4BSZA

Crystal structure of the yeast ribosomal protein rps3 in complex with its chaperone yar1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
187
structure length
187
Chain Sequence
VADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRATRTQDVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKFADGFLIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRDPAKSRTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 40S RIBOSOMAL PROTEIN S3
publication title Crystal Structure of the Yeast Ribosomal Protein Rps3 in Complex with its Chaperone Yar1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 35
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4bszA01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4bszA02
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4bszA03
4DR2C 3GKUA 3AF5A 1USPB 1PA4A 2CY1A 3OTOC 4DR1C 5LMNC 2DYJA 3EERA 1N32C 1N34C 4DV1C 4YHHC 4B3MC 2HHHC 2JMPA 1NYEA 2F4VC 1K0RA 2E7GA 4DR4C 2ASBA 2CXCA 2PT7G 4YY3C 4GKKC 4DV0C 3R9XA 2UUBC 1ZB9A 4DCVA 4JI4C 3R9WA 2ZM6C 1USPA 2UU9C 1HNWC 1MKYA 2E8CA 4LF5C 4BSZA 1WH9A 2HJGA 5BR8C 3JAMD 4B3RC 2D7VA 4JI6C 5FLXD 1KKGA 4LFCC 4JI2C 1EGAA 4DV5C 2UXDC 2PN2A 4DV6C 1IBMC 1HNZC 4JI7C 2ONFA 5IWAC 1HR0C 2ATWA 2UUAC 4DV7C 4XX2A 4JI8C 3LUSA 1ZB8A 1N33C 1JOSA 4X62C 4JYAC 1I94C 2VQFC 4DR7C 2OPLB 4KHPC 4K0KC 4DV4C 4AQYC 4LF6C 3J80D 4JI3C 2VQEC 3IEUA 1L2FA 4LF8C 1XMOC 4DV2C 1XNQC 4LFAC 4DCSA 4MH4A 4DCTA 4JV5C 2BJOA 4NOZA 3IEVA 2UXCC 1N2FA 4NXNC 1FJGC 4NXMC 1QWIA 1ML8A 4JI1C 4LFBC 4B3TC 2UUCC 4JI0C 5A2QD 5IT9D 4DUZC 4X65C 4LF4C 4MTNA 1IBLC 3J7AD 2OPLA 2XR1A 3T1YC 3T1HC 2YCBA 4DV3C 1IBKC 4GKJC 5LMUC 3CJEA 4DUYC 4JI5C 1UKKA 4OX9C 4DR6C 2UXBC 4X64C 2KZFA 4LF9C 1HNXC 4DCUA 4B3SC 2E8FA 4DR5C 1LQLA 2QL8A 2E8EA 1HH2P 2E5LC 4DR3C 1XNRC 1N36C 4X66C 1J5EC 1WF3A 3I07A 2EGTA 3J81D 3AF6A 1VLAA 1XMQC 4LF7C
chains in the Genus database with same CATH superfamily
1AMUA 2P2MA 5K85A 1PA4A 4KTVA 4ISBA 4GS5A 5LMNC 2QVZX 1N32C 4DV1C 2HHHC 4K0BA 3CW9A 1O93A 4FTFA 3H2TA 4YY3C 1MD9A 4ODJA 4DV0C 1NY8A 3LNOA 5KEIA 5LCIA 1V25A 1HNWC 5BSMA 1MKYA 2E8CA 3JAMD 1KKGA 4GXQA 4G37A 2PN2A 4D56A 1XRCA 4JI7C 4ZLPA 2ONFA 5T8SA 5IWAC 2MMAB 5AE1A 3L95X 1HR0C 2D28C 2ATWA 2P2FA 5K8FA 4PHTA 3TR3A 1P4EC 3FM7A 4X62C 2QVYX 2Y27A 4PUHA 2P2BA 2OPLB 1VEHA 3AY0A 4KHPC 4DV4C 3J80D 1XMOC 3A9UA 4LFAC 1M6XC 4WV3A 2P2QA 2D1SA 3CQ3A 3GR1A 4NOZA 3LGXA 3ETOA 2ZZMA 3N54B 1N2FA 5BSRA 5A1IA 5CZXA 3LAXA 1ML8A 1O92A 1PU1A 5A2QD 5BSTA 1V60A 4DUZC 1IBLC 2OPLA 3T1YC 3GR0A 5A1GA 4R0MA 1UKKA 4OX9C 4X64C 4LF9C 1HNXC 4IZ6A 4DCUA 2E8FA 5T8TA 4U5YD 2P20A 5H9UA 2KDNA 3KXWA 5DV9A 4G1IA 4X66C 3I07A 2P02A 4PUGA 2PG1E 1MXCA 1XMQC 4DR2C 3GKUA 1MDBA 3G7SA 3AF5A 2M5HA 2CY1A 4DR1C 3E7WA 3L8CA 4YHHC 1K0RA 3RV2A 4DR4C 2PT7G 3TUFA 3IMLA 4GXRA 3R9XA 3TQIA 2UUBC 4DCVA 3N2QA 4JI4C 2V7BA 2D1TA 4BSZA 4B3RC 5BR8C 2D7VA 3NYRA 4JI2C 2MCQA 5GTDA 2D27A 1EGAA 2VZEA 3O2EA 3VNSA 1P4EA 4XX2A 4PUIA 1N33C 4ZJZA 1UWDA 2CU6A 2VQFC 4TPSB 4LE5A 4LF6C 1M6XA 3IEUA 4I9FA 2WD9A 4L2ZA 5BSVA 4DCSA 5BUSA 3R44A 4DCTA 2VSQA 1QWIA 4G36A 1XHJA 4RLFA 2UUCC 5IT9D 4HPVA 4X65C 2Z51A 3CW8X 2M5OA 4DV3C 1IBKC 3CJEA 4DUYC 3FCEA 2QW0X 2KZFA 1TH5A 4D4GA 2PROA 2QL8A 1ULTA 2E8EA 4DG9A 5BURA 1WF3A 2AYAA 2EGTA 3AF6A 4RVNA 4PZPA 3NPDA 3A4IA 4B3SC 4FUTA 4I9GA 3S82A 2DYJA 4L4QA 1N34C 3B7WA 4B3MC 2JMPA 4PROC 2F4VC 1FUGA 2NCLA 3SO4A 3UX3A 1IB8A 3A25A 1XDXA 1RY2A 4GKKC 1LCIA 1YJ7A 5AE2A 5IFIA 1ZB9A 2ZM6C 4JM1A 3UOWA 3UZ0A 4LF5C 2BH1X 2JNVA 2OBVA 5FLXD 3DHVA 3A26A 4LFCC 3IPLA 1BA3A 1T5DX 4DV5C 2UXDC 4DV6C 1IBMC 4RMNA 4RM3A 3NI2A 2OO4A 2Y4OA 2UUAC 2YWCA 3DLPX 3LUSA 4OXIA 1JOSA 3K6RA 4JYAC 4R1LA 1I94C 5BUQA 4K0KC 1QM4A 1V26A 2Y4NA 5BSUA 4JI3C 2VQEC 4D57A 3RG2A 2QVXX 4DV2C 1XNQC 1WCJA 1MXAA 1MXBA 2DPLA 2D1RA 2UXCC 1FJGC 3I08A 1FLOA 3DAYA 4JI1C 4B3TC 4OYCA 4JI0C 4MTNA 3VNRA 3E7XA 2DHMA 3J7AD 2P2JA 5BSWA 2YWBA 1PG3A 4GKJC 5A19A 5LMUC 4DR6C 2YX1A 3PROC 1LQLA 2MM9A 2E5LC 4DR3C 1XNRC 5KYTA 1O90A 4WS9A 1N36C 1J5EC 3C5EA 4LF7C 4L7IA 3TDEA 1USPB 5KYVA 3OTOC 3PESA 2ZZNA 4R1MA 3EERA 1NYEA 3FCCA 1MDFA 2E7GA 2ASBA 3LNVA 2CXCA 2D1QA 3VNQA 5E7QA 3R9WA 4BBYA 1USPA 4DG8A 2UU9C 1T5HX 1XS3A 4BC9A 2WP0C 1WH9A 2HJGA 4JI6C 1O9TA 1PG4A 3PBKA 4BCAA 3CQ2A 1XRBA 1HNZC 2ZTBA 1XRAA 5CZVA 4DV7C 4JI8C 5JRHA 1ZB8A 4RM2A 4DR7C 1P7LA 1YGTA 4AQYC 1RG9A 3NYQA 3A9VA 3CQ1A 1L2FA 4LF8C 4RVOA 4MH4A 4JV5C 2BJOA 1GPMA 3IEVA 4NXNC 4IR7A 4FUQA 4NXMC 4LFBC 3GPCA 4LF4C 2XR1A 3T1HC 2YCBA 5AE3A 4JI5C 3ETCA 2UXBC 2KZ0A 4D4IA 5ADZA 4NDNA 4KTTA 4DR5C 2E0GA 1HH2P 3EQ6A 4RLQA 4BC7A 4EATA 3UEBA 3J81D 1VLAA 3UX2A
chains in the Genus database with same CATH topology
1AMUA 2P2MA 5K85A 1PA4A 4KTVA 4ISBA 4GS5A 5LMNC 2QVZX 1N32C 4DV1C 2HHHC 4K0BA 3CW9A 1O93A 4FTFA 3H2TA 4YY3C 1MD9A 4ODJA 4DV0C 5KEIA 1V25A 1HNWC 5BSMA 1MKYA 2E8CA 3JAMD 1KKGA 4GXQA 4G37A 2PN2A 4D56A 1XRCA 4JI7C 4ZLPA 2ONFA 5T8SA 5IWAC 5AE1A 3L95X 1HR0C 2D28C 2ATWA 2P2FA 5K8FA 4PHTA 4X62C 2QVYX 2Y27A 2P2BA 2OPLB 4KHPC 4DV4C 3J80D 1XMOC 3A9UA 4LFAC 4WV3A 2P2QA 2D1SA 3GR1A 4NOZA 3LGXA 3ETOA 3N54B 1N2FA 5BSRA 5A1IA 5CZXA 3LAXA 1ML8A 1O92A 5A2QD 5BSTA 4DUZC 1IBLC 2OPLA 3T1YC 3GR0A 5A1GA 4R0MA 1UKKA 4OX9C 4X64C 4LF9C 1HNXC 4IZ6A 4DCUA 2E8FA 5T8TA 4U5YD 2P20A 5H9UA 3KXWA 5DV9A 4G1IA 4X66C 3I07A 2P02A 1MXCA 1XMQC 4DR2C 3GKUA 1MDBA 3G7SA 3AF5A 2CY1A 4DR1C 3E7WA 3L8CA 4YHHC 1K0RA 3RV2A 4DR4C 2PT7G 3TUFA 3IMLA 4GXRA 3R9XA 3TQIA 2UUBC 4DCVA 3N2QA 4JI4C 2V7BA 2D1TA 4BSZA 4B3RC 5BR8C 2D7VA 3NYRA 4JI2C 5GTDA 2D27A 1EGAA 2VZEA 3VNSA 4XX2A 1N33C 4ZJZA 2VQFC 4TPSB 4LE5A 4LF6C 3IEUA 4I9FA 2WD9A 4L2ZA 5BSVA 4DCSA 5BUSA 3R44A 4DCTA 2VSQA 1QWIA 4G36A 4RLFA 2UUCC 5IT9D 4HPVA 4X65C 3CW8X 4DV3C 1IBKC 3CJEA 4DUYC 3FCEA 2QW0X 2KZFA 4D4GA 2PROA 2QL8A 1ULTA 2E8EA 4DG9A 5BURA 1WF3A 2AYAA 2EGTA 3AF6A 4RVNA 4PZPA 3NPDA 3A4IA 4B3SC 4FUTA 4I9GA 3S82A 2DYJA 4L4QA 1N34C 3B7WA 4B3MC 2JMPA 4PROC 2F4VC 1FUGA 3SO4A 1RY2A 4GKKC 1LCIA 1YJ7A 5AE2A 5IFIA 1ZB9A 2ZM6C 4JM1A 3UOWA 3UZ0A 4LF5C 2BH1X 2OBVA 5FLXD 3DHVA 4LFCC 3IPLA 1BA3A 1T5DX 4DV5C 2UXDC 4DV6C 1IBMC 4RMNA 4RM3A 3NI2A 2OO4A 2Y4OA 2UUAC 2YWCA 3DLPX 3LUSA 4OXIA 1JOSA 4JYAC 4R1LA 1I94C 5BUQA 4K0KC 1QM4A 1V26A 2Y4NA 5BSUA 4JI3C 2VQEC 4D57A 3RG2A 2QVXX 4DV2C 1XNQC 1MXAA 1MXBA 2DPLA 2D1RA 2UXCC 1FJGC 3I08A 3DAYA 4JI1C 4B3TC 4OYCA 4JI0C 4MTNA 3VNRA 3E7XA 3J7AD 2P2JA 5BSWA 2YWBA 1PG3A 4GKJC 5A19A 5LMUC 4DR6C 3PROC 1LQLA 2E5LC 4DR3C 1XNRC 5KYTA 1O90A 4WS9A 1N36C 1J5EC 3C5EA 4LF7C 4L7IA 3TDEA 1USPB 5KYVA 3OTOC 3PESA 4R1MA 3EERA 1NYEA 3FCCA 1MDFA 2E7GA 2ASBA 3LNVA 2CXCA 2D1QA 3VNQA 5E7QA 3R9WA 4BBYA 1USPA 4DG8A 2UU9C 1T5HX 4BC9A 2WP0C 1WH9A 2HJGA 4JI6C 1O9TA 1PG4A 3PBKA 4BCAA 1XRBA 1HNZC 1XRAA 5CZVA 4DV7C 4JI8C 5JRHA 1ZB8A 4RM2A 4DR7C 1P7LA 4AQYC 1RG9A 3NYQA 3A9VA 1L2FA 4LF8C 4RVOA 4MH4A 4JV5C 2BJOA 1GPMA 3IEVA 4NXNC 4IR7A 4FUQA 4NXMC 4LFBC 3GPCA 4LF4C 2XR1A 3T1HC 2YCBA 5AE3A 4JI5C 3ETCA 2UXBC 4D4IA 5ADZA 4NDNA 4KTTA 4DR5C 2E0GA 1HH2P 3EQ6A 4RLQA 4BC7A 4EATA 3J81D 1VLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 C;  3GKU A;  3AF5 A;  1USP B;  1PA4 A;  2CY1 A;  3OTO C;  4DR1 C;  5LMN C;  2DYJ A;  3EER A;  1N32 C;  1N34 C;  4DV1 C;  4YHH C;  4B3M C;  2HHH C;  2JMP A;  1NYE A;  2F4V C;  1K0R A;  2E7G A;  4DR4 C;  2ASB A;  2CXC A;  2PT7 G;  4YY3 C;  4GKK C;  4DV0 C;  3R9X A;  2UUB C;  1ZB9 A;  4DCV A;  4JI4 C;  3R9W A;  2ZM6 C;  1USP A;  2UU9 C;  1HNW C;  1MKY A;  2E8C A;  4LF5 C;  4BSZ A;  1WH9 A;  2HJG A;  5BR8 C;  3JAM D;  4B3R C;  2D7V A;  4JI6 C;  5FLX D;  1KKG A;  4LFC C;  4JI2 C;  1EGA A;  4DV5 C;  2UXD C;  2PN2 A;  4DV6 C;  1IBM C;  1HNZ C;  4JI7 C;  2ONF A;  5IWA C;  1HR0 C;  2ATW A;  2UUA C;  4DV7 C;  4XX2 A;  4JI8 C;  3LUS A;  1ZB8 A;  1N33 C;  1JOS A;  4X62 C;  4JYA C;  1I94 C;  2VQF C;  4DR7 C;  2OPL B;  4KHP C;  4K0K C;  4DV4 C;  4AQY C;  4LF6 C;  3J80 D;  4JI3 C;  2VQE C;  3IEU A;  1L2F A;  4LF8 C;  1XMO C;  4DV2 C;  1XNQ C;  4LFA C;  4DCS A;  4MH4 A;  4DCT A;  4JV5 C;  2BJO A;  4NOZ A;  3IEV A;  2UXC C;  1N2F A;  4NXN C;  1FJG C;  4NXM C;  1QWI A;  1ML8 A;  4JI1 C;  4LFB C;  4B3T C;  2UUC C;  4JI0 C;  5A2Q D;  5IT9 D;  4DUZ C;  4X65 C;  4LF4 C;  4MTN A;  1IBL C;  3J7A D;  2OPL A;  2XR1 A;  3T1Y C;  3T1H C;  2YCB A;  4DV3 C;  1IBK C;  4GKJ C;  5LMU C;  3CJE A;  4DUY C;  4JI5 C;  1UKK A;  4OX9 C;  4DR6 C;  2UXB C;  4X64 C;  2KZF A;  4LF9 C;  1HNX C;  4DCU A;  4B3S C;  2E8F A;  4DR5 C;  1LQL A;  2QL8 A;  2E8E A;  1HH2 P;  2E5L C;  4DR3 C;  1XNR C;  1N36 C;  4X66 C;  1J5E C;  1WF3 A;  3I07 A;  2EGT A;  3J81 D;  3AF6 A;  1VLA A;  1XMQ C;  4LF7 C; 
#chains in the Genus database with same CATH topology
 1AMU A;  2P2M A;  5K85 A;  1PA4 A;  4KTV A;  4ISB A;  4GS5 A;  5LMN C;  2QVZ X;  1N32 C;  4DV1 C;  2HHH C;  4K0B A;  3CW9 A;  1O93 A;  4FTF A;  3H2T A;  4YY3 C;  1MD9 A;  4ODJ A;  4DV0 C;  1NY8 A;  3LNO A;  5KEI A;  5LCI A;  1V25 A;  1HNW C;  5BSM A;  1MKY A;  2E8C A;  3JAM D;  1KKG A;  4GXQ A;  4G37 A;  2PN2 A;  4D56 A;  1XRC A;  4JI7 C;  4ZLP A;  2ONF A;  5T8S A;  5IWA C;  2MMA B;  5AE1 A;  3L95 X;  1HR0 C;  2D28 C;  2ATW A;  2P2F A;  5K8F A;  4PHT A;  3TR3 A;  1P4E C;  3FM7 A;  4X62 C;  2QVY X;  2Y27 A;  4PUH A;  2P2B A;  2OPL B;  1VEH A;  3AY0 A;  4KHP C;  4DV4 C;  3J80 D;  1XMO C;  3A9U A;  4LFA C;  1M6X C;  4WV3 A;  2P2Q A;  2D1S A;  3CQ3 A;  3GR1 A;  4NOZ A;  3LGX A;  3ETO A;  2ZZM A;  3N54 B;  1N2F A;  5BSR A;  5A1I A;  5CZX A;  3LAX A;  1ML8 A;  1O92 A;  1PU1 A;  5A2Q D;  5BST A;  1V60 A;  4DUZ C;  1IBL C;  2OPL A;  3T1Y C;  3GR0 A;  5A1G A;  4R0M A;  1UKK A;  4OX9 C;  4X64 C;  4LF9 C;  1HNX C;  4IZ6 A;  4DCU A;  2E8F A;  5T8T A;  4U5Y D;  2P20 A;  5H9U A;  2KDN A;  3KXW A;  5DV9 A;  4G1I A;  4X66 C;  3I07 A;  2P02 A;  4PUG A;  2PG1 E;  1MXC A;  1XMQ C;  4DR2 C;  3GKU A;  1MDB A;  3G7S A;  3AF5 A;  2M5H A;  2CY1 A;  4DR1 C;  3E7W A;  3L8C A;  4YHH C;  1K0R A;  3RV2 A;  4DR4 C;  2PT7 G;  3TUF A;  3IML A;  4GXR A;  3R9X A;  3TQI A;  2UUB C;  4DCV A;  3N2Q A;  4JI4 C;  2V7B A;  2D1T A;  4BSZ A;  4B3R C;  5BR8 C;  2D7V A;  3NYR A;  4JI2 C;  2MCQ A;  5GTD A;  2D27 A;  1EGA A;  2VZE A;  3O2E A;  3VNS A;  1P4E A;  4XX2 A;  4PUI A;  1N33 C;  4ZJZ A;  1UWD A;  2CU6 A;  2VQF C;  4TPS B;  4LE5 A;  4LF6 C;  1M6X A;  3IEU A;  4I9F A;  2WD9 A;  4L2Z A;  5BSV A;  4DCS A;  5BUS A;  3R44 A;  4DCT A;  2VSQ A;  1QWI A;  4G36 A;  1XHJ A;  4RLF A;  2UUC C;  5IT9 D;  4HPV A;  4X65 C;  2Z51 A;  3CW8 X;  2M5O A;  4DV3 C;  1IBK C;  3CJE A;  4DUY C;  3FCE A;  2QW0 X;  2KZF A;  1TH5 A;  4D4G A;  2PRO A;  2QL8 A;  1ULT A;  2E8E A;  4DG9 A;  5BUR A;  1WF3 A;  2AYA A;  2EGT A;  3AF6 A;  4RVN A;  4PZP A;  3NPD A;  3A4I A;  4B3S C;  4FUT A;  4I9G A;  3S82 A;  2DYJ A;  4L4Q A;  1N34 C;  3B7W A;  4B3M C;  2JMP A;  4PRO C;  2F4V C;  1FUG A;  2NCL A;  3SO4 A;  3UX3 A;  1IB8 A;  3A25 A;  1XDX A;  1RY2 A;  4GKK C;  1LCI A;  1YJ7 A;  5AE2 A;  5IFI A;  1ZB9 A;  2ZM6 C;  4JM1 A;  3UOW A;  3UZ0 A;  4LF5 C;  2BH1 X;  2JNV A;  2OBV A;  5FLX D;  3DHV A;  3A26 A;  4LFC C;  3IPL A;  1BA3 A;  1T5D X;  4DV5 C;  2UXD C;  4DV6 C;  1IBM C;  4RMN A;  4RM3 A;  3NI2 A;  2OO4 A;  2Y4O A;  2UUA C;  2YWC A;  3DLP X;  3LUS A;  4OXI A;  1JOS A;  3K6R A;  4JYA C;  4R1L A;  1I94 C;  5BUQ A;  4K0K C;  1QM4 A;  1V26 A;  2Y4N A;  5BSU A;  4JI3 C;  2VQE C;  4D57 A;  3RG2 A;  2QVX X;  4DV2 C;  1XNQ C;  1WCJ A;  1MXA A;  1MXB A;  2DPL A;  2D1R A;  2UXC C;  1FJG C;  3I08 A;  1FLO A;  3DAY A;  4JI1 C;  4B3T C;  4OYC A;  4JI0 C;  4MTN A;  3VNR A;  3E7X A;  2DHM A;  3J7A D;  2P2J A;  5BSW A;  2YWB A;  1PG3 A;  4GKJ C;  5A19 A;  5LMU C;  4DR6 C;  2YX1 A;  3PRO C;  1LQL A;  2MM9 A;  2E5L C;  4DR3 C;  1XNR C;  5KYT A;  1O90 A;  4WS9 A;  1N36 C;  1J5E C;  3C5E A;  4LF7 C;  4L7I A;  3TDE A;  1USP B;  5KYV A;  3OTO C;  3PES A;  2ZZN A;  4R1M A;  3EER A;  1NYE A;  3FCC A;  1MDF A;  2E7G A;  2ASB A;  3LNV A;  2CXC A;  2D1Q A;  3VNQ A;  5E7Q A;  3R9W A;  4BBY A;  1USP A;  4DG8 A;  2UU9 C;  1T5H X;  1XS3 A;  4BC9 A;  2WP0 C;  1WH9 A;  2HJG A;  4JI6 C;  1O9T A;  1PG4 A;  3PBK A;  4BCA A;  3CQ2 A;  1XRB A;  1HNZ C;  2ZTB A;  1XRA A;  5CZV A;  4DV7 C;  4JI8 C;  5JRH A;  1ZB8 A;  4RM2 A;  4DR7 C;  1P7L A;  1YGT A;  4AQY C;  1RG9 A;  3NYQ A;  3A9V A;  3CQ1 A;  1L2F A;  4LF8 C;  4RVO A;  4MH4 A;  4JV5 C;  2BJO A;  1GPM A;  3IEV A;  4NXN C;  4IR7 A;  4FUQ A;  4NXM C;  4LFB C;  3GPC A;  4LF4 C;  2XR1 A;  3T1H C;  2YCB A;  5AE3 A;  4JI5 C;  3ETC A;  2UXB C;  2KZ0 A;  4D4I A;  5ADZ A;  4NDN A;  4KTT A;  4DR5 C;  2E0G A;  1HH2 P;  3EQ6 A;  4RLQ A;  4BC7 A;  4EAT A;  3UEB A;  3J81 D;  1VLA A;  3UX2 A; 
#chains in the Genus database with same CATH homology
 1AMU A;  2P2M A;  5K85 A;  1PA4 A;  4KTV A;  4ISB A;  4GS5 A;  5LMN C;  2QVZ X;  1N32 C;  4DV1 C;  2HHH C;  4K0B A;  3CW9 A;  1O93 A;  4FTF A;  3H2T A;  4YY3 C;  1MD9 A;  4ODJ A;  4DV0 C;  5KEI A;  1V25 A;  1HNW C;  5BSM A;  1MKY A;  2E8C A;  3JAM D;  1KKG A;  4GXQ A;  4G37 A;  2PN2 A;  4D56 A;  1XRC A;  4JI7 C;  4ZLP A;  2ONF A;  5T8S A;  5IWA C;  5AE1 A;  3L95 X;  1HR0 C;  2D28 C;  2ATW A;  2P2F A;  5K8F A;  4PHT A;  4X62 C;  2QVY X;  2Y27 A;  2P2B A;  2OPL B;  4KHP C;  4DV4 C;  3J80 D;  1XMO C;  3A9U A;  4LFA C;  4WV3 A;  2P2Q A;  2D1S A;  3GR1 A;  4NOZ A;  3LGX A;  3ETO A;  3N54 B;  1N2F A;  5BSR A;  5A1I A;  5CZX A;  3LAX A;  1ML8 A;  1O92 A;  5A2Q D;  5BST A;  4DUZ C;  1IBL C;  2OPL A;  3T1Y C;  3GR0 A;  5A1G A;  4R0M A;  1UKK A;  4OX9 C;  4X64 C;  4LF9 C;  1HNX C;  4IZ6 A;  4DCU A;  2E8F A;  5T8T A;  4U5Y D;  2P20 A;  5H9U A;  3KXW A;  5DV9 A;  4G1I A;  4X66 C;  3I07 A;  2P02 A;  1MXC A;  1XMQ C;  4DR2 C;  3GKU A;  1MDB A;  3G7S A;  3AF5 A;  2CY1 A;  4DR1 C;  3E7W A;  3L8C A;  4YHH C;  1K0R A;  3RV2 A;  4DR4 C;  2PT7 G;  3TUF A;  3IML A;  4GXR A;  3R9X A;  3TQI A;  2UUB C;  4DCV A;  3N2Q A;  4JI4 C;  2V7B A;  2D1T A;  4BSZ A;  4B3R C;  5BR8 C;  2D7V A;  3NYR A;  4JI2 C;  5GTD A;  2D27 A;  1EGA A;  2VZE A;  3VNS A;  4XX2 A;  1N33 C;  4ZJZ A;  2VQF C;  4TPS B;  4LE5 A;  4LF6 C;  3IEU A;  4I9F A;  2WD9 A;  4L2Z A;  5BSV A;  4DCS A;  5BUS A;  3R44 A;  4DCT A;  2VSQ A;  1QWI A;  4G36 A;  4RLF A;  2UUC C;  5IT9 D;  4HPV A;  4X65 C;  3CW8 X;  4DV3 C;  1IBK C;  3CJE A;  4DUY C;  3FCE A;  2QW0 X;  2KZF A;  4D4G A;  2PRO A;  2QL8 A;  1ULT A;  2E8E A;  4DG9 A;  5BUR A;  1WF3 A;  2AYA A;  2EGT A;  3AF6 A;  4RVN A;  4PZP A;  3NPD A;  3A4I A;  4B3S C;  4FUT A;  4I9G A;  3S82 A;  2DYJ A;  4L4Q A;  1N34 C;  3B7W A;  4B3M C;  2JMP A;  4PRO C;  2F4V C;  1FUG A;  3SO4 A;  1RY2 A;  4GKK C;  1LCI A;  1YJ7 A;  5AE2 A;  5IFI A;  1ZB9 A;  2ZM6 C;  4JM1 A;  3UOW A;  3UZ0 A;  4LF5 C;  2BH1 X;  2OBV A;  5FLX D;  3DHV A;  4LFC C;  3IPL A;  1BA3 A;  1T5D X;  4DV5 C;  2UXD C;  4DV6 C;  1IBM C;  4RMN A;  4RM3 A;  3NI2 A;  2OO4 A;  2Y4O A;  2UUA C;  2YWC A;  3DLP X;  3LUS A;  4OXI A;  1JOS A;  4JYA C;  4R1L A;  1I94 C;  5BUQ A;  4K0K C;  1QM4 A;  1V26 A;  2Y4N A;  5BSU A;  4JI3 C;  2VQE C;  4D57 A;  3RG2 A;  2QVX X;  4DV2 C;  1XNQ C;  1MXA A;  1MXB A;  2DPL A;  2D1R A;  2UXC C;  1FJG C;  3I08 A;  3DAY A;  4JI1 C;  4B3T C;  4OYC A;  4JI0 C;  4MTN A;  3VNR A;  3E7X A;  3J7A D;  2P2J A;  5BSW A;  2YWB A;  1PG3 A;  4GKJ C;  5A19 A;  5LMU C;  4DR6 C;  3PRO C;  1LQL A;  2E5L C;  4DR3 C;  1XNR C;  5KYT A;  1O90 A;  4WS9 A;  1N36 C;  1J5E C;  3C5E A;  4LF7 C;  4L7I A;  3TDE A;  1USP B;  5KYV A;  3OTO C;  3PES A;  4R1M A;  3EER A;  1NYE A;  3FCC A;  1MDF A;  2E7G A;  2ASB A;  3LNV A;  2CXC A;  2D1Q A;  3VNQ A;  5E7Q A;  3R9W A;  4BBY A;  1USP A;  4DG8 A;  2UU9 C;  1T5H X;  4BC9 A;  2WP0 C;  1WH9 A;  2HJG A;  4JI6 C;  1O9T A;  1PG4 A;  3PBK A;  4BCA A;  1XRB A;  1HNZ C;  1XRA A;  5CZV A;  4DV7 C;  4JI8 C;  5JRH A;  1ZB8 A;  4RM2 A;  4DR7 C;  1P7L A;  4AQY C;  1RG9 A;  3NYQ A;  3A9V A;  1L2F A;  4LF8 C;  4RVO A;  4MH4 A;  4JV5 C;  2BJO A;  1GPM A;  3IEV A;  4NXN C;  4IR7 A;  4FUQ A;  4NXM C;  4LFB C;  3GPC A;  4LF4 C;  2XR1 A;  3T1H C;  2YCB A;  5AE3 A;  4JI5 C;  3ETC A;  2UXB C;  4D4I A;  5ADZ A;  4NDN A;  4KTT A;  4DR5 C;  2E0G A;  1HH2 P;  3EQ6 A;  4RLQ A;  4BC7 A;  4EAT A;  3J81 D;  1VLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...