4BSZA

Crystal structure of the yeast ribosomal protein rps3 in complex with its chaperone yar1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
187
structure length
187
Chain Sequence
VADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRATRTQDVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKFADGFLIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRDPAKSRTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Yeast Ribosomal Protein Rps3 in Complex with its Chaperone Yar1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords 40S RIBOSOMAL PROTEIN S3
total genus 35
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4bszA01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4bszA02
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4bszA03
1LQLA 1JOSA 2KZFA 1IBMC 4DUYC 2UUCC 4DR4C 1J5EC 2VQEC 4DV6C 2PT7G 4OX9C 1WF3A 2E8EA 5A2QD 1NYEA 5LMNC 4DV2C 1HNWC 2UXDC 3OTOC 4JI2C 2CXCA 4JI0C 4DCSA 4LFAC 2ATWA 2UUBC 4YY3C 4K0KC 3AF5A 2DYJA 1IBKC 4LF4C 2UUAC 3R9WA 4NXNC 4GKJC 2ONFA 1EGAA 4X62C 3T1HC 4JI7C 1XMOC 1IBLC 2UXCC 4NOZA 1N2FA 2PN2A 2F4VC 4LF5C 2HHHC 3IEVA 4DR7C 1XNRC 1WH9A 4MH4A 4LF6C 4DCVA 4JI3C 1N36C 4JYAC 1N33C 4JI8C 4DV7C 5BR8C 1HNZC 3J80D 4B3RC 2UXBC 4DV1C 1L2FA 4GKKC 4LF8C 4DR6C 4JV5C 1ML8A 4X65C 2VQFC 4KHPC 5IWAC 2JMPA 1K0RA 4MTNA 4B3TC 3J81D 4X64C 1HR0C 1UKKA 5FLXD 4JI6C 4DUZC 4JI1C 5LMUC 4DR1C 4DR2C 1MKYA 4YHHC 4JI4C 1XNQC 3CJEA 3AF6A 1N32C 2ASBA 4B3SC 2E8CA 3I07A 1USPA 4DV3C 1FJGC 1QWIA 3J7AD 2E7GA 1ZB8A 2E5LC 4LFCC 2EGTA 4DCUA 4LF9C 2E8FA 1VLAA 1HH2P 4XX2A 2QL8A 3IEUA 1XMQC 1ZB9A 2ZM6C 3JAMD 4DR5C 4LFBC 1USPB 4BSZA 4AQYC 4X66C 2OPLB 2YCBA 2OPLA 4DV0C 3LUSA 4DV5C 1KKGA 4JI5C 3GKUA 4DV4C 1I94C 4NXMC 5IT9D 1HNXC 3R9XA 2UU9C 3EERA 4B3MC 2CY1A 2XR1A 2D7VA 1PA4A 3T1YC 4DR3C 1N34C 4DCTA 2HJGA 2BJOA 4LF7C
chains in the Genus database with same CATH superfamily
2D1SA 4D56A 1J5EC 4HPVA 1M6XC 4ZJZA 1UWDA 5DV9A 1WF3A 4RMNA 2E8EA 1NYEA 5LMNC 2UXDC 4G36A 4D57A 2JNVA 3K6RA 3DHVA 3AF5A 3IPLA 2DYJA 4PZPA 4G1IA 2ONFA 1LCIA 3GPCA 1EGAA 4JI7C 3T1HC 4NOZA 3RV2A 5BSVA 2NCLA 5CZVA 4RM3A 5BSRA 2HHHC 3B7WA 3CQ3A 2DHMA 3CQ1A 3N54B 2P20A 3VNRA 4GKKC 4K0BA 5KYVA 5LCIA 1ML8A 4X65C 1XS3A 5BSUA 3A25A 5A1GA 4BC7A 1WCJA 3TQIA 1HR0C 1UKKA 4JI6C 2MCQA 1V25A 4JI1C 4DR1C 4DR2C 2P2FA 2KZ0A 2OBVA 3CJEA 3SO4A 4B3SC 2E8CA 4DV3C 1FJGC 1QWIA 3J7AD 4LFCC 2EGTA 4WV3A 3UOWA 1VLAA 2QL8A 3EQ6A 4LE5A 3JAMD 1O9TA 4BSZA 5A1IA 2OO4A 5GTDA 3LUSA 3GKUA 3FCEA 4DV4C 1XRAA 4NXMC 1O92A 3LAXA 1QM4A 1AMUA 5BSMA 2CU6A 4ZLPA 3R44A 2HJGA 4LF7C 1IBMC 2UUCC 5AE2A 4DV6C 2WP0C 3FCCA 3KXWA 3UX3A 1NY8A 1ULTA 4OX9C 5A2QD 2D27A 2V7BA 5T8TA 2Z51A 3GR0A 3OTOC 2CXCA 3NPDA 1VEHA 4LFAC 2ATWA 5K85A 4TPSB 2QW0X 2UUBC 4YY3C 2MM9A 4LF4C 1RG9A 3GR1A 4X62C 1IBLC 2D1QA 2QVZX 4OYCA 1P4EA 4R1MA 4LF5C 3IEVA 5BURA 2ZZMA 5BUSA 4GS5A 3CW8X 3NI2A 1XNRC 4MH4A 2D1RA 4RLFA 4BC9A 5BR8C 3A4IA 4B3RC 2D28C 5K8FA 1XRBA 2VSQA 4KTTA 3RG2A 1MXBA 3L8CA 4B3TC 4FUTA 4RM2A 4NDNA 5IFIA 4DUZC 1MDBA 3A26A 4D4GA 2PROA 4YHHC 3N2QA 3AF6A 1USPA 4FTFA 1ZB8A 4ISBA 2E5LC 3ETOA 5JRHA 4LF9C 2E8FA 1MD9A 2P2MA 3LGXA 1T5HX 1XMQC 2ZM6C 4DR5C 4LFBC 4PUGA 4AQYC 1YGTA 2YCBA 5H9UA 5KYTA 1YJ7A 4DV5C 1KKGA 3VNQA 4DG8A 4BCAA 1I94C 1MDFA 5IT9D 4PUIA 1HNXC 2UU9C 1PG3A 4PROC 3L95X 2XR1A 3TDEA 3T1YC 1N34C 1PU1A 2Y4OA 2BJOA 3TR3A 1LQLA 1M6XA 4DUYC 2YWCA 2VQEC 1T5DX 3LNVA 2PT7G 5CZXA 2QVXX 2D1TA 4DV2C 3UZ0A 3E7XA 4JI2C 1O93A 4JI0C 2P2QA 4DCSA 3PBKA 1IBKC 2UUAC 3R9WA 2QVYX 4NXNC 1XMOC 2P2BA 4U5YD 5KEIA 3C5EA 1N36C 1N33C 1FLOA 4DV7C 1MXCA 2PG1E 3I08A 4DV1C 4DG9A 5A19A 1PG4A 1MXAA 2M5OA 4DR6C 4KHPC 1FUGA 5IWAC 5T8SA 1K0RA 4PHTA 3S82A 3J81D 4X64C 3VNSA 4WS9A 5LMUC 5BSWA 1MKYA 3DLPX 4PUHA 4JI4C 1XNQC 2WD9A 4KTVA 1N32C 2ASBA 3I07A 5BSTA 1V26A 1IB8A 4ODJA 2P02A 3A9UA 1HH2P 3IEUA 1ZB9A 3PROC 5BUQA 4X66C 2M5HA 4DV0C 2KDNA 3UX2A 2BH1X 4JI5C 2YWBA 3FM7A 3R9XA 4IZ6A 3EERA 4FUQA 4B3MC 2CY1A 1XRCA 3NYQA 4OXIA 3TUFA 1PA4A 4DR3C 1JOSA 3PESA 4EATA 2KZFA 2ZTBA 4DR4C 1V60A 1HNWC 4RVNA 4K0KC 4GKJC 3LNOA 1O90A 5E7QA 2UXCC 5AE1A 1N2FA 4R1LA 2PN2A 2F4VC 1TH5A 4DR7C 1P4EC 1GPMA 4JM1A 1WH9A 1P7LA 3CW9A 4LF6C 1XHJA 3NYRA 4L2ZA 4DCVA 4JI3C 4JYAC 4JI8C 1HNZC 4D4IA 3J80D 3AY0A 2UXBC 2MMAB 1L2FA 4LF8C 4JV5C 1XDXA 4GXQA 2VQFC 3G7SA 3A9VA 4R0MA 4IR7A 2JMPA 4MTNA 3IMLA 5AE3A 4GXRA 4I9FA 2YX1A 5FLXD 4L7IA 4RVOA 3CQ2A 5ADZA 3ETCA 3H2TA 2ZZNA 2DPLA 2E7GA 4L4QA 4DCUA 4I9GA 2Y4NA 4XX2A 1USPB 2AYAA 2Y27A 2OPLB 2OPLA 2P2JA 1BA3A 4BBYA 3DAYA 4RLQA 3O2EA 3UEBA 1RY2A 3E7WA 2D7VA 2VZEA 4DCTA 2E0GA 4G37A
chains in the Genus database with same CATH topology
2D1SA 4D56A 1J5EC 4HPVA 4ZJZA 5DV9A 1WF3A 4RMNA 2E8EA 1NYEA 5LMNC 2UXDC 4G36A 4D57A 3DHVA 3AF5A 3IPLA 2DYJA 4PZPA 4G1IA 2ONFA 1LCIA 3GPCA 1EGAA 4JI7C 3T1HC 4NOZA 3RV2A 5BSVA 5CZVA 4RM3A 5BSRA 2HHHC 3B7WA 3N54B 2P20A 3VNRA 4GKKC 4K0BA 5KYVA 1ML8A 4X65C 5BSUA 5A1GA 4BC7A 3TQIA 1HR0C 1UKKA 4JI6C 1V25A 4JI1C 4DR1C 4DR2C 2P2FA 3CJEA 2OBVA 3SO4A 4B3SC 2E8CA 4DV3C 1FJGC 1QWIA 3J7AD 4LFCC 2EGTA 4WV3A 3UOWA 1VLAA 2QL8A 3EQ6A 4LE5A 3JAMD 1O9TA 4BSZA 5A1IA 2OO4A 5GTDA 3LUSA 3GKUA 3FCEA 4DV4C 1XRAA 4NXMC 1O92A 3LAXA 1QM4A 1AMUA 5BSMA 4ZLPA 3R44A 2HJGA 4LF7C 1IBMC 2UUCC 5AE2A 4DV6C 2WP0C 3FCCA 3KXWA 1ULTA 4OX9C 5A2QD 2D27A 2V7BA 5T8TA 3GR0A 3OTOC 2CXCA 3NPDA 4LFAC 2ATWA 5K85A 4TPSB 2QW0X 2UUBC 4YY3C 4LF4C 1RG9A 3GR1A 4X62C 1IBLC 2D1QA 2QVZX 4OYCA 4R1MA 4LF5C 3IEVA 5BURA 5BUSA 4GS5A 3CW8X 3NI2A 1XNRC 4MH4A 2D1RA 4RLFA 4BC9A 5BR8C 3A4IA 4B3RC 2D28C 5K8FA 1XRBA 2VSQA 4KTTA 3RG2A 1MXBA 3L8CA 4B3TC 4FUTA 4RM2A 4NDNA 5IFIA 4DUZC 1MDBA 4D4GA 2PROA 4YHHC 3N2QA 3AF6A 1USPA 4FTFA 1ZB8A 4ISBA 2E5LC 3ETOA 5JRHA 4LF9C 2E8FA 1MD9A 2P2MA 3LGXA 1T5HX 1XMQC 2ZM6C 4DR5C 4LFBC 4AQYC 2YCBA 5H9UA 5KYTA 1YJ7A 4DV5C 1KKGA 3VNQA 4DG8A 4BCAA 1I94C 1MDFA 5IT9D 1HNXC 2UU9C 1PG3A 4PROC 3L95X 2XR1A 3TDEA 3T1YC 1N34C 2Y4OA 2BJOA 1LQLA 4DUYC 2YWCA 2VQEC 1T5DX 3LNVA 2PT7G 5CZXA 2QVXX 2D1TA 4DV2C 3UZ0A 3E7XA 4JI2C 1O93A 4JI0C 2P2QA 4DCSA 3PBKA 1IBKC 2UUAC 3R9WA 2QVYX 4NXNC 1XMOC 2P2BA 4U5YD 5KEIA 3C5EA 1N36C 1N33C 4DV7C 1MXCA 3I08A 4DG9A 4DV1C 5A19A 1PG4A 1MXAA 4DR6C 4KHPC 1FUGA 5IWAC 5T8SA 1K0RA 4PHTA 3S82A 3J81D 4X64C 3VNSA 4WS9A 5LMUC 5BSWA 1MKYA 3DLPX 4JI4C 1XNQC 2WD9A 4KTVA 1N32C 2ASBA 3I07A 5BSTA 1V26A 4ODJA 2P02A 3A9UA 1HH2P 3IEUA 1ZB9A 3PROC 5BUQA 4X66C 4DV0C 2BH1X 4JI5C 2YWBA 3R9XA 4IZ6A 3EERA 4FUQA 4B3MC 2CY1A 1XRCA 3NYQA 4OXIA 3TUFA 1PA4A 4DR3C 1JOSA 3PESA 4EATA 2KZFA 4DR4C 1HNWC 4RVNA 4K0KC 4GKJC 1O90A 5E7QA 2UXCC 5AE1A 1N2FA 4R1LA 2PN2A 2F4VC 4DR7C 1GPMA 4JM1A 1WH9A 1P7LA 3CW9A 4LF6C 3NYRA 4L2ZA 4DCVA 4JI3C 4JYAC 4JI8C 1HNZC 4D4IA 3J80D 2UXBC 1L2FA 4LF8C 4JV5C 4GXQA 2VQFC 3G7SA 3A9VA 4R0MA 4IR7A 2JMPA 4MTNA 3IMLA 5AE3A 4GXRA 4I9FA 5FLXD 4L7IA 4RVOA 5ADZA 3ETCA 3H2TA 2DPLA 2E7GA 4L4QA 4DCUA 4I9GA 2Y4NA 4XX2A 1USPB 2AYAA 2Y27A 2OPLB 2OPLA 2P2JA 1BA3A 4BBYA 3DAYA 4RLQA 1RY2A 3E7WA 2D7VA 2VZEA 4DCTA 2E0GA 4G37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQL A;  1JOS A;  2KZF A;  1IBM C;  4DUY C;  2UUC C;  4DR4 C;  1J5E C;  2VQE C;  4DV6 C;  2PT7 G;  4OX9 C;  1WF3 A;  2E8E A;  5A2Q D;  1NYE A;  5LMN C;  4DV2 C;  1HNW C;  2UXD C;  3OTO C;  4JI2 C;  2CXC A;  4JI0 C;  4DCS A;  4LFA C;  2ATW A;  2UUB C;  4YY3 C;  4K0K C;  3AF5 A;  2DYJ A;  1IBK C;  4LF4 C;  2UUA C;  3R9W A;  4NXN C;  4GKJ C;  2ONF A;  1EGA A;  4X62 C;  3T1H C;  4JI7 C;  1XMO C;  1IBL C;  2UXC C;  4NOZ A;  1N2F A;  2PN2 A;  2F4V C;  4LF5 C;  2HHH C;  3IEV A;  4DR7 C;  1XNR C;  1WH9 A;  4MH4 A;  4LF6 C;  4DCV A;  4JI3 C;  1N36 C;  4JYA C;  1N33 C;  4JI8 C;  4DV7 C;  5BR8 C;  1HNZ C;  3J80 D;  4B3R C;  2UXB C;  4DV1 C;  1L2F A;  4GKK C;  4LF8 C;  4DR6 C;  4JV5 C;  1ML8 A;  4X65 C;  2VQF C;  4KHP C;  5IWA C;  2JMP A;  1K0R A;  4MTN A;  4B3T C;  3J81 D;  4X64 C;  1HR0 C;  1UKK A;  5FLX D;  4JI6 C;  4DUZ C;  4JI1 C;  5LMU C;  4DR1 C;  4DR2 C;  1MKY A;  4YHH C;  4JI4 C;  1XNQ C;  3CJE A;  3AF6 A;  1N32 C;  2ASB A;  4B3S C;  2E8C A;  3I07 A;  1USP A;  4DV3 C;  1FJG C;  1QWI A;  3J7A D;  2E7G A;  1ZB8 A;  2E5L C;  4LFC C;  2EGT A;  4DCU A;  4LF9 C;  2E8F A;  1VLA A;  1HH2 P;  4XX2 A;  2QL8 A;  3IEU A;  1XMQ C;  1ZB9 A;  2ZM6 C;  3JAM D;  4DR5 C;  4LFB C;  1USP B;  4BSZ A;  4AQY C;  4X66 C;  2OPL B;  2YCB A;  2OPL A;  4DV0 C;  3LUS A;  4DV5 C;  1KKG A;  4JI5 C;  3GKU A;  4DV4 C;  1I94 C;  4NXM C;  5IT9 D;  1HNX C;  3R9X A;  2UU9 C;  3EER A;  4B3M C;  2CY1 A;  2XR1 A;  2D7V A;  1PA4 A;  3T1Y C;  4DR3 C;  1N34 C;  4DCT A;  2HJG A;  2BJO A;  4LF7 C; 
#chains in the Genus database with same CATH topology
 2D1S A;  4D56 A;  1J5E C;  4HPV A;  1M6X C;  4ZJZ A;  1UWD A;  5DV9 A;  1WF3 A;  4RMN A;  2E8E A;  1NYE A;  5LMN C;  2UXD C;  4G36 A;  4D57 A;  2JNV A;  3K6R A;  3DHV A;  3AF5 A;  3IPL A;  2DYJ A;  4PZP A;  4G1I A;  2ONF A;  1LCI A;  3GPC A;  1EGA A;  4JI7 C;  3T1H C;  4NOZ A;  3RV2 A;  5BSV A;  2NCL A;  5CZV A;  4RM3 A;  5BSR A;  2HHH C;  3B7W A;  3CQ3 A;  2DHM A;  3CQ1 A;  3N54 B;  2P20 A;  3VNR A;  4GKK C;  4K0B A;  5KYV A;  5LCI A;  1ML8 A;  4X65 C;  1XS3 A;  5BSU A;  3A25 A;  5A1G A;  4BC7 A;  1WCJ A;  3TQI A;  1HR0 C;  1UKK A;  4JI6 C;  2MCQ A;  1V25 A;  4JI1 C;  4DR1 C;  4DR2 C;  2P2F A;  2KZ0 A;  2OBV A;  3CJE A;  3SO4 A;  4B3S C;  2E8C A;  4DV3 C;  1FJG C;  1QWI A;  3J7A D;  4LFC C;  2EGT A;  4WV3 A;  3UOW A;  1VLA A;  2QL8 A;  3EQ6 A;  4LE5 A;  3JAM D;  1O9T A;  4BSZ A;  5A1I A;  2OO4 A;  5GTD A;  3LUS A;  3GKU A;  3FCE A;  4DV4 C;  1XRA A;  4NXM C;  1O92 A;  3LAX A;  1QM4 A;  1AMU A;  5BSM A;  2CU6 A;  4ZLP A;  3R44 A;  2HJG A;  4LF7 C;  1IBM C;  2UUC C;  5AE2 A;  4DV6 C;  2WP0 C;  3FCC A;  3KXW A;  3UX3 A;  1NY8 A;  1ULT A;  4OX9 C;  5A2Q D;  2D27 A;  2V7B A;  5T8T A;  2Z51 A;  3GR0 A;  3OTO C;  2CXC A;  3NPD A;  1VEH A;  4LFA C;  2ATW A;  5K85 A;  4TPS B;  2QW0 X;  2UUB C;  4YY3 C;  2MM9 A;  4LF4 C;  1RG9 A;  3GR1 A;  4X62 C;  1IBL C;  2D1Q A;  2QVZ X;  4OYC A;  1P4E A;  4R1M A;  4LF5 C;  3IEV A;  5BUR A;  2ZZM A;  5BUS A;  4GS5 A;  3CW8 X;  3NI2 A;  1XNR C;  4MH4 A;  2D1R A;  4RLF A;  4BC9 A;  5BR8 C;  3A4I A;  4B3R C;  2D28 C;  5K8F A;  1XRB A;  2VSQ A;  4KTT A;  3RG2 A;  1MXB A;  3L8C A;  4B3T C;  4FUT A;  4RM2 A;  4NDN A;  5IFI A;  4DUZ C;  1MDB A;  3A26 A;  4D4G A;  2PRO A;  4YHH C;  3N2Q A;  3AF6 A;  1USP A;  4FTF A;  1ZB8 A;  4ISB A;  2E5L C;  3ETO A;  5JRH A;  4LF9 C;  2E8F A;  1MD9 A;  2P2M A;  3LGX A;  1T5H X;  1XMQ C;  2ZM6 C;  4DR5 C;  4LFB C;  4PUG A;  4AQY C;  1YGT A;  2YCB A;  5H9U A;  5KYT A;  1YJ7 A;  4DV5 C;  1KKG A;  3VNQ A;  4DG8 A;  4BCA A;  1I94 C;  1MDF A;  5IT9 D;  4PUI A;  1HNX C;  2UU9 C;  1PG3 A;  4PRO C;  3L95 X;  2XR1 A;  3TDE A;  3T1Y C;  1N34 C;  1PU1 A;  2Y4O A;  2BJO A;  3TR3 A;  1LQL A;  1M6X A;  4DUY C;  2YWC A;  2VQE C;  1T5D X;  3LNV A;  2PT7 G;  5CZX A;  2QVX X;  2D1T A;  4DV2 C;  3UZ0 A;  3E7X A;  4JI2 C;  1O93 A;  4JI0 C;  2P2Q A;  4DCS A;  3PBK A;  1IBK C;  2UUA C;  3R9W A;  2QVY X;  4NXN C;  1XMO C;  2P2B A;  4U5Y D;  5KEI A;  3C5E A;  1N36 C;  1N33 C;  1FLO A;  4DV7 C;  1MXC A;  2PG1 E;  3I08 A;  4DV1 C;  4DG9 A;  5A19 A;  1PG4 A;  1MXA A;  2M5O A;  4DR6 C;  4KHP C;  1FUG A;  5IWA C;  5T8S A;  1K0R A;  4PHT A;  3S82 A;  3J81 D;  4X64 C;  3VNS A;  4WS9 A;  5LMU C;  5BSW A;  1MKY A;  3DLP X;  4PUH A;  4JI4 C;  1XNQ C;  2WD9 A;  4KTV A;  1N32 C;  2ASB A;  3I07 A;  5BST A;  1V26 A;  1IB8 A;  4ODJ A;  2P02 A;  3A9U A;  1HH2 P;  3IEU A;  1ZB9 A;  3PRO C;  5BUQ A;  4X66 C;  2M5H A;  4DV0 C;  2KDN A;  3UX2 A;  2BH1 X;  4JI5 C;  2YWB A;  3FM7 A;  3R9X A;  4IZ6 A;  3EER A;  4FUQ A;  4B3M C;  2CY1 A;  1XRC A;  3NYQ A;  4OXI A;  3TUF A;  1PA4 A;  4DR3 C;  1JOS A;  3PES A;  4EAT A;  2KZF A;  2ZTB A;  4DR4 C;  1V60 A;  1HNW C;  4RVN A;  4K0K C;  4GKJ C;  3LNO A;  1O90 A;  5E7Q A;  2UXC C;  5AE1 A;  1N2F A;  4R1L A;  2PN2 A;  2F4V C;  1TH5 A;  4DR7 C;  1P4E C;  1GPM A;  4JM1 A;  1WH9 A;  1P7L A;  3CW9 A;  4LF6 C;  1XHJ A;  3NYR A;  4L2Z A;  4DCV A;  4JI3 C;  4JYA C;  4JI8 C;  1HNZ C;  4D4I A;  3J80 D;  3AY0 A;  2UXB C;  2MMA B;  1L2F A;  4LF8 C;  4JV5 C;  1XDX A;  4GXQ A;  2VQF C;  3G7S A;  3A9V A;  4R0M A;  4IR7 A;  2JMP A;  4MTN A;  3IML A;  5AE3 A;  4GXR A;  4I9F A;  2YX1 A;  5FLX D;  4L7I A;  4RVO A;  3CQ2 A;  5ADZ A;  3ETC A;  3H2T A;  2ZZN A;  2DPL A;  2E7G A;  4L4Q A;  4DCU A;  4I9G A;  2Y4N A;  4XX2 A;  1USP B;  2AYA A;  2Y27 A;  2OPL B;  2OPL A;  2P2J A;  1BA3 A;  4BBY A;  3DAY A;  4RLQ A;  3O2E A;  3UEB A;  1RY2 A;  3E7W A;  2D7V A;  2VZE A;  4DCT A;  2E0G A;  4G37 A; 
#chains in the Genus database with same CATH homology
 2D1S A;  4D56 A;  1J5E C;  4HPV A;  4ZJZ A;  5DV9 A;  1WF3 A;  4RMN A;  2E8E A;  1NYE A;  5LMN C;  2UXD C;  4G36 A;  4D57 A;  3DHV A;  3AF5 A;  3IPL A;  2DYJ A;  4PZP A;  4G1I A;  2ONF A;  1LCI A;  3GPC A;  1EGA A;  4JI7 C;  3T1H C;  4NOZ A;  3RV2 A;  5BSV A;  5CZV A;  4RM3 A;  5BSR A;  2HHH C;  3B7W A;  3N54 B;  2P20 A;  3VNR A;  4GKK C;  4K0B A;  5KYV A;  1ML8 A;  4X65 C;  5BSU A;  5A1G A;  4BC7 A;  3TQI A;  1HR0 C;  1UKK A;  4JI6 C;  1V25 A;  4JI1 C;  4DR1 C;  4DR2 C;  2P2F A;  3CJE A;  2OBV A;  3SO4 A;  4B3S C;  2E8C A;  4DV3 C;  1FJG C;  1QWI A;  3J7A D;  4LFC C;  2EGT A;  4WV3 A;  3UOW A;  1VLA A;  2QL8 A;  3EQ6 A;  4LE5 A;  3JAM D;  1O9T A;  4BSZ A;  5A1I A;  2OO4 A;  5GTD A;  3LUS A;  3GKU A;  3FCE A;  4DV4 C;  1XRA A;  4NXM C;  1O92 A;  3LAX A;  1QM4 A;  1AMU A;  5BSM A;  4ZLP A;  3R44 A;  2HJG A;  4LF7 C;  1IBM C;  2UUC C;  5AE2 A;  4DV6 C;  2WP0 C;  3FCC A;  3KXW A;  1ULT A;  4OX9 C;  5A2Q D;  2D27 A;  2V7B A;  5T8T A;  3GR0 A;  3OTO C;  2CXC A;  3NPD A;  4LFA C;  2ATW A;  5K85 A;  4TPS B;  2QW0 X;  2UUB C;  4YY3 C;  4LF4 C;  1RG9 A;  3GR1 A;  4X62 C;  1IBL C;  2D1Q A;  2QVZ X;  4OYC A;  4R1M A;  4LF5 C;  3IEV A;  5BUR A;  5BUS A;  4GS5 A;  3CW8 X;  3NI2 A;  1XNR C;  4MH4 A;  2D1R A;  4RLF A;  4BC9 A;  5BR8 C;  3A4I A;  4B3R C;  2D28 C;  5K8F A;  1XRB A;  2VSQ A;  4KTT A;  3RG2 A;  1MXB A;  3L8C A;  4B3T C;  4FUT A;  4RM2 A;  4NDN A;  5IFI A;  4DUZ C;  1MDB A;  4D4G A;  2PRO A;  4YHH C;  3N2Q A;  3AF6 A;  1USP A;  4FTF A;  1ZB8 A;  4ISB A;  2E5L C;  3ETO A;  5JRH A;  4LF9 C;  2E8F A;  1MD9 A;  2P2M A;  3LGX A;  1T5H X;  1XMQ C;  2ZM6 C;  4DR5 C;  4LFB C;  4AQY C;  2YCB A;  5H9U A;  5KYT A;  1YJ7 A;  4DV5 C;  1KKG A;  3VNQ A;  4DG8 A;  4BCA A;  1I94 C;  1MDF A;  5IT9 D;  1HNX C;  2UU9 C;  1PG3 A;  4PRO C;  3L95 X;  2XR1 A;  3TDE A;  3T1Y C;  1N34 C;  2Y4O A;  2BJO A;  1LQL A;  4DUY C;  2YWC A;  2VQE C;  1T5D X;  3LNV A;  2PT7 G;  5CZX A;  2QVX X;  2D1T A;  4DV2 C;  3UZ0 A;  3E7X A;  4JI2 C;  1O93 A;  4JI0 C;  2P2Q A;  4DCS A;  3PBK A;  1IBK C;  2UUA C;  3R9W A;  2QVY X;  4NXN C;  1XMO C;  2P2B A;  4U5Y D;  5KEI A;  3C5E A;  1N36 C;  1N33 C;  4DV7 C;  1MXC A;  3I08 A;  4DG9 A;  4DV1 C;  5A19 A;  1PG4 A;  1MXA A;  4DR6 C;  4KHP C;  1FUG A;  5IWA C;  5T8S A;  1K0R A;  4PHT A;  3S82 A;  3J81 D;  4X64 C;  3VNS A;  4WS9 A;  5LMU C;  5BSW A;  1MKY A;  3DLP X;  4JI4 C;  1XNQ C;  2WD9 A;  4KTV A;  1N32 C;  2ASB A;  3I07 A;  5BST A;  1V26 A;  4ODJ A;  2P02 A;  3A9U A;  1HH2 P;  3IEU A;  1ZB9 A;  3PRO C;  5BUQ A;  4X66 C;  4DV0 C;  2BH1 X;  4JI5 C;  2YWB A;  3R9X A;  4IZ6 A;  3EER A;  4FUQ A;  4B3M C;  2CY1 A;  1XRC A;  3NYQ A;  4OXI A;  3TUF A;  1PA4 A;  4DR3 C;  1JOS A;  3PES A;  4EAT A;  2KZF A;  4DR4 C;  1HNW C;  4RVN A;  4K0K C;  4GKJ C;  1O90 A;  5E7Q A;  2UXC C;  5AE1 A;  1N2F A;  4R1L A;  2PN2 A;  2F4V C;  4DR7 C;  1GPM A;  4JM1 A;  1WH9 A;  1P7L A;  3CW9 A;  4LF6 C;  3NYR A;  4L2Z A;  4DCV A;  4JI3 C;  4JYA C;  4JI8 C;  1HNZ C;  4D4I A;  3J80 D;  2UXB C;  1L2F A;  4LF8 C;  4JV5 C;  4GXQ A;  2VQF C;  3G7S A;  3A9V A;  4R0M A;  4IR7 A;  2JMP A;  4MTN A;  3IML A;  5AE3 A;  4GXR A;  4I9F A;  5FLX D;  4L7I A;  4RVO A;  5ADZ A;  3ETC A;  3H2T A;  2DPL A;  2E7G A;  4L4Q A;  4DCU A;  4I9G A;  2Y4N A;  4XX2 A;  1USP B;  2AYA A;  2Y27 A;  2OPL B;  2OPL A;  2P2J A;  1BA3 A;  4BBY A;  3DAY A;  4RLQ A;  1RY2 A;  3E7W A;  2D7V A;  2VZE A;  4DCT A;  2E0G A;  4G37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...