4BSZA

Crystal structure of the yeast ribosomal protein rps3 in complex with its chaperone yar1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
187
structure length
187
Chain Sequence
VADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRATRTQDVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKFADGFLIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRDPAKSRTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 40S RIBOSOMAL PROTEIN S3
publication title Crystal Structure of the Yeast Ribosomal Protein Rps3 in Complex with its Chaperone Yar1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 35
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4bszA01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4bszA02
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4bszA03
4DR6C 1NYEA 4GKKC 1N34C 2PT7G 2BJOA 4JV5C 3J81D 1USPB 1JOSA 4DV4C 4LF6C 3R9WA 2UUBC 4DV0C 5LMUC 4DUZC 3R9XA 1EGAA 2UU9C 2OPLA 2DYJA 4AQYC 4X64C 4JI0C 4DV6C 4XX2A 3T1YC 1VLAA 1ZB8A 2ZM6C 1N32C 4DR5C 4MTNA 4JI2C 3AF5A 4LF5C 4DCSA 4JI8C 4DR4C 2UXBC 3I07A 2KZFA 3AF6A 4B3MC 1XMOC 4B3SC 4DR1C 1N33C 4DV7C 4LF7C 1XNRC 2UXCC 1FJGC 5A2QD 2ASBA 2YCBA 1N2FA 4B3RC 3J7AD 2VQFC 4JI6C 3J80D 1IBMC 5IWAC 4NXNC 3EERA 4JI1C 4LFBC 1HH2P 3T1HC 4JI4C 4LF8C 4MH4A 1L2FA 2VQEC 4JI7C 1LQLA 4JYAC 1XNQC 1XMQC 4B3TC 2UUAC 1HR0C 4X66C 2XR1A 1HNZC 1ZB9A 2E8EA 3CJEA 4DR2C 2OPLB 4OX9C 4DV5C 1WH9A 4YY3C 4DCTA 4DV2C 5LMNC 1N36C 4JI5C 4K0KC 4NOZA 4DCVA 2ATWA 1UKKA 1J5EC 2HHHC 1USPA 1KKGA 2CY1A 4DV3C 2UUCC 2D7VA 3IEVA 4DR3C 1IBKC 4X65C 1QWIA 5BR8C 2ONFA 4GKJC 4JI3C 4DR7C 4LFAC 1IBLC 2UXDC 1HNXC 2PN2A 2EGTA 3IEUA 1I94C 1K0RA 2E8CA 2E8FA 4DUYC 4KHPC 3LUSA 4X62C 2JMPA 1HNWC 4BSZA 2HJGA 2E5LC 5FLXD 4DCUA 4LF4C 4YHHC 3GKUA 4LFCC 3JAMD 2F4VC 1ML8A 1MKYA 2E7GA 4DV1C 1PA4A 1WF3A 4LF9C 4NXMC 5IT9D 2CXCA 3OTOC 2QL8A
chains in the Genus database with same CATH superfamily
1NYEA 1N34C 2PT7G 4JV5C 4PUGA 3H2TA 1USPB 3UX2A 5BSUA 4LF6C 4DUZC 3R9XA 1EGAA 2UU9C 2OPLA 5T8TA 4XX2A 2OBVA 1VLAA 1ZB8A 5A1GA 3A26A 2ZZMA 2ZM6C 4MTNA 2PROA 3E7XA 2MM9A 4LF5C 4DCSA 1FUGA 1XHJA 1WCJA 5A19A 3LGXA 4DV7C 2P2QA 1M6XC 2P02A 3IMLA 2UXCC 3LAXA 2VZEA 4JI6C 1IBMC 3NYRA 3GPCA 3A9UA 1L2FA 2VQEC 4JI7C 4JYAC 1MXCA 1PG4A 4FUQA 4B3TC 2QVXX 3B7WA 2VSQA 2YWCA 5K8FA 4DR2C 4OX9C 2P2JA 4YY3C 5LMNC 1XDXA 3KXWA 1UKKA 1J5EC 1USPA 4DV3C 2MCQA 4L2ZA 4DR3C 4X65C 3PBKA 2QVZX 3DLPX 3G7SA 1XRBA 5T8SA 4DR7C 1NY8A 4WS9A 2PN2A 4EATA 3S82A 3LUSA 3N2QA 4BSZA 3LNOA 2HJGA 5KEIA 5BUSA 3GKUA 3JAMD 1MKYA 2E7GA 3DHVA 4FUTA 5AE3A 3E7WA 2CXCA 1VEHA 4GXQA 2P2MA 1O92A 2KZ0A 1BA3A 3RV2A 3J81D 5H9UA 4G37A 2UUBC 4GXRA 5LMUC 4D57A 2DYJA 4AQYC 3T1YC 1N32C 1V26A 2P20A 4R1LA 3I07A 4OXIA 2KZFA 1M6XA 4NDNA 5DV9A 1P4EC 4BBYA 2WP0C 4DR1C 1N33C 4PROC 5BSRA 1MD9A 3NYQA 1T5HX 1FJGC 5A2QD 2ASBA 3J7AD 3J80D 1PG3A 5IWAC 4NXNC 3EERA 4JI1C 1GPMA 4HPVA 1HH2P 3T1HC 3UEBA 2Y4OA 1LQLA 5BSMA 2E0GA 1TH5A 1XNQC 4L4QA 3A25A 2XR1A 3UOWA 1PU1A 1WH9A 4DCTA 4ISBA 3I08A 1N36C 4D4GA 5JRHA 3CW9A 4FTFA 4RVNA 2JNVA 5CZXA 1LCIA 2AYAA 1QM4A 1YJ7A 5BR8C 4GKJC 3TUFA 5BSWA 1UWDA 2KDNA 3L8CA 3IEUA 4RLQA 2D1SA 1I94C 1K0RA 2E8FA 4DUYC 4G1IA 1MXBA 2DHMA 2D1QA 1XRAA 5BURA 2E5LC 1O9TA 1O93A 4YHHC 4LFCC 2QVYX 1ML8A 3UX3A 4DV1C 2NCLA 4NXMC 2D27A 1MDBA 4G36A 5GTDA 3UZ0A 4KTVA 4DR6C 2BJOA 1JOSA 4DV4C 3R9WA 4DV0C 4WV3A 1V60A 3CQ1A 4BCAA 4DG9A 4I9GA 2ZTBA 1V25A 4U5YD 4DV6C 2M5OA 3VNQA 4DR5C 4TPSB 4JI8C 3SO4A 4DR4C 1FLOA 4B3SC 3A4IA 1XRCA 3PESA 3AY0A 1XNRC 1N2FA 2WD9A 2VQFC 3K6RA 5AE1A 4LFBC 4R1MA 4JI4C 3FM7A 4MH4A 3LNVA 2YWBA 3TQIA 4GS5A 2OO4A 2E8EA 4DV5C 2Y4NA 4OYCA 4DV2C 4JI5C 2P2BA 1P7LA 4RM3A 4K0KC 4NOZA 2ATWA 4IZ6A 4RVOA 2MMAB 2CY1A 3NPDA 4ZLPA 4ZJZA 2D7VA 2UUCC 2YX1A 1O90A 3ETOA 3ETCA 1QWIA 1ULTA 4RLFA 4JI3C 2V7BA 2UXDC 1HNXC 2EGTA 3GR0A 3CQ3A 3GR1A 4X62C 2JMPA 5FLXD 4LF4C 4PUIA 2F4VC 5BSTA 2ZZNA 2QW0X 4D4IA 1RY2A 2QL8A 4GKKC 1MXAA 2M5HA 4DG8A 2BH1X 4BC7A 3NI2A 2DPLA 3RG2A 4BC9A 3VNSA 4X64C 4JI0C 3CW8X 1T5DX 2Z51A 4JI2C 3AF5A 3TR3A 2UXBC 1IB8A 3DAYA 3AF6A 5A1IA 4B3MC 1XMOC 4PUHA 1XS3A 5KYVA 4LF7C 3L95X 2Y27A 5BSVA 2YCBA 4B3RC 1AMUA 2PG1E 2D28C 3C5EA 4LF8C 5E7QA 3IPLA 1P4EA 4LE5A 4JM1A 5AE2A 1XMQC 2P2FA 2UUAC 3CQ2A 5K85A 1HR0C 4PZPA 4X66C 3VNRA 2D1TA 1HNZC 1ZB9A 3CJEA 2OPLB 3N54B 2D1RA 4IR7A 1YGTA 5BUQA 3TDEA 4DCVA 2HHHC 1KKGA 3FCCA 4R0MA 5LCIA 3PROC 3IEVA 1RG9A 4RMNA 3A9VA 1IBKC 4L7IA 5IFIA 4I9FA 2ONFA 4K0BA 4ODJA 4KTTA 4LFAC 1IBLC 3O2EA 4PHTA 3FCEA 2E8CA 4D56A 5KYTA 2CU6A 3EQ6A 4KHPC 5CZVA 4RM2A 1MDFA 1HNWC 4DCUA 1PA4A 1WF3A 4LF9C 3R44A 5IT9D 5ADZA 3OTOC
chains in the Genus database with same CATH topology
1NYEA 1N34C 2PT7G 4JV5C 3H2TA 1USPB 4LF6C 5BSUA 4DUZC 3R9XA 1EGAA 2UU9C 2OPLA 5T8TA 4XX2A 2OBVA 1VLAA 1ZB8A 5A1GA 2ZM6C 4MTNA 2PROA 3E7XA 4LF5C 4DCSA 1FUGA 5A19A 3LGXA 4DV7C 2P2QA 2P02A 3IMLA 2UXCC 3LAXA 2VZEA 4JI6C 1IBMC 3NYRA 3GPCA 3A9UA 1L2FA 2VQEC 4JI7C 4JYAC 1MXCA 1PG4A 4FUQA 4B3TC 2QVXX 3B7WA 2VSQA 2YWCA 5K8FA 4DR2C 4OX9C 2P2JA 4YY3C 5LMNC 3KXWA 1UKKA 1J5EC 1USPA 4DV3C 4L2ZA 4DR3C 4X65C 3PBKA 2QVZX 3DLPX 3G7SA 1XRBA 5T8SA 4DR7C 4WS9A 2PN2A 4EATA 3S82A 3LUSA 3N2QA 4BSZA 2HJGA 5KEIA 5BUSA 3GKUA 3JAMD 1MKYA 2E7GA 3DHVA 4FUTA 5AE3A 3E7WA 2CXCA 4GXQA 2P2MA 1O92A 1BA3A 3RV2A 3J81D 5H9UA 4G37A 2UUBC 4GXRA 5LMUC 4D57A 2DYJA 4AQYC 3T1YC 1N32C 1V26A 2P20A 4R1LA 3I07A 4OXIA 2KZFA 4NDNA 5DV9A 4BBYA 2WP0C 4DR1C 1N33C 4PROC 5BSRA 1MD9A 3NYQA 1T5HX 1FJGC 5A2QD 2ASBA 3J7AD 3J80D 1PG3A 5IWAC 4NXNC 3EERA 4JI1C 1GPMA 4HPVA 1HH2P 3T1HC 2Y4OA 1LQLA 5BSMA 2E0GA 1XNQC 4L4QA 2XR1A 3UOWA 1WH9A 4DCTA 4ISBA 3I08A 1N36C 4D4GA 5JRHA 3CW9A 4FTFA 4RVNA 5CZXA 1LCIA 2AYAA 1QM4A 1YJ7A 5BR8C 4GKJC 3TUFA 5BSWA 3L8CA 3IEUA 4RLQA 2D1SA 1I94C 1K0RA 2E8FA 4DUYC 4G1IA 1MXBA 2D1QA 1XRAA 5BURA 2E5LC 1O9TA 1O93A 4YHHC 4LFCC 2QVYX 1ML8A 4DV1C 4NXMC 2D27A 1MDBA 4G36A 5GTDA 3UZ0A 4KTVA 4DR6C 2BJOA 1JOSA 4DV4C 3R9WA 4DV0C 4WV3A 4BCAA 4DG9A 4I9GA 1V25A 4U5YD 4DV6C 3VNQA 4DR5C 4TPSB 4JI8C 3SO4A 4DR4C 4B3SC 3A4IA 1XRCA 3PESA 1XNRC 1N2FA 2WD9A 2VQFC 5AE1A 4LFBC 4R1MA 4JI4C 4MH4A 3LNVA 2YWBA 3TQIA 4GS5A 2OO4A 2E8EA 4DV5C 2Y4NA 4OYCA 4DV2C 4JI5C 2P2BA 1P7LA 4RM3A 4K0KC 4NOZA 2ATWA 4IZ6A 4RVOA 3NPDA 2CY1A 4ZLPA 4ZJZA 2D7VA 2UUCC 1O90A 3ETOA 3ETCA 1QWIA 1ULTA 4RLFA 4JI3C 2V7BA 2UXDC 1HNXC 2EGTA 3GR0A 3GR1A 4X62C 2JMPA 5FLXD 4LF4C 2F4VC 5BSTA 2QW0X 4D4IA 1RY2A 2QL8A 4GKKC 1MXAA 4DG8A 2BH1X 4BC7A 3NI2A 2DPLA 3RG2A 4BC9A 3VNSA 4X64C 4JI0C 3CW8X 1T5DX 4JI2C 3AF5A 2UXBC 3DAYA 3AF6A 5A1IA 4B3MC 1XMOC 5KYVA 4LF7C 3L95X 2Y27A 5BSVA 2YCBA 4B3RC 1AMUA 2D28C 3C5EA 4LF8C 5E7QA 3IPLA 4LE5A 4JM1A 5AE2A 1XMQC 2P2FA 2UUAC 5K85A 1HR0C 4PZPA 4X66C 3VNRA 2D1TA 1HNZC 1ZB9A 3CJEA 2OPLB 3N54B 2D1RA 4IR7A 5BUQA 3TDEA 4DCVA 2HHHC 1KKGA 3FCCA 4R0MA 3PROC 3IEVA 1RG9A 4RMNA 3A9VA 1IBKC 4L7IA 5IFIA 4I9FA 2ONFA 4K0BA 4ODJA 4KTTA 4LFAC 1IBLC 4PHTA 3FCEA 2E8CA 4D56A 5KYTA 3EQ6A 4KHPC 5CZVA 4RM2A 1MDFA 1HNWC 4DCUA 1PA4A 1WF3A 4LF9C 3R44A 5IT9D 5ADZA 3OTOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 C;  1NYE A;  4GKK C;  1N34 C;  2PT7 G;  2BJO A;  4JV5 C;  3J81 D;  1USP B;  1JOS A;  4DV4 C;  4LF6 C;  3R9W A;  2UUB C;  4DV0 C;  5LMU C;  4DUZ C;  3R9X A;  1EGA A;  2UU9 C;  2OPL A;  2DYJ A;  4AQY C;  4X64 C;  4JI0 C;  4DV6 C;  4XX2 A;  3T1Y C;  1VLA A;  1ZB8 A;  2ZM6 C;  1N32 C;  4DR5 C;  4MTN A;  4JI2 C;  3AF5 A;  4LF5 C;  4DCS A;  4JI8 C;  4DR4 C;  2UXB C;  3I07 A;  2KZF A;  3AF6 A;  4B3M C;  1XMO C;  4B3S C;  4DR1 C;  1N33 C;  4DV7 C;  4LF7 C;  1XNR C;  2UXC C;  1FJG C;  5A2Q D;  2ASB A;  2YCB A;  1N2F A;  4B3R C;  3J7A D;  2VQF C;  4JI6 C;  3J80 D;  1IBM C;  5IWA C;  4NXN C;  3EER A;  4JI1 C;  4LFB C;  1HH2 P;  3T1H C;  4JI4 C;  4LF8 C;  4MH4 A;  1L2F A;  2VQE C;  4JI7 C;  1LQL A;  4JYA C;  1XNQ C;  1XMQ C;  4B3T C;  2UUA C;  1HR0 C;  4X66 C;  2XR1 A;  1HNZ C;  1ZB9 A;  2E8E A;  3CJE A;  4DR2 C;  2OPL B;  4OX9 C;  4DV5 C;  1WH9 A;  4YY3 C;  4DCT A;  4DV2 C;  5LMN C;  1N36 C;  4JI5 C;  4K0K C;  4NOZ A;  4DCV A;  2ATW A;  1UKK A;  1J5E C;  2HHH C;  1USP A;  1KKG A;  2CY1 A;  4DV3 C;  2UUC C;  2D7V A;  3IEV A;  4DR3 C;  1IBK C;  4X65 C;  1QWI A;  5BR8 C;  2ONF A;  4GKJ C;  4JI3 C;  4DR7 C;  4LFA C;  1IBL C;  2UXD C;  1HNX C;  2PN2 A;  2EGT A;  3IEU A;  1I94 C;  1K0R A;  2E8C A;  2E8F A;  4DUY C;  4KHP C;  3LUS A;  4X62 C;  2JMP A;  1HNW C;  4BSZ A;  2HJG A;  2E5L C;  5FLX D;  4DCU A;  4LF4 C;  4YHH C;  3GKU A;  4LFC C;  3JAM D;  2F4V C;  1ML8 A;  1MKY A;  2E7G A;  4DV1 C;  1PA4 A;  1WF3 A;  4LF9 C;  4NXM C;  5IT9 D;  2CXC A;  3OTO C;  2QL8 A; 
#chains in the Genus database with same CATH topology
 1NYE A;  1N34 C;  2PT7 G;  4JV5 C;  4PUG A;  3H2T A;  1USP B;  3UX2 A;  5BSU A;  4LF6 C;  4DUZ C;  3R9X A;  1EGA A;  2UU9 C;  2OPL A;  5T8T A;  4XX2 A;  2OBV A;  1VLA A;  1ZB8 A;  5A1G A;  3A26 A;  2ZZM A;  2ZM6 C;  4MTN A;  2PRO A;  3E7X A;  2MM9 A;  4LF5 C;  4DCS A;  1FUG A;  1XHJ A;  1WCJ A;  5A19 A;  3LGX A;  4DV7 C;  2P2Q A;  1M6X C;  2P02 A;  3IML A;  2UXC C;  3LAX A;  2VZE A;  4JI6 C;  1IBM C;  3NYR A;  3GPC A;  3A9U A;  1L2F A;  2VQE C;  4JI7 C;  4JYA C;  1MXC A;  1PG4 A;  4FUQ A;  4B3T C;  2QVX X;  3B7W A;  2VSQ A;  2YWC A;  5K8F A;  4DR2 C;  4OX9 C;  2P2J A;  4YY3 C;  5LMN C;  1XDX A;  3KXW A;  1UKK A;  1J5E C;  1USP A;  4DV3 C;  2MCQ A;  4L2Z A;  4DR3 C;  4X65 C;  3PBK A;  2QVZ X;  3DLP X;  3G7S A;  1XRB A;  5T8S A;  4DR7 C;  1NY8 A;  4WS9 A;  2PN2 A;  4EAT A;  3S82 A;  3LUS A;  3N2Q A;  4BSZ A;  3LNO A;  2HJG A;  5KEI A;  5BUS A;  3GKU A;  3JAM D;  1MKY A;  2E7G A;  3DHV A;  4FUT A;  5AE3 A;  3E7W A;  2CXC A;  1VEH A;  4GXQ A;  2P2M A;  1O92 A;  2KZ0 A;  1BA3 A;  3RV2 A;  3J81 D;  5H9U A;  4G37 A;  2UUB C;  4GXR A;  5LMU C;  4D57 A;  2DYJ A;  4AQY C;  3T1Y C;  1N32 C;  1V26 A;  2P20 A;  4R1L A;  3I07 A;  4OXI A;  2KZF A;  1M6X A;  4NDN A;  5DV9 A;  1P4E C;  4BBY A;  2WP0 C;  4DR1 C;  1N33 C;  4PRO C;  5BSR A;  1MD9 A;  3NYQ A;  1T5H X;  1FJG C;  5A2Q D;  2ASB A;  3J7A D;  3J80 D;  1PG3 A;  5IWA C;  4NXN C;  3EER A;  4JI1 C;  1GPM A;  4HPV A;  1HH2 P;  3T1H C;  3UEB A;  2Y4O A;  1LQL A;  5BSM A;  2E0G A;  1TH5 A;  1XNQ C;  4L4Q A;  3A25 A;  2XR1 A;  3UOW A;  1PU1 A;  1WH9 A;  4DCT A;  4ISB A;  3I08 A;  1N36 C;  4D4G A;  5JRH A;  3CW9 A;  4FTF A;  4RVN A;  2JNV A;  5CZX A;  1LCI A;  2AYA A;  1QM4 A;  1YJ7 A;  5BR8 C;  4GKJ C;  3TUF A;  5BSW A;  1UWD A;  2KDN A;  3L8C A;  3IEU A;  4RLQ A;  2D1S A;  1I94 C;  1K0R A;  2E8F A;  4DUY C;  4G1I A;  1MXB A;  2DHM A;  2D1Q A;  1XRA A;  5BUR A;  2E5L C;  1O9T A;  1O93 A;  4YHH C;  4LFC C;  2QVY X;  1ML8 A;  3UX3 A;  4DV1 C;  2NCL A;  4NXM C;  2D27 A;  1MDB A;  4G36 A;  5GTD A;  3UZ0 A;  4KTV A;  4DR6 C;  2BJO A;  1JOS A;  4DV4 C;  3R9W A;  4DV0 C;  4WV3 A;  1V60 A;  3CQ1 A;  4BCA A;  4DG9 A;  4I9G A;  2ZTB A;  1V25 A;  4U5Y D;  4DV6 C;  2M5O A;  3VNQ A;  4DR5 C;  4TPS B;  4JI8 C;  3SO4 A;  4DR4 C;  1FLO A;  4B3S C;  3A4I A;  1XRC A;  3PES A;  3AY0 A;  1XNR C;  1N2F A;  2WD9 A;  2VQF C;  3K6R A;  5AE1 A;  4LFB C;  4R1M A;  4JI4 C;  3FM7 A;  4MH4 A;  3LNV A;  2YWB A;  3TQI A;  4GS5 A;  2OO4 A;  2E8E A;  4DV5 C;  2Y4N A;  4OYC A;  4DV2 C;  4JI5 C;  2P2B A;  1P7L A;  4RM3 A;  4K0K C;  4NOZ A;  2ATW A;  4IZ6 A;  4RVO A;  2MMA B;  2CY1 A;  3NPD A;  4ZLP A;  4ZJZ A;  2D7V A;  2UUC C;  2YX1 A;  1O90 A;  3ETO A;  3ETC A;  1QWI A;  1ULT A;  4RLF A;  4JI3 C;  2V7B A;  2UXD C;  1HNX C;  2EGT A;  3GR0 A;  3CQ3 A;  3GR1 A;  4X62 C;  2JMP A;  5FLX D;  4LF4 C;  4PUI A;  2F4V C;  5BST A;  2ZZN A;  2QW0 X;  4D4I A;  1RY2 A;  2QL8 A;  4GKK C;  1MXA A;  2M5H A;  4DG8 A;  2BH1 X;  4BC7 A;  3NI2 A;  2DPL A;  3RG2 A;  4BC9 A;  3VNS A;  4X64 C;  4JI0 C;  3CW8 X;  1T5D X;  2Z51 A;  4JI2 C;  3AF5 A;  3TR3 A;  2UXB C;  1IB8 A;  3DAY A;  3AF6 A;  5A1I A;  4B3M C;  1XMO C;  4PUH A;  1XS3 A;  5KYV A;  4LF7 C;  3L95 X;  2Y27 A;  5BSV A;  2YCB A;  4B3R C;  1AMU A;  2PG1 E;  2D28 C;  3C5E A;  4LF8 C;  5E7Q A;  3IPL A;  1P4E A;  4LE5 A;  4JM1 A;  5AE2 A;  1XMQ C;  2P2F A;  2UUA C;  3CQ2 A;  5K85 A;  1HR0 C;  4PZP A;  4X66 C;  3VNR A;  2D1T A;  1HNZ C;  1ZB9 A;  3CJE A;  2OPL B;  3N54 B;  2D1R A;  4IR7 A;  1YGT A;  5BUQ A;  3TDE A;  4DCV A;  2HHH C;  1KKG A;  3FCC A;  4R0M A;  5LCI A;  3PRO C;  3IEV A;  1RG9 A;  4RMN A;  3A9V A;  1IBK C;  4L7I A;  5IFI A;  4I9F A;  2ONF A;  4K0B A;  4ODJ A;  4KTT A;  4LFA C;  1IBL C;  3O2E A;  4PHT A;  3FCE A;  2E8C A;  4D56 A;  5KYT A;  2CU6 A;  3EQ6 A;  4KHP C;  5CZV A;  4RM2 A;  1MDF A;  1HNW C;  4DCU A;  1PA4 A;  1WF3 A;  4LF9 C;  3R44 A;  5IT9 D;  5ADZ A;  3OTO C; 
#chains in the Genus database with same CATH homology
 1NYE A;  1N34 C;  2PT7 G;  4JV5 C;  3H2T A;  1USP B;  4LF6 C;  5BSU A;  4DUZ C;  3R9X A;  1EGA A;  2UU9 C;  2OPL A;  5T8T A;  4XX2 A;  2OBV A;  1VLA A;  1ZB8 A;  5A1G A;  2ZM6 C;  4MTN A;  2PRO A;  3E7X A;  4LF5 C;  4DCS A;  1FUG A;  5A19 A;  3LGX A;  4DV7 C;  2P2Q A;  2P02 A;  3IML A;  2UXC C;  3LAX A;  2VZE A;  4JI6 C;  1IBM C;  3NYR A;  3GPC A;  3A9U A;  1L2F A;  2VQE C;  4JI7 C;  4JYA C;  1MXC A;  1PG4 A;  4FUQ A;  4B3T C;  2QVX X;  3B7W A;  2VSQ A;  2YWC A;  5K8F A;  4DR2 C;  4OX9 C;  2P2J A;  4YY3 C;  5LMN C;  3KXW A;  1UKK A;  1J5E C;  1USP A;  4DV3 C;  4L2Z A;  4DR3 C;  4X65 C;  3PBK A;  2QVZ X;  3DLP X;  3G7S A;  1XRB A;  5T8S A;  4DR7 C;  4WS9 A;  2PN2 A;  4EAT A;  3S82 A;  3LUS A;  3N2Q A;  4BSZ A;  2HJG A;  5KEI A;  5BUS A;  3GKU A;  3JAM D;  1MKY A;  2E7G A;  3DHV A;  4FUT A;  5AE3 A;  3E7W A;  2CXC A;  4GXQ A;  2P2M A;  1O92 A;  1BA3 A;  3RV2 A;  3J81 D;  5H9U A;  4G37 A;  2UUB C;  4GXR A;  5LMU C;  4D57 A;  2DYJ A;  4AQY C;  3T1Y C;  1N32 C;  1V26 A;  2P20 A;  4R1L A;  3I07 A;  4OXI A;  2KZF A;  4NDN A;  5DV9 A;  4BBY A;  2WP0 C;  4DR1 C;  1N33 C;  4PRO C;  5BSR A;  1MD9 A;  3NYQ A;  1T5H X;  1FJG C;  5A2Q D;  2ASB A;  3J7A D;  3J80 D;  1PG3 A;  5IWA C;  4NXN C;  3EER A;  4JI1 C;  1GPM A;  4HPV A;  1HH2 P;  3T1H C;  2Y4O A;  1LQL A;  5BSM A;  2E0G A;  1XNQ C;  4L4Q A;  2XR1 A;  3UOW A;  1WH9 A;  4DCT A;  4ISB A;  3I08 A;  1N36 C;  4D4G A;  5JRH A;  3CW9 A;  4FTF A;  4RVN A;  5CZX A;  1LCI A;  2AYA A;  1QM4 A;  1YJ7 A;  5BR8 C;  4GKJ C;  3TUF A;  5BSW A;  3L8C A;  3IEU A;  4RLQ A;  2D1S A;  1I94 C;  1K0R A;  2E8F A;  4DUY C;  4G1I A;  1MXB A;  2D1Q A;  1XRA A;  5BUR A;  2E5L C;  1O9T A;  1O93 A;  4YHH C;  4LFC C;  2QVY X;  1ML8 A;  4DV1 C;  4NXM C;  2D27 A;  1MDB A;  4G36 A;  5GTD A;  3UZ0 A;  4KTV A;  4DR6 C;  2BJO A;  1JOS A;  4DV4 C;  3R9W A;  4DV0 C;  4WV3 A;  4BCA A;  4DG9 A;  4I9G A;  1V25 A;  4U5Y D;  4DV6 C;  3VNQ A;  4DR5 C;  4TPS B;  4JI8 C;  3SO4 A;  4DR4 C;  4B3S C;  3A4I A;  1XRC A;  3PES A;  1XNR C;  1N2F A;  2WD9 A;  2VQF C;  5AE1 A;  4LFB C;  4R1M A;  4JI4 C;  4MH4 A;  3LNV A;  2YWB A;  3TQI A;  4GS5 A;  2OO4 A;  2E8E A;  4DV5 C;  2Y4N A;  4OYC A;  4DV2 C;  4JI5 C;  2P2B A;  1P7L A;  4RM3 A;  4K0K C;  4NOZ A;  2ATW A;  4IZ6 A;  4RVO A;  3NPD A;  2CY1 A;  4ZLP A;  4ZJZ A;  2D7V A;  2UUC C;  1O90 A;  3ETO A;  3ETC A;  1QWI A;  1ULT A;  4RLF A;  4JI3 C;  2V7B A;  2UXD C;  1HNX C;  2EGT A;  3GR0 A;  3GR1 A;  4X62 C;  2JMP A;  5FLX D;  4LF4 C;  2F4V C;  5BST A;  2QW0 X;  4D4I A;  1RY2 A;  2QL8 A;  4GKK C;  1MXA A;  4DG8 A;  2BH1 X;  4BC7 A;  3NI2 A;  2DPL A;  3RG2 A;  4BC9 A;  3VNS A;  4X64 C;  4JI0 C;  3CW8 X;  1T5D X;  4JI2 C;  3AF5 A;  2UXB C;  3DAY A;  3AF6 A;  5A1I A;  4B3M C;  1XMO C;  5KYV A;  4LF7 C;  3L95 X;  2Y27 A;  5BSV A;  2YCB A;  4B3R C;  1AMU A;  2D28 C;  3C5E A;  4LF8 C;  5E7Q A;  3IPL A;  4LE5 A;  4JM1 A;  5AE2 A;  1XMQ C;  2P2F A;  2UUA C;  5K85 A;  1HR0 C;  4PZP A;  4X66 C;  3VNR A;  2D1T A;  1HNZ C;  1ZB9 A;  3CJE A;  2OPL B;  3N54 B;  2D1R A;  4IR7 A;  5BUQ A;  3TDE A;  4DCV A;  2HHH C;  1KKG A;  3FCC A;  4R0M A;  3PRO C;  3IEV A;  1RG9 A;  4RMN A;  3A9V A;  1IBK C;  4L7I A;  5IFI A;  4I9F A;  2ONF A;  4K0B A;  4ODJ A;  4KTT A;  4LFA C;  1IBL C;  4PHT A;  3FCE A;  2E8C A;  4D56 A;  5KYT A;  3EQ6 A;  4KHP C;  5CZV A;  4RM2 A;  1MDF A;  1HNW C;  4DCU A;  1PA4 A;  1WF3 A;  4LF9 C;  3R44 A;  5IT9 D;  5ADZ A;  3OTO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...