4JI2C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji2C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji2C02
2UU9C 4B3RC 4LF9C 3R9XA 1LQLA 1N33C 1MKYA 5FLXD 3T1HC 2F4VC 2PN2A 5IWAC 3I07A 4X66C 3IEVA 1EGAA 2JMPA 3GKUA 4JV5C 5IT9D 3OTOC 3IEUA 4DCVA 1ZB8A 4XX2A 1K0RA 3LUSA 1NYEA 5LMUC 4JI7C 4DR7C 4DV5C 4X62C 1WH9A 4B3TC 2UUCC 4BSZA 4B3MC 2QL8A 1N36C 1I94C 4LF7C 1N32C 4KHPC 2UXCC 4X65C 4LF6C 1WF3A 5LMNC 2E7GA 3AF6A 4JI1C 4JI8C 4X64C 4JI4C 4DV1C 1XMQC 2OPLB 2HJGA 4DR1C 4MTNA 1IBLC 1XNQC 2DYJA 1JOSA 4DV0C 4K0KC 2D7VA 1VLAA 1USPB 1L2FA 3JAMD 1XMOC 4JI0C 3AF5A 4LFCC 4B3SC 1J5EC 4LF8C 1FJGC 2E8EA 1UKKA 2E8FA 1IBMC 3R9WA 1N34C 1HNZC 2ATWA 2UXDC 3J80D 2UUAC 2ZM6C 2ONFA 2BJOA 4DV3C 2CXCA 4YY3C 4LFBC 4DR6C 4NXNC 2E5LC 1HNWC 4NXMC 2VQEC 4DV6C 1QWIA 4DUZC 1USPA 1HNXC 4JI6C 2YCBA 3J7AD 2KZFA 4NOZA 1ML8A 4LF4C 1IBKC 3T1YC 2OPLA 5BR8C 2E8CA 2HHHC 2UXBC 4DV2C 1ZB9A 4DCSA 2PT7G 4LFAC 1HH2P 1KKGA 4DV4C 2EGTA 2UUBC 2CY1A 4GKJC 4YHHC 4JYAC 4DCUA 1N2FA 4MH4A 4JI3C 4OX9C 1HR0C 3CJEA 4GKKC 4DR4C 3J81D 4DUYC 2ASBA 4DR3C 1PA4A 1XNRC 4DR2C 2VQFC 4AQYC 4DR5C 2XR1A 3EERA 4DCTA 4JI2C 4DV7C 4JI5C 4LF5C 5A2QD
chains in the Genus database with same CATH superfamily
5BURA 5A1IA 1N33C 3ETCA 4IR7A 2WD9A 3DAYA 1P7LA 4DG9A 4OXIA 3IEVA 1O93A 2QW0X 3GKUA 3R44A 1T5DX 4XX2A 1K0RA 3LUSA 3UX2A 5LMUC 1WH9A 4B3TC 1PG3A 4B3MC 1MXBA 1I94C 5T8SA 4KHPC 2UXCC 4X65C 3C5EA 1WF3A 1RG9A 2D1QA 3AF6A 2P2BA 4JI1C 5AE1A 3TQIA 2ZZNA 4DR1C 4R1MA 1JOSA 3VNSA 4RLQA 1USPB 4R1LA 5BSMA 3AF5A 4LFCC 2E8EA 4K0BA 1N34C 3NYRA 3J80D 2UUAC 5ADZA 1P4EC 4YY3C 2E5LC 5GTDA 4NXMC 1TH5A 2P2QA 1QWIA 5BSRA 2YCBA 4D4IA 3A26A 3FCEA 3EQ6A 2OPLA 3DHVA 5BR8C 2E8CA 4L7IA 4BC9A 2HHHC 2UXBC 3TR3A 4RM2A 1P4EA 3NI2A 2EGTA 2CY1A 4YHHC 4G37A 5BUSA 2Y4OA 2Y27A 3GR0A 3IMLA 2ASBA 1PA4A 3UEBA 5K85A 2ZTBA 5A2QD 4B3RC 3R9XA 1LQLA 3E7WA 2YWCA 1WCJA 1MKYA 2PROA 2F4VC 3S82A 3N2QA 2M5OA 5IWAC 4OYCA 2P2FA 2P20A 3CW8X 5IT9D 3IEUA 1ZB8A 2P2JA 3A9UA 1NYEA 4JI7C 4DR7C 4DV5C 1LCIA 2UUCC 4I9GA 1N36C 4IZ6A 2D28C 3LAXA 4PROC 5BSWA 2E7GA 5IFIA 1YJ7A 3GPCA 2Y4NA 2OPLB 3GR1A 4L2ZA 4GS5A 2DYJA 1M6XA 3H2TA 1VLAA 1PG4A 2DHMA 1L2FA 3FM7A 2QVZX 4D56A 4JI0C 1MXAA 4B3SC 4LF8C 1FJGC 3VNRA 1IBMC 3R9WA 5BUQA 2UXDC 1M6XC 4DV3C 2QVYX 3TDEA 1O90A 1XRCA 1NY8A 1USPA 4JI6C 2OBVA 3J7AD 1V26A 2PG1E 1ML8A 1VEHA 2D1TA 4PUHA 2QVXX 2MMAB 1ZB9A 2P02A 4DCSA 1HH2P 1KKGA 5CZVA 4KTTA 5AE3A 2D1RA 4GKJC 4JM1A 3DLPX 4DCUA 1N2FA 3L95X 2E0GA 1V60A 3J81D 5LCIA 4DR3C 1XNRC 4DG8A 2XR1A 3EERA 4DCTA 4BC7A 2WP0C 4DV7C 4I9FA 2UU9C 4LF9C 4RVOA 2PN2A 3CQ2A 4D4GA 4G1IA 2D27A 3I07A 4X66C 1O92A 5AE2A 3CQ3A 4JV5C 3OTOC 1O9TA 4DCVA 1XS3A 3ETOA 3PROC 4FTFA 1MD9A 1GPMA 2VZEA 4X62C 3A4IA 3A9VA 4GXRA 1V25A 4BSZA 2QL8A 3PBKA 5BSUA 1XRBA 4LF6C 5LMNC 5BSTA 1XHJA 4X64C 4JI4C 4WV3A 1XMQC 2HJGA 3N54B 4R0MA 4MTNA 1IBLC 2YWBA 3LNOA 2D7VA 1XRAA 5KEIA 3KXWA 5KYVA 4RM3A 4ZLPA 3JAMD 1FLOA 1XMOC 4RMNA 2CU6A 1XDXA 1QM4A 5H9UA 5JRHA 3NYQA 1UWDA 5K8FA 2MCQA 2JNVA 1HNZC 2ZM6C 2ONFA 2BJOA 4LFBC 2CXCA 4RLFA 1MDFA 4DV6C 3O2EA 2D1SA 2P2MA 2VSQA 4U5YD 4TPSB 2KZFA 4G36A 4NOZA 3E7XA 1IBKC 2MM9A 3CQ1A 2PT7G 5CZXA 5A1GA 2Z51A 1IB8A 3G7SA 4BCAA 3NPDA 2NCLA 3K6RA 4FUTA 4JI3C 4OX9C 2DPLA 3LNVA 3CJEA 4GKKC 4DR4C 4DUYC 1RY2A 4WS9A 3FCCA 4DR2C 4AQYC 3LGXA 4JI2C 3RV2A 4JI5C 4LF5C 4JI8C 4ISBA 5FLXD 3PESA 4L4QA 4RVNA 3T1HC 1YGTA 4PUGA 5KYTA 1PU1A 3RG2A 1EGAA 2JMPA 5T8TA 2AYAA 4BBYA 3B7WA 4GXQA 1MDBA 3I08A 4LF7C 1N32C 4PHTA 5BSVA 4LE5A 3VNQA 4DV1C 1XNQC 4DV0C 2OO4A 4K0KC 4PUIA 2ZZMA 2KDNA 4D57A 1T5HX 2YX1A 3L8CA 3UZ0A 1J5EC 4FUQA 1UKKA 2E8FA 2ATWA 3SO4A 4DR6C 4NXNC 1HNWC 2M5HA 2VQEC 3A25A 4DUZC 4ZJZA 1HNXC 4PZPA 3AY0A 4LF4C 4KTVA 3T1YC 4DV2C 2BH1X 1FUGA 4LFAC 2KZ0A 5DV9A 3IPLA 4DV4C 2UUBC 1BA3A 1ULTA 3UOWA 4JYAC 2V7BA 1MXCA 4NDNA 4ODJA 4MH4A 4HPVA 5E7QA 4EATA 1HR0C 3UX3A 3CW9A 2VQFC 1AMUA 4DR5C 5A19A 3TUFA
chains in the Genus database with same CATH topology
5BURA 5A1IA 1N33C 3ETCA 4IR7A 2WD9A 3DAYA 1P7LA 4DG9A 4OXIA 3IEVA 1O93A 2QW0X 3GKUA 3R44A 1T5DX 4XX2A 1K0RA 3LUSA 5LMUC 1WH9A 4B3TC 1PG3A 4B3MC 1MXBA 1I94C 5T8SA 4KHPC 2UXCC 4X65C 3C5EA 1WF3A 1RG9A 2D1QA 3AF6A 2P2BA 4JI1C 5AE1A 3TQIA 4DR1C 4R1MA 1JOSA 3VNSA 4RLQA 1USPB 4R1LA 5BSMA 3AF5A 4LFCC 2E8EA 4K0BA 1N34C 3NYRA 3J80D 2UUAC 5ADZA 4YY3C 2E5LC 5GTDA 4NXMC 2P2QA 1QWIA 5BSRA 2YCBA 4D4IA 3FCEA 3EQ6A 2OPLA 3DHVA 5BR8C 2E8CA 4L7IA 4BC9A 2HHHC 2UXBC 4RM2A 3NI2A 2EGTA 2CY1A 4YHHC 4G37A 5BUSA 2Y4OA 2Y27A 3GR0A 3IMLA 2ASBA 1PA4A 5K85A 5A2QD 4B3RC 3R9XA 1LQLA 3E7WA 2YWCA 1MKYA 2PROA 2F4VC 3S82A 3N2QA 5IWAC 4OYCA 2P2FA 2P20A 3CW8X 5IT9D 3IEUA 1ZB8A 2P2JA 3A9UA 1NYEA 4JI7C 4DR7C 4DV5C 1LCIA 2UUCC 4I9GA 1N36C 4IZ6A 2D28C 3LAXA 4PROC 5BSWA 2E7GA 5IFIA 1YJ7A 3GPCA 2Y4NA 2OPLB 3GR1A 4L2ZA 4GS5A 2DYJA 3H2TA 1VLAA 1PG4A 1L2FA 2QVZX 4D56A 4JI0C 1MXAA 4B3SC 4LF8C 1FJGC 3VNRA 1IBMC 3R9WA 5BUQA 2UXDC 4DV3C 2QVYX 3TDEA 1O90A 1XRCA 4JI6C 1USPA 2OBVA 3J7AD 1V26A 1ML8A 2D1TA 2QVXX 1ZB9A 2P02A 4DCSA 1HH2P 1KKGA 5CZVA 4KTTA 5AE3A 2D1RA 4GKJC 4JM1A 3DLPX 4DCUA 1N2FA 3L95X 2E0GA 3J81D 4DR3C 1XNRC 4DG8A 2XR1A 3EERA 4DCTA 4BC7A 2WP0C 4DV7C 4I9FA 2UU9C 4LF9C 4RVOA 2PN2A 4D4GA 4G1IA 2D27A 3I07A 4X66C 1O92A 5AE2A 4JV5C 3OTOC 1O9TA 4DCVA 3ETOA 3PROC 4FTFA 1MD9A 1GPMA 2VZEA 4X62C 3A4IA 3A9VA 4GXRA 1V25A 4BSZA 2QL8A 3PBKA 5BSUA 1XRBA 4LF6C 5LMNC 5BSTA 4X64C 4JI4C 4WV3A 1XMQC 2HJGA 3N54B 4R0MA 4MTNA 1IBLC 2YWBA 2D7VA 1XRAA 5KEIA 3KXWA 5KYVA 4RM3A 4ZLPA 3JAMD 1XMOC 4RMNA 1QM4A 5H9UA 5JRHA 3NYQA 5K8FA 1HNZC 2ZM6C 2ONFA 2BJOA 4LFBC 2CXCA 4RLFA 1MDFA 4DV6C 2P2MA 2D1SA 2VSQA 4U5YD 4TPSB 2KZFA 4G36A 4NOZA 3E7XA 1IBKC 2PT7G 5CZXA 5A1GA 3G7SA 4BCAA 3NPDA 4FUTA 4JI3C 4OX9C 2DPLA 3LNVA 3CJEA 4GKKC 4DR4C 4DUYC 1RY2A 4WS9A 3FCCA 4DR2C 4JI2C 4AQYC 3LGXA 3RV2A 4JI5C 4LF5C 4JI8C 4ISBA 5FLXD 3PESA 4L4QA 4RVNA 3T1HC 5KYTA 3RG2A 1EGAA 2JMPA 5T8TA 2AYAA 4BBYA 3B7WA 4GXQA 1MDBA 3I08A 4LF7C 1N32C 4PHTA 5BSVA 4LE5A 3VNQA 4DV1C 1XNQC 4DV0C 2OO4A 4K0KC 4D57A 1T5HX 3L8CA 3UZ0A 1J5EC 4FUQA 1UKKA 2E8FA 2ATWA 3SO4A 4DR6C 4NXNC 1HNWC 2VQEC 4DUZC 1HNXC 4ZJZA 4PZPA 4LF4C 4KTVA 3T1YC 4DV2C 2BH1X 1FUGA 4LFAC 5DV9A 3IPLA 4DV4C 2UUBC 1BA3A 1ULTA 3UOWA 4JYAC 2V7BA 1MXCA 4NDNA 4ODJA 4MH4A 4HPVA 5E7QA 4EATA 1HR0C 3CW9A 2VQFC 1AMUA 4DR5C 5A19A 3TUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 C;  4B3R C;  4LF9 C;  3R9X A;  1LQL A;  1N33 C;  1MKY A;  5FLX D;  3T1H C;  2F4V C;  2PN2 A;  5IWA C;  3I07 A;  4X66 C;  3IEV A;  1EGA A;  2JMP A;  3GKU A;  4JV5 C;  5IT9 D;  3OTO C;  3IEU A;  4DCV A;  1ZB8 A;  4XX2 A;  1K0R A;  3LUS A;  1NYE A;  5LMU C;  4JI7 C;  4DR7 C;  4DV5 C;  4X62 C;  1WH9 A;  4B3T C;  2UUC C;  4BSZ A;  4B3M C;  2QL8 A;  1N36 C;  1I94 C;  4LF7 C;  1N32 C;  4KHP C;  2UXC C;  4X65 C;  4LF6 C;  1WF3 A;  5LMN C;  2E7G A;  3AF6 A;  4JI1 C;  4JI8 C;  4X64 C;  4JI4 C;  4DV1 C;  1XMQ C;  2OPL B;  2HJG A;  4DR1 C;  4MTN A;  1IBL C;  1XNQ C;  2DYJ A;  1JOS A;  4DV0 C;  4K0K C;  2D7V A;  1VLA A;  1USP B;  1L2F A;  3JAM D;  1XMO C;  4JI0 C;  3AF5 A;  4LFC C;  4B3S C;  1J5E C;  4LF8 C;  1FJG C;  2E8E A;  1UKK A;  2E8F A;  1IBM C;  3R9W A;  1N34 C;  1HNZ C;  2ATW A;  2UXD C;  3J80 D;  2UUA C;  2ZM6 C;  2ONF A;  2BJO A;  4DV3 C;  2CXC A;  4YY3 C;  4LFB C;  4DR6 C;  4NXN C;  2E5L C;  1HNW C;  4NXM C;  2VQE C;  4DV6 C;  1QWI A;  4DUZ C;  1USP A;  1HNX C;  4JI6 C;  2YCB A;  3J7A D;  2KZF A;  4NOZ A;  1ML8 A;  4LF4 C;  1IBK C;  3T1Y C;  2OPL A;  5BR8 C;  2E8C A;  2HHH C;  2UXB C;  4DV2 C;  1ZB9 A;  4DCS A;  2PT7 G;  4LFA C;  1HH2 P;  1KKG A;  4DV4 C;  2EGT A;  2UUB C;  2CY1 A;  4GKJ C;  4YHH C;  4JYA C;  4DCU A;  1N2F A;  4MH4 A;  4JI3 C;  4OX9 C;  1HR0 C;  3CJE A;  4GKK C;  4DR4 C;  3J81 D;  4DUY C;  2ASB A;  4DR3 C;  1PA4 A;  1XNR C;  4DR2 C;  2VQF C;  4AQY C;  4DR5 C;  2XR1 A;  3EER A;  4DCT A;  4JI2 C;  4DV7 C;  4JI5 C;  4LF5 C;  5A2Q D; 
#chains in the Genus database with same CATH topology
 5BUR A;  5A1I A;  1N33 C;  3ETC A;  4IR7 A;  2WD9 A;  3DAY A;  1P7L A;  4DG9 A;  4OXI A;  3IEV A;  1O93 A;  2QW0 X;  3GKU A;  3R44 A;  1T5D X;  4XX2 A;  1K0R A;  3LUS A;  3UX2 A;  5LMU C;  1WH9 A;  4B3T C;  1PG3 A;  4B3M C;  1MXB A;  1I94 C;  5T8S A;  4KHP C;  2UXC C;  4X65 C;  3C5E A;  1WF3 A;  1RG9 A;  2D1Q A;  3AF6 A;  2P2B A;  4JI1 C;  5AE1 A;  3TQI A;  2ZZN A;  4DR1 C;  4R1M A;  1JOS A;  3VNS A;  4RLQ A;  1USP B;  4R1L A;  5BSM A;  3AF5 A;  4LFC C;  2E8E A;  4K0B A;  1N34 C;  3NYR A;  3J80 D;  2UUA C;  5ADZ A;  1P4E C;  4YY3 C;  2E5L C;  5GTD A;  4NXM C;  1TH5 A;  2P2Q A;  1QWI A;  5BSR A;  2YCB A;  4D4I A;  3A26 A;  3FCE A;  3EQ6 A;  2OPL A;  3DHV A;  5BR8 C;  2E8C A;  4L7I A;  4BC9 A;  2HHH C;  2UXB C;  3TR3 A;  4RM2 A;  1P4E A;  3NI2 A;  2EGT A;  2CY1 A;  4YHH C;  4G37 A;  5BUS A;  2Y4O A;  2Y27 A;  3GR0 A;  3IML A;  2ASB A;  1PA4 A;  3UEB A;  5K85 A;  2ZTB A;  5A2Q D;  4B3R C;  3R9X A;  1LQL A;  3E7W A;  2YWC A;  1WCJ A;  1MKY A;  2PRO A;  2F4V C;  3S82 A;  3N2Q A;  2M5O A;  5IWA C;  4OYC A;  2P2F A;  2P20 A;  3CW8 X;  5IT9 D;  3IEU A;  1ZB8 A;  2P2J A;  3A9U A;  1NYE A;  4JI7 C;  4DR7 C;  4DV5 C;  1LCI A;  2UUC C;  4I9G A;  1N36 C;  4IZ6 A;  2D28 C;  3LAX A;  4PRO C;  5BSW A;  2E7G A;  5IFI A;  1YJ7 A;  3GPC A;  2Y4N A;  2OPL B;  3GR1 A;  4L2Z A;  4GS5 A;  2DYJ A;  1M6X A;  3H2T A;  1VLA A;  1PG4 A;  2DHM A;  1L2F A;  3FM7 A;  2QVZ X;  4D56 A;  4JI0 C;  1MXA A;  4B3S C;  4LF8 C;  1FJG C;  3VNR A;  1IBM C;  3R9W A;  5BUQ A;  2UXD C;  1M6X C;  4DV3 C;  2QVY X;  3TDE A;  1O90 A;  1XRC A;  1NY8 A;  1USP A;  4JI6 C;  2OBV A;  3J7A D;  1V26 A;  2PG1 E;  1ML8 A;  1VEH A;  2D1T A;  4PUH A;  2QVX X;  2MMA B;  1ZB9 A;  2P02 A;  4DCS A;  1HH2 P;  1KKG A;  5CZV A;  4KTT A;  5AE3 A;  2D1R A;  4GKJ C;  4JM1 A;  3DLP X;  4DCU A;  1N2F A;  3L95 X;  2E0G A;  1V60 A;  3J81 D;  5LCI A;  4DR3 C;  1XNR C;  4DG8 A;  2XR1 A;  3EER A;  4DCT A;  4BC7 A;  2WP0 C;  4DV7 C;  4I9F A;  2UU9 C;  4LF9 C;  4RVO A;  2PN2 A;  3CQ2 A;  4D4G A;  4G1I A;  2D27 A;  3I07 A;  4X66 C;  1O92 A;  5AE2 A;  3CQ3 A;  4JV5 C;  3OTO C;  1O9T A;  4DCV A;  1XS3 A;  3ETO A;  3PRO C;  4FTF A;  1MD9 A;  1GPM A;  2VZE A;  4X62 C;  3A4I A;  3A9V A;  4GXR A;  1V25 A;  4BSZ A;  2QL8 A;  3PBK A;  5BSU A;  1XRB A;  4LF6 C;  5LMN C;  5BST A;  1XHJ A;  4X64 C;  4JI4 C;  4WV3 A;  1XMQ C;  2HJG A;  3N54 B;  4R0M A;  4MTN A;  1IBL C;  2YWB A;  3LNO A;  2D7V A;  1XRA A;  5KEI A;  3KXW A;  5KYV A;  4RM3 A;  4ZLP A;  3JAM D;  1FLO A;  1XMO C;  4RMN A;  2CU6 A;  1XDX A;  1QM4 A;  5H9U A;  5JRH A;  3NYQ A;  1UWD A;  5K8F A;  2MCQ A;  2JNV A;  1HNZ C;  2ZM6 C;  2ONF A;  2BJO A;  4LFB C;  2CXC A;  4RLF A;  1MDF A;  4DV6 C;  3O2E A;  2D1S A;  2P2M A;  2VSQ A;  4U5Y D;  4TPS B;  2KZF A;  4G36 A;  4NOZ A;  3E7X A;  1IBK C;  2MM9 A;  3CQ1 A;  2PT7 G;  5CZX A;  5A1G A;  2Z51 A;  1IB8 A;  3G7S A;  4BCA A;  3NPD A;  2NCL A;  3K6R A;  4FUT A;  4JI3 C;  4OX9 C;  2DPL A;  3LNV A;  3CJE A;  4GKK C;  4DR4 C;  4DUY C;  1RY2 A;  4WS9 A;  3FCC A;  4DR2 C;  4AQY C;  3LGX A;  4JI2 C;  3RV2 A;  4JI5 C;  4LF5 C;  4JI8 C;  4ISB A;  5FLX D;  3PES A;  4L4Q A;  4RVN A;  3T1H C;  1YGT A;  4PUG A;  5KYT A;  1PU1 A;  3RG2 A;  1EGA A;  2JMP A;  5T8T A;  2AYA A;  4BBY A;  3B7W A;  4GXQ A;  1MDB A;  3I08 A;  4LF7 C;  1N32 C;  4PHT A;  5BSV A;  4LE5 A;  3VNQ A;  4DV1 C;  1XNQ C;  4DV0 C;  2OO4 A;  4K0K C;  4PUI A;  2ZZM A;  2KDN A;  4D57 A;  1T5H X;  2YX1 A;  3L8C A;  3UZ0 A;  1J5E C;  4FUQ A;  1UKK A;  2E8F A;  2ATW A;  3SO4 A;  4DR6 C;  4NXN C;  1HNW C;  2M5H A;  2VQE C;  3A25 A;  4DUZ C;  4ZJZ A;  1HNX C;  4PZP A;  3AY0 A;  4LF4 C;  4KTV A;  3T1Y C;  4DV2 C;  2BH1 X;  1FUG A;  4LFA C;  2KZ0 A;  5DV9 A;  3IPL A;  4DV4 C;  2UUB C;  1BA3 A;  1ULT A;  3UOW A;  4JYA C;  2V7B A;  1MXC A;  4NDN A;  4ODJ A;  4MH4 A;  4HPV A;  5E7Q A;  4EAT A;  1HR0 C;  3UX3 A;  3CW9 A;  2VQF C;  1AMU A;  4DR5 C;  5A19 A;  3TUF A; 
#chains in the Genus database with same CATH homology
 5BUR A;  5A1I A;  1N33 C;  3ETC A;  4IR7 A;  2WD9 A;  3DAY A;  1P7L A;  4DG9 A;  4OXI A;  3IEV A;  1O93 A;  2QW0 X;  3GKU A;  3R44 A;  1T5D X;  4XX2 A;  1K0R A;  3LUS A;  5LMU C;  1WH9 A;  4B3T C;  1PG3 A;  4B3M C;  1MXB A;  1I94 C;  5T8S A;  4KHP C;  2UXC C;  4X65 C;  3C5E A;  1WF3 A;  1RG9 A;  2D1Q A;  3AF6 A;  2P2B A;  4JI1 C;  5AE1 A;  3TQI A;  4DR1 C;  4R1M A;  1JOS A;  3VNS A;  4RLQ A;  1USP B;  4R1L A;  5BSM A;  3AF5 A;  4LFC C;  2E8E A;  4K0B A;  1N34 C;  3NYR A;  3J80 D;  2UUA C;  5ADZ A;  4YY3 C;  2E5L C;  5GTD A;  4NXM C;  2P2Q A;  1QWI A;  5BSR A;  2YCB A;  4D4I A;  3FCE A;  3EQ6 A;  2OPL A;  3DHV A;  5BR8 C;  2E8C A;  4L7I A;  4BC9 A;  2HHH C;  2UXB C;  4RM2 A;  3NI2 A;  2EGT A;  2CY1 A;  4YHH C;  4G37 A;  5BUS A;  2Y4O A;  2Y27 A;  3GR0 A;  3IML A;  2ASB A;  1PA4 A;  5K85 A;  5A2Q D;  4B3R C;  3R9X A;  1LQL A;  3E7W A;  2YWC A;  1MKY A;  2PRO A;  2F4V C;  3S82 A;  3N2Q A;  5IWA C;  4OYC A;  2P2F A;  2P20 A;  3CW8 X;  5IT9 D;  3IEU A;  1ZB8 A;  2P2J A;  3A9U A;  1NYE A;  4JI7 C;  4DR7 C;  4DV5 C;  1LCI A;  2UUC C;  4I9G A;  1N36 C;  4IZ6 A;  2D28 C;  3LAX A;  4PRO C;  5BSW A;  2E7G A;  5IFI A;  1YJ7 A;  3GPC A;  2Y4N A;  2OPL B;  3GR1 A;  4L2Z A;  4GS5 A;  2DYJ A;  3H2T A;  1VLA A;  1PG4 A;  1L2F A;  2QVZ X;  4D56 A;  4JI0 C;  1MXA A;  4B3S C;  4LF8 C;  1FJG C;  3VNR A;  1IBM C;  3R9W A;  5BUQ A;  2UXD C;  4DV3 C;  2QVY X;  3TDE A;  1O90 A;  1XRC A;  4JI6 C;  1USP A;  2OBV A;  3J7A D;  1V26 A;  1ML8 A;  2D1T A;  2QVX X;  1ZB9 A;  2P02 A;  4DCS A;  1HH2 P;  1KKG A;  5CZV A;  4KTT A;  5AE3 A;  2D1R A;  4GKJ C;  4JM1 A;  3DLP X;  4DCU A;  1N2F A;  3L95 X;  2E0G A;  3J81 D;  4DR3 C;  1XNR C;  4DG8 A;  2XR1 A;  3EER A;  4DCT A;  4BC7 A;  2WP0 C;  4DV7 C;  4I9F A;  2UU9 C;  4LF9 C;  4RVO A;  2PN2 A;  4D4G A;  4G1I A;  2D27 A;  3I07 A;  4X66 C;  1O92 A;  5AE2 A;  4JV5 C;  3OTO C;  1O9T A;  4DCV A;  3ETO A;  3PRO C;  4FTF A;  1MD9 A;  1GPM A;  2VZE A;  4X62 C;  3A4I A;  3A9V A;  4GXR A;  1V25 A;  4BSZ A;  2QL8 A;  3PBK A;  5BSU A;  1XRB A;  4LF6 C;  5LMN C;  5BST A;  4X64 C;  4JI4 C;  4WV3 A;  1XMQ C;  2HJG A;  3N54 B;  4R0M A;  4MTN A;  1IBL C;  2YWB A;  2D7V A;  1XRA A;  5KEI A;  3KXW A;  5KYV A;  4RM3 A;  4ZLP A;  3JAM D;  1XMO C;  4RMN A;  1QM4 A;  5H9U A;  5JRH A;  3NYQ A;  5K8F A;  1HNZ C;  2ZM6 C;  2ONF A;  2BJO A;  4LFB C;  2CXC A;  4RLF A;  1MDF A;  4DV6 C;  2P2M A;  2D1S A;  2VSQ A;  4U5Y D;  4TPS B;  2KZF A;  4G36 A;  4NOZ A;  3E7X A;  1IBK C;  2PT7 G;  5CZX A;  5A1G A;  3G7S A;  4BCA A;  3NPD A;  4FUT A;  4JI3 C;  4OX9 C;  2DPL A;  3LNV A;  3CJE A;  4GKK C;  4DR4 C;  4DUY C;  1RY2 A;  4WS9 A;  3FCC A;  4DR2 C;  4JI2 C;  4AQY C;  3LGX A;  3RV2 A;  4JI5 C;  4LF5 C;  4JI8 C;  4ISB A;  5FLX D;  3PES A;  4L4Q A;  4RVN A;  3T1H C;  5KYT A;  3RG2 A;  1EGA A;  2JMP A;  5T8T A;  2AYA A;  4BBY A;  3B7W A;  4GXQ A;  1MDB A;  3I08 A;  4LF7 C;  1N32 C;  4PHT A;  5BSV A;  4LE5 A;  3VNQ A;  4DV1 C;  1XNQ C;  4DV0 C;  2OO4 A;  4K0K C;  4D57 A;  1T5H X;  3L8C A;  3UZ0 A;  1J5E C;  4FUQ A;  1UKK A;  2E8F A;  2ATW A;  3SO4 A;  4DR6 C;  4NXN C;  1HNW C;  2VQE C;  4DUZ C;  1HNX C;  4ZJZ A;  4PZP A;  4LF4 C;  4KTV A;  3T1Y C;  4DV2 C;  2BH1 X;  1FUG A;  4LFA C;  5DV9 A;  3IPL A;  4DV4 C;  2UUB C;  1BA3 A;  1ULT A;  3UOW A;  4JYA C;  2V7B A;  1MXC A;  4NDN A;  4ODJ A;  4MH4 A;  4HPV A;  5E7Q A;  4EAT A;  1HR0 C;  3CW9 A;  2VQF C;  1AMU A;  4DR5 C;  5A19 A;  3TUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...