4BSZA

Crystal structure of the yeast ribosomal protein rps3 in complex with its chaperone yar1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
187
structure length
187
Chain Sequence
b'VADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRATRTQDVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKFADGFLIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRDPAKSRTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 40S RIBOSOMAL PROTEIN S3
publication title Crystal Structure of the Yeast Ribosomal Protein Rps3 in Complex with its Chaperone Yar1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 35
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4bszA01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4bszA02
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4bszA03
1WF3A 5A2QD 4NXMC 4DV4C 2E8CA 3GKUA 3I07A 1HH2P 4DUYC 4DV2C 4LF8C 2EGTA 3AF5A 4DR7C 2ZM6C 4NOZA 1UKKA 4GKKC 5LMUC 4DR2C 1HNWC 4JI3C 4JI8C 4JI6C 4DR5C 3OTOC 1PA4A 5FLXD 2PT7G 4DUZC 1L2FA 4B3SC 2F4VC 4DV1C 2HJGA 4DCTA 1N36C 4B3MC 4MTNA 1JOSA 4DR1C 1N33C 1N34C 3R9WA 4OX9C 5LMNC 2VQFC 4LFCC 3LUSA 3JAMD 1VLAA 5IT9D 2UU9C 3J81D 4DV3C 4AQYC 2E8FA 1NYEA 3IEVA 2UUAC 4GKJC 2QL8A 1LQLA 1K0RA 1HR0C 2E5LC 1WH9A 2UXDC 3CJEA 4YHHC 2D7VA 2VQEC 4DCUA 1I94C 1HNXC 1N2FA 4K0KC 2UXCC 2OPLB 3IEUA 4DV0C 2ASBA 3R9XA 2XR1A 4X66C 1USPB 1IBKC 2CY1A 2YCBA 4DR4C 1IBMC 1FJGC 2CXCA 5BR8C 4LF7C 2E7GA 3J7AD 1XMQC 4MH4A 1IBLC 2DYJA 2UUBC 3EERA 4JI0C 4DV7C 3AF6A 4LFBC 2E8EA 1MKYA 3T1YC 4DR3C 4LF5C 1KKGA 4BSZA 1XNRC 4LF6C 4LF9C 2BJOA 4JI4C 4JI2C 4X65C 4YY3C 4JI1C 4JI5C 4NXNC 4B3TC 1N32C 1ML8A 3J80D 4DCSA 2ATWA 4DR6C 4LFAC 2OPLA 1QWIA 4X62C 3T1HC 4JV5C 4DV6C 4KHPC 4JI7C 1ZB8A 4JYAC 2JMPA 4DCVA 4B3RC 1USPA 4LF4C 2UXBC 2ONFA 4DV5C 2HHHC 1EGAA 1ZB9A 5IWAC 1HNZC 1J5EC 2PN2A 4XX2A 1XMOC 1XNQC 2KZFA 2UUCC 4X64C
chains in the Genus database with same CATH superfamily
1IB8A 4G1IA 4NXMC 2P02A 3I07A 5T8TA 4DUYC 3AF5A 4NOZA 1BA3A 3RG2A 4I9FA 4DR5C 4BC9A 5FLXD 5LCIA 2WP0C 2F4VC 2P20A 1AMUA 5CZVA 1ULTA 2PROA 3CQ3A 3IMLA 4DR1C 1MDFA 4G36A 2OBVA 4KTTA 3L95X 3JAMD 1V25A 2UU9C 3J81D 5K85A 4AQYC 2E8FA 1NYEA 1QM4A 2JNVA 2KZ0A 2QL8A 1LQLA 1HR0C 5BUSA 1MXCA 2UXDC 4K0KC 3PBKA 1T5HX 2OPLB 2OO4A 3R9XA 4X66C 3A4IA 1PG3A 2YCBA 5BSWA 2P2BA 2YWCA 1O90A 4LF7C 4RM2A 2BH1X 3B7WA 2WD9A 4DV7C 3AF6A 4L4QA 5BSMA 5GTDA 3FCEA 4G37A 1XNRC 5T8SA 3A9VA 5AE3A 4FUTA 4PHTA 4RVNA 3J80D 2Y4NA 3UX3A 1RG9A 4OYCA 1PG4A 4LFAC 2VZEA 1V60A 3EQ6A 4JM1A 4DV6C 4JI7C 4JYAC 3N2QA 4PZPA 1USPA 4LF4C 1T5DX 1EGAA 5A19A 5E7QA 2KZFA 5BSVA 4RLQA 4BCAA 4X64C 1WF3A 1HH2P 5H9UA 4DR7C 2ZM6C 1UKKA 5LMUC 4DR2C 1P4EA 4JI3C 2AYAA 4JI6C 4DG9A 2VSQA 3OTOC 1V26A 4ZLPA 2NCLA 2Y27A 3RV2A 4B3SC 2HJGA 4D4GA 4ODJA 2D1QA 4MTNA 3DLPX 1N33C 4OX9C 2YX1A 2Z51A 4I9GA 1VLAA 3NYRA 3L8CA 3A25A 1MXBA 3GPCA 1WH9A 3KXWA 4YHHC 2D7VA 2VQEC 5K8FA 1I94C 2UXCC 4DV0C 1YJ7A 1USPB 4FTFA 4U5YD 3CW9A 2CXCA 2KDNA 1PU1A 4MH4A 4NDNA 2DYJA 4JI0C 4RLFA 2M5OA 3E7WA 3K6RA 2E8EA 4WV3A 1O93A 3S82A 2MMAB 1KKGA 3A26A 4DR3C 2P2FA 4BSZA 4LF6C 4LF9C 3UZ0A 5A1IA 4JI2C 3E7XA 4NXNC 4R1LA 3GR0A 2PG1E 1M6XA 4DR6C 2MM9A 5BUQA 1O92A 3G7SA 3VNQA 2ONFA 1VEHA 1MXAA 5IWAC 1J5EC 4KTVA 3LGXA 1MD9A 4D4IA 5A2QD 1LCIA 4BC7A 2D1TA 4LF8C 2EGTA 1UWDA 3IPLA 5BURA 1HNWC 4JI8C 2P2MA 3ETOA 4PUIA 1PA4A 1L2FA 4DV1C 3FCCA 1WCJA 3CQ1A 4PUHA 2QVZX 2QVYX 4B3MC 4ZJZA 3A9UA 4IZ6A 3TUFA 3R9WA 4OXIA 1XRCA 5CZXA 2D1RA 5JRHA 3LUSA 4GS5A 5IT9D 3LAXA 5AE1A 4L7IA 3O2EA 4R1MA 4DV3C 5BSRA 3UX2A 5KYTA 2YWBA 4GKJC 1K0RA 1XRAA 2E5LC 3R44A 2V7BA 1N2FA 4LE5A 2Y4OA 3IEUA 1FLOA 4RVOA 1P4EC 1GPMA 2CY1A 1IBMC 3VNRA 3PESA 4RMNA 2E7GA 1P7LA 1XS3A 1FUGA 4EATA 4IR7A 3PROC 4LFBC 1XHJA 3DAYA 4TPSB 2BJOA 4JI4C 4X65C 4YY3C 4JI1C 1YGTA 1N32C 1ML8A 2D27A 4DCSA 3TR3A 2MCQA 2M5HA 4BBYA 3T1HC 4KHPC 1ZB8A 2JMPA 4DCVA 1HNZC 4XX2A 1XMOC 2D1SA 4ISBA 1XNQC 3CW8X 2UUCC 1O9TA 2QW0X 3VNSA 5BSTA 4DV4C 2E8CA 3GKUA 4R0MA 5KEIA 4DV2C 4D57A 4GKKC 3AY0A 3UOWA 1NY8A 5ADZA 3ETCA 2PT7G 4DUZC 3CQ2A 2QVXX 2DPLA 4DCTA 4GXQA 2D28C 3NYQA 1N36C 1JOSA 2CU6A 5KYVA 3N54B 1N34C 1M6XC 5LMNC 2VQFC 3H2TA 4LFCC 3NPDA 5DV9A 3UEBA 1RY2A 3IEVA 2ZZMA 2UUAC 1XDXA 1TH5A 3CJEA 4DG8A 3TQIA 4DCUA 1HNXC 3I08A 3DHVA 2ASBA 4WS9A 1MDBA 3C5EA 4PROC 5A1GA 2XR1A 1IBKC 4DR4C 1FJGC 5BR8C 4HPVA 3J7AD 4GXRA 1XMQC 2ZTBA 3GR1A 1IBLC 2UUBC 3EERA 2DHMA 3TDEA 5BSUA 4D56A 1MKYA 4L2ZA 3T1YC 4LF5C 2ZZNA 4K0BA 1XRBA 4JI5C 4B3TC 2P2QA 3SO4A 2ATWA 2P2JA 2OPLA 1QWIA 4X62C 3FM7A 4JV5C 3LNOA 2E0GA 3NI2A 4PUGA 4B3RC 2UXBC 4DV5C 2HHHC 4FUQA 1ZB9A 3LNVA 2PN2A 5IFIA 5AE2A 4RM3A
chains in the Genus database with same CATH topology
4G1IA 4NXMC 2P02A 3I07A 5T8TA 4DUYC 3AF5A 4NOZA 1BA3A 3RG2A 4I9FA 4DR5C 4BC9A 5FLXD 2WP0C 2F4VC 2P20A 1AMUA 5CZVA 1ULTA 2PROA 3IMLA 4DR1C 1MDFA 4G36A 2OBVA 4KTTA 3L95X 3JAMD 1V25A 2UU9C 3J81D 5K85A 4AQYC 2E8FA 1NYEA 1QM4A 2QL8A 1LQLA 1HR0C 5BUSA 1MXCA 2UXDC 4K0KC 3PBKA 1T5HX 2OPLB 2OO4A 3R9XA 4X66C 3A4IA 1PG3A 2YCBA 5BSWA 2P2BA 2YWCA 1O90A 4LF7C 4RM2A 2BH1X 3B7WA 2WD9A 4DV7C 3AF6A 4L4QA 5BSMA 5GTDA 3FCEA 4G37A 1XNRC 5T8SA 3A9VA 5AE3A 4FUTA 4PHTA 4RVNA 3J80D 2Y4NA 1RG9A 4OYCA 1PG4A 4LFAC 2VZEA 3EQ6A 4JM1A 4DV6C 4JI7C 4JYAC 3N2QA 4PZPA 1USPA 4LF4C 1T5DX 1EGAA 5A19A 5E7QA 2KZFA 5BSVA 4RLQA 4BCAA 4X64C 1WF3A 1HH2P 5H9UA 4DR7C 2ZM6C 1UKKA 5LMUC 4DR2C 4JI3C 2AYAA 4JI6C 4DG9A 2VSQA 3OTOC 1V26A 4ZLPA 3RV2A 2Y27A 4B3SC 2HJGA 4D4GA 4ODJA 2D1QA 4MTNA 3DLPX 1N33C 4OX9C 4I9GA 1VLAA 3NYRA 3L8CA 1MXBA 3GPCA 1WH9A 3KXWA 4YHHC 2D7VA 2VQEC 5K8FA 1I94C 2UXCC 4DV0C 1YJ7A 1USPB 4FTFA 4U5YD 3CW9A 2CXCA 4MH4A 4NDNA 2DYJA 4JI0C 4RLFA 3E7WA 2E8EA 4WV3A 1O93A 3S82A 1KKGA 4DR3C 2P2FA 4BSZA 4LF6C 4LF9C 3UZ0A 5A1IA 4JI2C 3E7XA 4NXNC 4R1LA 3GR0A 4DR6C 5BUQA 1O92A 3G7SA 3VNQA 2ONFA 1MXAA 5IWAC 1J5EC 4KTVA 3LGXA 1MD9A 4D4IA 5A2QD 1LCIA 4BC7A 2D1TA 4LF8C 2EGTA 3IPLA 5BURA 1HNWC 4JI8C 2P2MA 3ETOA 1PA4A 1L2FA 4DV1C 3FCCA 2QVZX 2QVYX 4B3MC 4ZJZA 3A9UA 4IZ6A 3TUFA 3R9WA 4OXIA 1XRCA 5CZXA 2D1RA 5JRHA 3LUSA 4GS5A 5IT9D 3LAXA 5AE1A 4L7IA 4R1MA 4DV3C 5BSRA 5KYTA 2YWBA 4GKJC 1K0RA 1XRAA 2E5LC 3R44A 2V7BA 1N2FA 4LE5A 2Y4OA 3IEUA 4RVOA 1GPMA 2CY1A 1IBMC 3VNRA 3PESA 4RMNA 2E7GA 1P7LA 1FUGA 4EATA 4IR7A 3PROC 4LFBC 3DAYA 4TPSB 2BJOA 4JI4C 4X65C 4YY3C 4JI1C 1N32C 1ML8A 2D27A 4DCSA 4BBYA 3T1HC 4KHPC 1ZB8A 2JMPA 4DCVA 1HNZC 1XMOC 4XX2A 2D1SA 4ISBA 1XNQC 3CW8X 2UUCC 1O9TA 2QW0X 3VNSA 5BSTA 4DV4C 2E8CA 3GKUA 4R0MA 5KEIA 4DV2C 4D57A 4GKKC 3UOWA 5ADZA 3ETCA 2PT7G 4DUZC 2QVXX 2DPLA 4DCTA 4GXQA 2D28C 3NYQA 1N36C 1JOSA 5KYVA 3N54B 1N34C 5LMNC 2VQFC 3H2TA 4LFCC 3NPDA 5DV9A 1RY2A 3IEVA 2UUAC 3CJEA 4DG8A 3TQIA 4DCUA 1HNXC 3I08A 3DHVA 2ASBA 4WS9A 1MDBA 3C5EA 4PROC 5A1GA 2XR1A 1IBKC 4DR4C 1FJGC 5BR8C 4HPVA 3J7AD 4GXRA 1XMQC 3GR1A 1IBLC 2UUBC 3EERA 3TDEA 5BSUA 4D56A 3T1YC 1MKYA 4L2ZA 4LF5C 4K0BA 1XRBA 4JI5C 4B3TC 2P2QA 3SO4A 2ATWA 2P2JA 2OPLA 1QWIA 4X62C 4JV5C 2E0GA 3NI2A 4B3RC 2UXBC 4DV5C 2HHHC 4FUQA 1ZB9A 3LNVA 2PN2A 5IFIA 5AE2A 4RM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WF3 A;  5A2Q D;  4NXM C;  4DV4 C;  2E8C A;  3GKU A;  3I07 A;  1HH2 P;  4DUY C;  4DV2 C;  4LF8 C;  2EGT A;  3AF5 A;  4DR7 C;  2ZM6 C;  4NOZ A;  1UKK A;  4GKK C;  5LMU C;  4DR2 C;  1HNW C;  4JI3 C;  4JI8 C;  4JI6 C;  4DR5 C;  3OTO C;  1PA4 A;  5FLX D;  2PT7 G;  4DUZ C;  1L2F A;  4B3S C;  2F4V C;  4DV1 C;  2HJG A;  4DCT A;  1N36 C;  4B3M C;  4MTN A;  1JOS A;  4DR1 C;  1N33 C;  1N34 C;  3R9W A;  4OX9 C;  5LMN C;  2VQF C;  4LFC C;  3LUS A;  3JAM D;  1VLA A;  5IT9 D;  2UU9 C;  3J81 D;  4DV3 C;  4AQY C;  2E8F A;  1NYE A;  3IEV A;  2UUA C;  4GKJ C;  2QL8 A;  1LQL A;  1K0R A;  1HR0 C;  2E5L C;  1WH9 A;  2UXD C;  3CJE A;  4YHH C;  2D7V A;  2VQE C;  4DCU A;  1I94 C;  1HNX C;  1N2F A;  4K0K C;  2UXC C;  2OPL B;  3IEU A;  4DV0 C;  2ASB A;  3R9X A;  2XR1 A;  4X66 C;  1USP B;  1IBK C;  2CY1 A;  2YCB A;  4DR4 C;  1IBM C;  1FJG C;  2CXC A;  5BR8 C;  4LF7 C;  2E7G A;  3J7A D;  1XMQ C;  4MH4 A;  1IBL C;  2DYJ A;  2UUB C;  3EER A;  4JI0 C;  4DV7 C;  3AF6 A;  4LFB C;  2E8E A;  1MKY A;  3T1Y C;  4DR3 C;  4LF5 C;  1KKG A;  4BSZ A;  1XNR C;  4LF6 C;  4LF9 C;  2BJO A;  4JI4 C;  4JI2 C;  4X65 C;  4YY3 C;  4JI1 C;  4JI5 C;  4NXN C;  4B3T C;  1N32 C;  1ML8 A;  3J80 D;  4DCS A;  2ATW A;  4DR6 C;  4LFA C;  2OPL A;  1QWI A;  4X62 C;  3T1H C;  4JV5 C;  4DV6 C;  4KHP C;  4JI7 C;  1ZB8 A;  4JYA C;  2JMP A;  4DCV A;  4B3R C;  1USP A;  4LF4 C;  2UXB C;  2ONF A;  4DV5 C;  2HHH C;  1EGA A;  1ZB9 A;  5IWA C;  1HNZ C;  1J5E C;  2PN2 A;  4XX2 A;  1XMO C;  1XNQ C;  2KZF A;  2UUC C;  4X64 C; 
#chains in the Genus database with same CATH topology
 1IB8 A;  4G1I A;  4NXM C;  2P02 A;  3I07 A;  5T8T A;  4DUY C;  3AF5 A;  4NOZ A;  1BA3 A;  3RG2 A;  4I9F A;  4DR5 C;  4BC9 A;  5FLX D;  5LCI A;  2WP0 C;  2F4V C;  2P20 A;  1AMU A;  5CZV A;  1ULT A;  2PRO A;  3CQ3 A;  3IML A;  4DR1 C;  1MDF A;  4G36 A;  2OBV A;  4KTT A;  3L95 X;  3JAM D;  1V25 A;  2UU9 C;  3J81 D;  5K85 A;  4AQY C;  2E8F A;  1NYE A;  1QM4 A;  2JNV A;  2KZ0 A;  2QL8 A;  1LQL A;  1HR0 C;  5BUS A;  1MXC A;  2UXD C;  4K0K C;  3PBK A;  1T5H X;  2OPL B;  2OO4 A;  3R9X A;  4X66 C;  3A4I A;  1PG3 A;  2YCB A;  5BSW A;  2P2B A;  2YWC A;  1O90 A;  4LF7 C;  4RM2 A;  2BH1 X;  3B7W A;  2WD9 A;  4DV7 C;  3AF6 A;  4L4Q A;  5BSM A;  5GTD A;  3FCE A;  4G37 A;  1XNR C;  5T8S A;  3A9V A;  5AE3 A;  4FUT A;  4PHT A;  4RVN A;  3J80 D;  2Y4N A;  3UX3 A;  1RG9 A;  4OYC A;  1PG4 A;  4LFA C;  2VZE A;  1V60 A;  3EQ6 A;  4JM1 A;  4DV6 C;  4JI7 C;  4JYA C;  3N2Q A;  4PZP A;  1USP A;  4LF4 C;  1T5D X;  1EGA A;  5A19 A;  5E7Q A;  2KZF A;  5BSV A;  4RLQ A;  4BCA A;  4X64 C;  1WF3 A;  1HH2 P;  5H9U A;  4DR7 C;  2ZM6 C;  1UKK A;  5LMU C;  4DR2 C;  1P4E A;  4JI3 C;  2AYA A;  4JI6 C;  4DG9 A;  2VSQ A;  3OTO C;  1V26 A;  4ZLP A;  2NCL A;  2Y27 A;  3RV2 A;  4B3S C;  2HJG A;  4D4G A;  4ODJ A;  2D1Q A;  4MTN A;  3DLP X;  1N33 C;  4OX9 C;  2YX1 A;  2Z51 A;  4I9G A;  1VLA A;  3NYR A;  3L8C A;  3A25 A;  1MXB A;  3GPC A;  1WH9 A;  3KXW A;  4YHH C;  2D7V A;  2VQE C;  5K8F A;  1I94 C;  2UXC C;  4DV0 C;  1YJ7 A;  1USP B;  4FTF A;  4U5Y D;  3CW9 A;  2CXC A;  2KDN A;  1PU1 A;  4MH4 A;  4NDN A;  2DYJ A;  4JI0 C;  4RLF A;  2M5O A;  3E7W A;  3K6R A;  2E8E A;  4WV3 A;  1O93 A;  3S82 A;  2MMA B;  1KKG A;  3A26 A;  4DR3 C;  2P2F A;  4BSZ A;  4LF6 C;  4LF9 C;  3UZ0 A;  5A1I A;  4JI2 C;  3E7X A;  4NXN C;  4R1L A;  3GR0 A;  2PG1 E;  1M6X A;  4DR6 C;  2MM9 A;  5BUQ A;  1O92 A;  3G7S A;  3VNQ A;  2ONF A;  1VEH A;  1MXA A;  5IWA C;  1J5E C;  4KTV A;  3LGX A;  1MD9 A;  4D4I A;  5A2Q D;  1LCI A;  4BC7 A;  2D1T A;  4LF8 C;  2EGT A;  1UWD A;  3IPL A;  5BUR A;  1HNW C;  4JI8 C;  2P2M A;  3ETO A;  4PUI A;  1PA4 A;  1L2F A;  4DV1 C;  3FCC A;  1WCJ A;  3CQ1 A;  4PUH A;  2QVZ X;  2QVY X;  4B3M C;  4ZJZ A;  3A9U A;  4IZ6 A;  3TUF A;  3R9W A;  4OXI A;  1XRC A;  5CZX A;  2D1R A;  5JRH A;  3LUS A;  4GS5 A;  5IT9 D;  3LAX A;  5AE1 A;  4L7I A;  3O2E A;  4R1M A;  4DV3 C;  5BSR A;  3UX2 A;  5KYT A;  2YWB A;  4GKJ C;  1K0R A;  1XRA A;  2E5L C;  3R44 A;  2V7B A;  1N2F A;  4LE5 A;  2Y4O A;  3IEU A;  1FLO A;  4RVO A;  1P4E C;  1GPM A;  2CY1 A;  1IBM C;  3VNR A;  3PES A;  4RMN A;  2E7G A;  1P7L A;  1XS3 A;  1FUG A;  4EAT A;  4IR7 A;  3PRO C;  4LFB C;  1XHJ A;  3DAY A;  4TPS B;  2BJO A;  4JI4 C;  4X65 C;  4YY3 C;  4JI1 C;  1YGT A;  1N32 C;  1ML8 A;  2D27 A;  4DCS A;  3TR3 A;  2MCQ A;  2M5H A;  4BBY A;  3T1H C;  4KHP C;  1ZB8 A;  2JMP A;  4DCV A;  1HNZ C;  4XX2 A;  1XMO C;  2D1S A;  4ISB A;  1XNQ C;  3CW8 X;  2UUC C;  1O9T A;  2QW0 X;  3VNS A;  5BST A;  4DV4 C;  2E8C A;  3GKU A;  4R0M A;  5KEI A;  4DV2 C;  4D57 A;  4GKK C;  3AY0 A;  3UOW A;  1NY8 A;  5ADZ A;  3ETC A;  2PT7 G;  4DUZ C;  3CQ2 A;  2QVX X;  2DPL A;  4DCT A;  4GXQ A;  2D28 C;  3NYQ A;  1N36 C;  1JOS A;  2CU6 A;  5KYV A;  3N54 B;  1N34 C;  1M6X C;  5LMN C;  2VQF C;  3H2T A;  4LFC C;  3NPD A;  5DV9 A;  3UEB A;  1RY2 A;  3IEV A;  2ZZM A;  2UUA C;  1XDX A;  1TH5 A;  3CJE A;  4DG8 A;  3TQI A;  4DCU A;  1HNX C;  3I08 A;  3DHV A;  2ASB A;  4WS9 A;  1MDB A;  3C5E A;  4PRO C;  5A1G A;  2XR1 A;  1IBK C;  4DR4 C;  1FJG C;  5BR8 C;  4HPV A;  3J7A D;  4GXR A;  1XMQ C;  2ZTB A;  3GR1 A;  1IBL C;  2UUB C;  3EER A;  2DHM A;  3TDE A;  5BSU A;  4D56 A;  1MKY A;  4L2Z A;  3T1Y C;  4LF5 C;  2ZZN A;  4K0B A;  1XRB A;  4JI5 C;  4B3T C;  2P2Q A;  3SO4 A;  2ATW A;  2P2J A;  2OPL A;  1QWI A;  4X62 C;  3FM7 A;  4JV5 C;  3LNO A;  2E0G A;  3NI2 A;  4PUG A;  4B3R C;  2UXB C;  4DV5 C;  2HHH C;  4FUQ A;  1ZB9 A;  3LNV A;  2PN2 A;  5IFI A;  5AE2 A;  4RM3 A; 
#chains in the Genus database with same CATH homology
 4G1I A;  4NXM C;  2P02 A;  3I07 A;  5T8T A;  4DUY C;  3AF5 A;  4NOZ A;  1BA3 A;  3RG2 A;  4I9F A;  4DR5 C;  4BC9 A;  5FLX D;  2WP0 C;  2F4V C;  2P20 A;  1AMU A;  5CZV A;  1ULT A;  2PRO A;  3IML A;  4DR1 C;  1MDF A;  4G36 A;  2OBV A;  4KTT A;  3L95 X;  3JAM D;  1V25 A;  2UU9 C;  3J81 D;  5K85 A;  4AQY C;  2E8F A;  1NYE A;  1QM4 A;  2QL8 A;  1LQL A;  1HR0 C;  5BUS A;  1MXC A;  2UXD C;  4K0K C;  3PBK A;  1T5H X;  2OPL B;  2OO4 A;  3R9X A;  4X66 C;  3A4I A;  1PG3 A;  2YCB A;  5BSW A;  2P2B A;  2YWC A;  1O90 A;  4LF7 C;  4RM2 A;  2BH1 X;  3B7W A;  2WD9 A;  4DV7 C;  3AF6 A;  4L4Q A;  5BSM A;  5GTD A;  3FCE A;  4G37 A;  1XNR C;  5T8S A;  3A9V A;  5AE3 A;  4FUT A;  4PHT A;  4RVN A;  3J80 D;  2Y4N A;  1RG9 A;  4OYC A;  1PG4 A;  4LFA C;  2VZE A;  3EQ6 A;  4JM1 A;  4DV6 C;  4JI7 C;  4JYA C;  3N2Q A;  4PZP A;  1USP A;  4LF4 C;  1T5D X;  1EGA A;  5A19 A;  5E7Q A;  2KZF A;  5BSV A;  4RLQ A;  4BCA A;  4X64 C;  1WF3 A;  1HH2 P;  5H9U A;  4DR7 C;  2ZM6 C;  1UKK A;  5LMU C;  4DR2 C;  4JI3 C;  2AYA A;  4JI6 C;  4DG9 A;  2VSQ A;  3OTO C;  1V26 A;  4ZLP A;  3RV2 A;  2Y27 A;  4B3S C;  2HJG A;  4D4G A;  4ODJ A;  2D1Q A;  4MTN A;  3DLP X;  1N33 C;  4OX9 C;  4I9G A;  1VLA A;  3NYR A;  3L8C A;  1MXB A;  3GPC A;  1WH9 A;  3KXW A;  4YHH C;  2D7V A;  2VQE C;  5K8F A;  1I94 C;  2UXC C;  4DV0 C;  1YJ7 A;  1USP B;  4FTF A;  4U5Y D;  3CW9 A;  2CXC A;  4MH4 A;  4NDN A;  2DYJ A;  4JI0 C;  4RLF A;  3E7W A;  2E8E A;  4WV3 A;  1O93 A;  3S82 A;  1KKG A;  4DR3 C;  2P2F A;  4BSZ A;  4LF6 C;  4LF9 C;  3UZ0 A;  5A1I A;  4JI2 C;  3E7X A;  4NXN C;  4R1L A;  3GR0 A;  4DR6 C;  5BUQ A;  1O92 A;  3G7S A;  3VNQ A;  2ONF A;  1MXA A;  5IWA C;  1J5E C;  4KTV A;  3LGX A;  1MD9 A;  4D4I A;  5A2Q D;  1LCI A;  4BC7 A;  2D1T A;  4LF8 C;  2EGT A;  3IPL A;  5BUR A;  1HNW C;  4JI8 C;  2P2M A;  3ETO A;  1PA4 A;  1L2F A;  4DV1 C;  3FCC A;  2QVZ X;  2QVY X;  4B3M C;  4ZJZ A;  3A9U A;  4IZ6 A;  3TUF A;  3R9W A;  4OXI A;  1XRC A;  5CZX A;  2D1R A;  5JRH A;  3LUS A;  4GS5 A;  5IT9 D;  3LAX A;  5AE1 A;  4L7I A;  4R1M A;  4DV3 C;  5BSR A;  5KYT A;  2YWB A;  4GKJ C;  1K0R A;  1XRA A;  2E5L C;  3R44 A;  2V7B A;  1N2F A;  4LE5 A;  2Y4O A;  3IEU A;  4RVO A;  1GPM A;  2CY1 A;  1IBM C;  3VNR A;  3PES A;  4RMN A;  2E7G A;  1P7L A;  1FUG A;  4EAT A;  4IR7 A;  3PRO C;  4LFB C;  3DAY A;  4TPS B;  2BJO A;  4JI4 C;  4X65 C;  4YY3 C;  4JI1 C;  1N32 C;  1ML8 A;  2D27 A;  4DCS A;  4BBY A;  3T1H C;  4KHP C;  1ZB8 A;  2JMP A;  4DCV A;  1HNZ C;  1XMO C;  4XX2 A;  2D1S A;  4ISB A;  1XNQ C;  3CW8 X;  2UUC C;  1O9T A;  2QW0 X;  3VNS A;  5BST A;  4DV4 C;  2E8C A;  3GKU A;  4R0M A;  5KEI A;  4DV2 C;  4D57 A;  4GKK C;  3UOW A;  5ADZ A;  3ETC A;  2PT7 G;  4DUZ C;  2QVX X;  2DPL A;  4DCT A;  4GXQ A;  2D28 C;  3NYQ A;  1N36 C;  1JOS A;  5KYV A;  3N54 B;  1N34 C;  5LMN C;  2VQF C;  3H2T A;  4LFC C;  3NPD A;  5DV9 A;  1RY2 A;  3IEV A;  2UUA C;  3CJE A;  4DG8 A;  3TQI A;  4DCU A;  1HNX C;  3I08 A;  3DHV A;  2ASB A;  4WS9 A;  1MDB A;  3C5E A;  4PRO C;  5A1G A;  2XR1 A;  1IBK C;  4DR4 C;  1FJG C;  5BR8 C;  4HPV A;  3J7A D;  4GXR A;  1XMQ C;  3GR1 A;  1IBL C;  2UUB C;  3EER A;  3TDE A;  5BSU A;  4D56 A;  3T1Y C;  1MKY A;  4L2Z A;  4LF5 C;  4K0B A;  1XRB A;  4JI5 C;  4B3T C;  2P2Q A;  3SO4 A;  2ATW A;  2P2J A;  2OPL A;  1QWI A;  4X62 C;  4JV5 C;  2E0G A;  3NI2 A;  4B3R C;  2UXB C;  4DV5 C;  2HHH C;  4FUQ A;  1ZB9 A;  3LNV A;  2PN2 A;  5IFI A;  5AE2 A;  4RM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...