33 C;  1LQL A;  4DUY C;  4LF9 C;  2DYJ A;  5IT9 D;  3IEV A;  4JI3 C;  1MKY A;  1PA4 A;  1ZB9 A;  1J5E C;  4BSZ A;  4LF7 C;  4LF6 C;  3I07 A;  2JMP A;  2OPL B;  4DR2 C;  4JV5 C;  3IEU A;  1N32 C;  2PT7 G;  4JI0 C;  3JAM D;  3AF6 A;  2E5L C;  1XNQ C;  4JI5 C;  4LFC C;  4NXN C;  4YY3 C;  4OX9 C;  4K0K C;  2QL8 A;  1ML8 A;  2UU9 C;  3CJE A;  1HNZ C;  4DUZ C;  2XR1 A;  4X64 C;  1FJG C;  4X66 C;  3GKU A;  1XMQ C;  1UKK A;  4DV6 C;  3R9X A;  4DR7 C;  5FLX D;  4JI6 C;  1I94 C;  1ZB8 A;  1WF3 A;  1N36 C;  1XNR C;  4DV1 C;  3R9W A;  4B3R C;  1NYE A;  4LFA C;  4DV3 C;  5LMN C;  2UXB C;  3OTO C;  2E7G A;  3J80 D;  1N34 C;  4DR3 C;  2E8E A;  4DCV A;  2F4V C;  4DR6 C;  4DR4 C;  2E8F A;  4LFB C;  4JYA C;  4GKK C;  1VLA A;  1IBL C;  1N2F A;  5LMU C;  3J81 D;  4DV7 C;  5A2Q D;  4LF8 C;  1EGA A;  4DCS A;  4DV2 C;  1USP A;  1QWI A;  4YHH C;  2YCB A;  4KHP C;  4JI8 C;  4MTN A;  2CY1 A;  1HNX C;  4DCT A;  4DCU A;  4XX2 A;  4DR5 C;  2CXC A;  3T1H C;  4JI4 C;  4LF4 C;  5BR8 C;  4B3T C;  2UXC C;  3LUS A;  1KKG A;  2BJO A;  2ATW A;  4X65 C;  4JI2 C;  2UUC C;  1HR0 C;  2ZM6 C;  4JI1 C;  2UUB C;  4NOZ A;  4GKJ C;  2D7V A;  2OPL A;  4LF5 C;  4DV0 C;  2UXD C;  2HJG A;  2ASB A;  1XMO C;  4MH4 A;  1JOS A;  4DR1 C;  4JI7 C;  2EGT A;  4DV5 C;  1L2F A;  4B3M C;  1WH9 A;  4DV4 C;  1IBK C;  3AF5 A;  2HHH C;  4B3S C;  2KZF A;  3T1Y C;  2E8C A; 
#chains in the Genus database with same CATH topology
 2D1Q A;  5H9U A;  1O90 A;  2D27 A;  4X62 C;  2VQE C;  4BBY A;  4ISB A;  2JNV A;  4AQY C;  3ETC A;  3DAY A;  2Y4N A;  5BUQ A;  3VNS A;  2Y27 A;  1N33 C;  5IT9 D;  3IEV A;  3A9V A;  4JI3 C;  1PA4 A;  1J5E C;  4PZP A;  1WCJ A;  2E0G A;  3I07 A;  4I9G A;  3JAM D;  3CQ2 A;  4BCA A;  1XNQ C;  4JI5 C;  4LFC C;  3CW8 X;  4PUG A;  4OX9 C;  5ADZ A;  4WV3 A;  4G37 A;  4GXQ A;  4WS9 A;  2XR1 A;  4X64 C;  5JRH A;  1XRA A;  4DV6 C;  1PG3 A;  4DR7 C;  2M5O A;  4R0M A;  1I94 C;  1VEH A;  4K0B A;  5T8S A;  3K6R A;  1XNR C;  5BSV A;  4RVO A;  5LMN C;  2QVZ X;  2OBV A;  4KTT A;  4DR3 C;  3A4I A;  3IPL A;  3TUF A;  2F4V C;  4DR6 C;  4DR4 C;  2Z51 A;  4PUH A;  5LMU C;  2QW0 X;  4DV7 C;  4U5Y D;  2VZE A;  4DCS A;  1USP A;  3RG2 A;  4D56 A;  1RY2 A;  2P2F A;  4MTN A;  3DLP X;  3VNR A;  3C5E A;  4R1L A;  4EAT A;  1XDX A;  4DR5 C;  3T1H C;  5E7Q A;  2UXC C;  4JM1 A;  2QVX X;  1HR0 C;  3UEB A;  4NOZ A;  3L95 X;  4LF5 C;  1IB8 A;  3NI2 A;  3FCC A;  3UZ0 A;  4DR1 C;  5BSW A;  2EGT A;  2OO4 A;  2DHM A;  1LCI A;  4B3S C;  2KZF A;  3T1Y C;  3PRO C;  2DPL A;  5IFI A;  2ZZN A;  2PN2 A;  5LCI A;  1BA3 A;  4NXM C;  5IWA C;  2KZ0 A;  3O2E A;  2VQF C;  1LQL A;  4LF9 C;  1V60 A;  5A1G A;  4ODJ A;  1MXA A;  4L4Q A;  3N54 B;  4BSZ A;  1V25 A;  4R1M A;  4LE5 A;  4LF6 C;  3CQ3 A;  2OPL B;  1N32 C;  3IEU A;  1UWD A;  3A26 A;  4RLF A;  3AF6 A;  3GPC A;  5BSR A;  4NXN C;  2PG1 E;  1MXB A;  2UU9 C;  4L7I A;  4I9F A;  4RVN A;  3VNQ A;  3GKU A;  1UKK A;  3E7W A;  3CW9 A;  3R9X A;  5BSU A;  1XRC A;  3RV2 A;  5GTD A;  2MM9 A;  3SO4 A;  4LFA C;  4RM3 A;  1MD9 A;  3A9U A;  3OTO C;  3J80 D;  3AY0 A;  3H2T A;  1N34 C;  3PBK A;  1ULT A;  1IBL C;  1N2F A;  1M6X A;  2MMA B;  1V26 A;  5A2Q D;  2P02 A;  4PUI A;  3B7W A;  2KDN A;  3FM7 A;  5AE1 A;  2CY1 A;  1P4E A;  4DCT A;  1XS3 A;  5KEI A;  4IR7 A;  4DCU A;  4XX2 A;  4JI4 C;  5BR8 C;  4PRO C;  4B3T C;  2PRO A;  1KKG A;  1O92 A;  2UUB C;  2D7V A;  3DHV A;  4DV0 C;  2ASB A;  4MH4 A;  1AMU A;  4JI7 C;  1T5D X;  1L2F A;  1WH9 A;  3CQ1 A;  3UOW A;  3S82 A;  1RG9 A;  3TQI A;  3UX3 A;  2AYA A;  1USP B;  1HH2 P;  3J7A D;  3EER A;  1FLO A;  4FUT A;  1K0R A;  1MXC A;  4DUY C;  1MKY A;  3NPD A;  4RM2 A;  4D57 A;  5T8T A;  3EQ6 A;  4RMN A;  4D4I A;  5KYV A;  2VSQ A;  4FTF A;  1GPM A;  2QL8 A;  1ML8 A;  5CZV A;  1HNZ C;  4DUZ C;  1O9T A;  1FJG C;  4OXI A;  4X66 C;  4ZJZ A;  1XMQ C;  1NY8 A;  4NDN A;  3IML A;  1WF3 A;  4B3R C;  4DV1 C;  1NYE A;  1PU1 A;  5K85 A;  2WD9 A;  4IZ6 A;  2UXB C;  2E7G A;  2ZZM A;  4DG8 A;  1TH5 A;  4LFB C;  3R44 A;  4GKK C;  2P20 A;  3G7S A;  2P2J A;  4LF8 C;  1EGA A;  2ZTB A;  2P2Q A;  1QWI A;  1P7L A;  4G36 A;  2YX1 A;  4BC9 A;  3KXW A;  1HNX C;  4BC7 A;  2CXC A;  4LF4 C;  1FUG A;  1YGT A;  1O93 A;  3LUS A;  2BJO A;  5CZX A;  4X65 C;  2ATW A;  4JI2 C;  2UUC C;  4GKJ C;  5BST A;  3LGX A;  2ZM6 C;  4JI1 C;  2WP0 C;  2HJG A;  4DG9 A;  2CU6 A;  1PG4 A;  4B3M C;  4DV5 C;  2M5H A;  2HHH C;  3E7X A;  3TR3 A;  2E8C A;  1IBM C;  2Y4O A;  2YWB A;  2ONF A;  1YJ7 A;  1HNW C;  5KYT A;  2DYJ A;  3L8C A;  1ZB9 A;  1T5H X;  4GXR A;  3NYR A;  4LF7 C;  5A19 A;  2JMP A;  3NYQ A;  4DR2 C;  4JV5 C;  4HPV A;  2P2M A;  2PT7 G;  4JI0 C;  4G1I A;  4KTV A;  2E5L C;  3I08 A;  2D1T A;  4OYC A;  3FCE A;  2MCQ A;  4K0K C;  4YY3 C;  3CJE A;  5BUR A;  1XHJ A;  5FLX D;  3ETO A;  4JI6 C;  1ZB8 A;  2QVY X;  1XRB A;  2D1R A;  1N36 C;  5DV9 A;  3TDE A;  4GS5 A;  3R9W A;  5AE3 A;  2NCL A;  5A1I A;  4DV3 C;  5BSM A;  2D1S A;  2E8E A;  5AE2 A;  4DCV A;  4D4G A;  3LNV A;  2E8F A;  3UX2 A;  4JYA C;  1VLA A;  4ZLP A;  3J81 D;  5BUS A;  4L2Z A;  4DV2 C;  3PES A;  1M6X C;  2P2B A;  4YHH C;  2V7B A;  2YCB A;  3GR0 A;  2D28 C;  4KHP C;  4JI8 C;  3LNO A;  4FUQ A;  1MDB A;  4TPS B;  3N2Q A;  3GR1 A;  1P4E C;  1QM4 A;  2OPL A;  4RLQ A;  2UXD C;  1MDF A;  1XMO C;  1JOS A;  4PHT A;  3A25 A;  5K8F A;  4DV4 C;  1IBK C;  3AF5 A;  2YWC A;  3LAX A;  2BH1 X;  2UUA C; 
#chains in the Genus database with same CATH homology
 2D1Q A;  5H9U A;  1O90 A;  2D27 A;  4X62 C;  2VQE C;  4BBY A;  4ISB A;  4AQY C;  3ETC A;  3DAY A;  2Y4N A;  5BUQ A;  3VNS A;  2Y27 A;  1N33 C;  5IT9 D;  3IEV A;  3A9V A;  4JI3 C;  1PA4 A;  1J5E C;  4PZP A;  2E0G A;  3I07 A;  4I9G A;  3JAM D;  1XNQ C;  4BCA A;  4JI5 C;  4LFC C;  3CW8 X;  4OX9 C;  5ADZ A;  4WV3 A;  4G37 A;  4GXQ A;  4WS9 A;  2XR1 A;  4X64 C;  5JRH A;  1XRA A;  4DV6 C;  1PG3 A;  4DR7 C;  4R0M A;  1I94 C;  4K0B A;  5T8S A;  1XNR C;  5BSV A;  4RVO A;  5LMN C;  2QVZ X;  2OBV A;  4KTT A;  4DR3 C;  3A4I A;  3IPL A;  3TUF A;  2F4V C;  4DR6 C;  4DR4 C;  5LMU C;  2QW0 X;  4DV7 C;  4U5Y D;  2VZE A;  4DCS A;  1USP A;  3RG2 A;  4D56 A;  1RY2 A;  2P2F A;  4MTN A;  3DLP X;  3VNR A;  3C5E A;  4R1L A;  4EAT A;  4DR5 C;  3T1H C;  5E7Q A;  2UXC C;  4JM1 A;  2QVX X;  1HR0 C;  4NOZ A;  3L95 X;  4LF5 C;  3NI2 A;  3FCC A;  3UZ0 A;  4DR1 C;  5BSW A;  2EGT A;  2OO4 A;  1LCI A;  4B3S C;  2KZF A;  3T1Y C;  3PRO C;  2DPL A;  5IFI A;  2PN2 A;  1BA3 A;  4NXM C;  5IWA C;  2VQF C;  1LQL A;  4LF9 C;  5A1G A;  4ODJ A;  1MXA A;  4L4Q A;  3N54 B;  4BSZ A;  1V25 A;  4R1M A;  4LE5 A;  4LF6 C;  2OPL B;  1N32 C;  3IEU A;  4RLF A;  3AF6 A;  3GPC A;  5BSR A;  4NXN C;  1MXB A;  2UU9 C;  4L7I A;  4I9F A;  4RVN A;  3VNQ A;  3GKU A;  1UKK A;  3E7W A;  3CW9 A;  3R9X A;  5BSU A;  1XRC A;  3RV2 A;  5GTD A;  3SO4 A;  4LFA C;  4RM3 A;  1MD9 A;  3A9U A;  3OTO C;  3J80 D;  1N34 C;  3H2T A;  3PBK A;  1ULT A;  1IBL C;  1N2F A;  1V26 A;  5A2Q D;  2P02 A;  3B7W A;  5AE1 A;  2CY1 A;  4DCT A;  5KEI A;  4IR7 A;  4DCU A;  4XX2 A;  4JI4 C;  5BR8 C;  4PRO C;  4B3T C;  2PRO A;  1KKG A;  1O92 A;  2UUB C;  2D7V A;  3DHV A;  4DV0 C;  2ASB A;  4MH4 A;  1AMU A;  4JI7 C;  1T5D X;  1L2F A;  1WH9 A;  3UOW A;  3S82 A;  1RG9 A;  3TQI A;  2AYA A;  1USP B;  1HH2 P;  3J7A D;  3EER A;  4FUT A;  1K0R A;  1MXC A;  4DUY C;  1MKY A;  3NPD A;  4RM2 A;  4D57 A;  5T8T A;  3EQ6 A;  4RMN A;  4D4I A;  5KYV A;  2VSQ A;  4FTF A;  1GPM A;  2QL8 A;  1ML8 A;  5CZV A;  1HNZ C;  4DUZ C;  1O9T A;  1FJG C;  4OXI A;  4X66 C;  4ZJZ A;  1XMQ C;  4NDN A;  3IML A;  1WF3 A;  4B3R C;  4DV1 C;  1NYE A;  5K85 A;  2WD9 A;  4IZ6 A;  2UXB C;  2E7G A;  4DG8 A;  4LFB C;  3R44 A;  4GKK C;  2P20 A;  3G7S A;  2P2J A;  4LF8 C;  1EGA A;  2P2Q A;  1QWI A;  1P7L A;  4G36 A;  4BC9 A;  3KXW A;  1HNX C;  4BC7 A;  2CXC A;  4LF4 C;  1FUG A;  1O93 A;  3LUS A;  2BJO A;  5CZX A;  4X65 C;  2ATW A;  4JI2 C;  2UUC C;  4GKJ C;  5BST A;  3LGX A;  2ZM6 C;  4JI1 C;  2WP0 C;  2HJG A;  4DG9 A;  1PG4 A;  4B3M C;  4DV5 C;  2HHH C;  3E7X A;  2E8C A;  1IBM C;  2Y4O A;  2YWB A;  2ONF A;  1YJ7 A;  1HNW C;  5KYT A;  2DYJ A;  3L8C A;  1ZB9 A;  1T5H X;  4GXR A;  3NYR A;  4LF7 C;  5A19 A;  2JMP A;  3NYQ A;  4DR2 C;  4JV5 C;  4HPV A;  2P2M A;  2PT7 G;  4JI0 C;  4G1I A;  4KTV A;  2E5L C;  3I08 A;  2D1T A;  4OYC A;  3FCE A;  4K0K C;  4YY3 C;  3CJE A;  5BUR A;  5FLX D;  3ETO A;  4JI6 C;  1ZB8 A;  2QVY X;  1XRB A;  2D1R A;  1N36 C;  5DV9 A;  3TDE A;  4GS5 A;  3R9W A;  5AE3 A;  5A1I A;  4DV3 C;  5BSM A;  2D1S A;  2E8E A;  5AE2 A;  4DCV A;  4D4G A;  3LNV A;  2E8F A;  4JYA C;  1VLA A;  4ZLP A;  3J81 D;  5BUS A;  4L2Z A;  4DV2 C;  3PES A;  2P2B A;  4YHH C;  2V7B A;  2YCB A;  3GR0 A;  2D28 C;  4KHP C;  4JI8 C;  4FUQ A;  1MDB A;  4TPS B;  3N2Q A;  3GR1 A;  1QM4 A;  2OPL A;  4RLQ A;  2UXD C;  1MDF A;  1XMO C;  1JOS A;  4PHT A;  5K8F A;  4DV4 C;  1IBK C;  3AF5 A;  2YWC A;  3LAX A;  2BH1 X;  2UUA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...