4BSZA

Crystal structure of the yeast ribosomal protein rps3 in complex with its chaperone yar1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
187
structure length
187
Chain Sequence
VADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRATRTQDVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKFADGFLIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRDPAKSRTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Yeast Ribosomal Protein Rps3 in Complex with its Chaperone Yar1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords 40S RIBOSOMAL PROTEIN S3
total genus 35
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4bszA01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4bszA02
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4bszA03
4DCSA 4LF4C 4K0KC 4LFAC 3EERA 3OTOC 1IBMC 4JI2C 4XX2A 2ONFA 3R9XA 4NOZA 2PN2A 4JYAC 2OPLA 1HNXC 4YHHC 5FLXD 4LF8C 1UKKA 4GKKC 4DR3C 4YY3C 2DYJA 4DV3C 4JI1C 5A2QD 4X64C 4B3RC 1N2FA 2YCBA 4DV7C 5LMNC 4DR2C 2F4VC 1ZB9A 1LQLA 4DV5C 4JI6C 4X65C 1XMQC 1IBLC 1ZB8A 1HH2P 2UXBC 3AF5A 3GKUA 1KKGA 2D7VA 4MTNA 1USPB 1ML8A 2XR1A 4JI3C 2UUBC 2VQFC 2UXCC 1WF3A 4NXMC 4AQYC 3T1YC 1XMOC 4B3TC 4JI4C 1HNWC 5IT9D 4DR6C 4DV2C 4DV1C 1MKYA 4JI5C 1PA4A 4BSZA 2E8EA 2HHHC 4B3MC 2UXDC 4B3SC 1L2FA 4JI7C 4LFCC 4DV0C 4DUZC 3I07A 2QL8A 1EGAA 2OPLB 3JAMD 4X62C 2EGTA 4DUYC 1HR0C 4DR5C 4KHPC 1WH9A 1QWIA 1J5EC 4DR4C 4NXNC 1NYEA 1N36C 3R9WA 1I94C 4JI0C 2PT7G 4DCTA 4LF6C 2UUCC 2ATWA 4LF5C 2ASBA 4X66C 3CJEA 1N33C 3J7AD 2CXCA 5LMUC 3T1HC 4JI8C 4GKJC 4LF7C 1XNQC 4LF9C 1VLAA 1N34C 2CY1A 4DCVA 4DV4C 2ZM6C 3IEVA 2E8CA 2BJOA 2E5LC 5BR8C 2UU9C 2KZFA 2UUAC 3LUSA 1HNZC 2HJGA 4JV5C 1N32C 2E8FA 1USPA 4OX9C 4DR7C 3J81D 2E7GA 4DCUA 3J80D 4MH4A 4LFBC 1IBKC 4DV6C 5IWAC 1FJGC 1K0RA 3IEUA 4DR1C 1JOSA 1XNRC 3AF6A 2VQEC 2JMPA
chains in the Genus database with same CATH superfamily
3IMLA 4DCSA 3L8CA 5BSWA 3EERA 3LNOA 1P4EC 3R9XA 2ZZNA 4FTFA 2OPLA 4D56A 4X64C 2V7BA 4G37A 1MXBA 1V26A 1YJ7A 2D1RA 4BC7A 1ZB9A 1V60A 3TDEA 4JI6C 2DHMA 2KDNA 4KTVA 2CU6A 1ZB8A 5BSVA 4ZJZA 2XR1A 1WF3A 1UWDA 4NXMC 4AQYC 4FUQA 4B3TC 1HNWC 4DV2C 4L7IA 2MM9A 4I9GA 1O9TA 1FUGA 4RLFA 4JI5C 1PA4A 2NCLA 2E8EA 4B3SC 4WS9A 5CZXA 4LFCC 3CW9A 2QL8A 5AE2A 2OPLB 4DUYC 4KHPC 1WH9A 1MD9A 1J5EC 3FM7A 5BURA 1I94C 3A9UA 3UZ0A 4G36A 4DCTA 2P2QA 4GS5A 2UUCC 4G1IA 1MDFA 3ETOA 3LGXA 5JRHA 4JI8C 2ZZMA 4LF7C 5BSMA 3GR0A 4GXQA 4DCVA 1YGTA 2VSQA 2UU9C 2KZFA 2KZ0A 2P2MA 4JV5C 2Y27A 3DLPX 2E0GA 4DV6C 5IWAC 4RVOA 1K0RA 4R1LA 2JMPA 4BCAA 4LF4C 4LFAC 1MDBA 2QVYX 5K8FA 1AMUA 3PROC 4YHHC 5FLXD 2M5OA 4DV3C 2D27A 3UOWA 2YCBA 4DV7C 5LMNC 4DR2C 2MMAB 4FUTA 3I08A 5BSUA 1MXCA 2QVZX 1LQLA 4IZ6A 4X65C 3GR1A 3LAXA 1IBLC 3SO4A 1IB8A 2UXBC 3AF5A 3GKUA 5ADZA 4R1MA 2D7VA 1ML8A 3GPCA 3LNVA 2UXCC 3T1YC 1PG3A 4JI4C 3N2QA 1M6XA 5IT9D 4DR6C 1PU1A 2ZTBA 4NDNA 5DV9A 2Y4NA 4PUIA 3DHVA 1XHJA 4B3MC 3PESA 2UXDC 1RG9A 3O2EA 4DR5C 3S82A 1M6XC 2OO4A 4NXNC 1N36C 2ATWA 3RV2A 4L4QA 4LF5C 1N33C 3G7SA 4GKJC 2D1SA 5GTDA 2AYAA 4OYCA 3CQ2A 1ULTA 1N34C 3DAYA 1NY8A 4K0BA 1XDXA 2ZM6C 5H9UA 2E8CA 2BJOA 3H2TA 5BR8C 3AY0A 2M5HA 3N54B 3LUSA 1HNZC 2HJGA 3R44A 4ISBA 3J80D 4PUGA 1T5DX 3IEUA 4EATA 3CQ3A 4DR1C 5A1GA 1RY2A 4D57A 2Y4OA 4K0KC 3OTOC 4JI2C 4R0MA 4GXRA 1XRAA 2ONFA 4PZPA 4NOZA 4U5YD 4JYAC 1HNXC 4LF8C 2BH1X 2D1QA 1O92A 1UKKA 4YY3C 2DYJA 4JI1C 4B3RC 2VZEA 1N2FA 1P4EA 2DPLA 2YX1A 2F4VC 1WCJA 1XRCA 3B7WA 1O93A 3TUFA 3A4IA 1QM4A 1XMQC 1XRBA 1GPMA 3FCEA 3CW8X 4MTNA 4ODJA 4JI3C 5A19A 2OBVA 3VNQA 4DV1C 4KTTA 5AE3A 3NI2A 3C5EA 4DG8A 3VNSA 4BSZA 4HPVA 1P7LA 3RG2A 2P2FA 2P20A 4DUZC 1EGAA 2PROA 4X62C 2EGTA 1HR0C 1QWIA 3L95X 1BA3A 3R9WA 4LF6C 2PT7G 1T5HX 2ASBA 4X66C 3A25A 3CJEA 3ETCA 2CXCA 5LMUC 3KXWA 3T1HC 5BUSA 3NYQA 3UX3A 4BBYA 2QW0X 2PG1E 3TR3A 4RLQA 1XNQC 3A26A 2YWBA 4JM1A 4LF9C 1VLAA 2CY1A 5AE1A 2QVXX 1N32C 2E8FA 1USPA 3J81D 4RVNA 4LFBC 1IBKC 1MXAA 1V25A 1XNRC 2VQEC 4PHTA 3TQIA 4BC9A 4LE5A 4RMNA 1IBMC 2D1TA 5T8TA 5BSTA 4RM3A 4ZLPA 1XS3A 2D28C 4XX2A 2PN2A 3FCCA 4L2ZA 5KEIA 4GKKC 4DR3C 5A2QD 2MCQA 4RM2A 1FLOA 4PROC 3CQ1A 5T8SA 4DV5C 2WD9A 2Z51A 5LCIA 1HH2P 5CZVA 1KKGA 1USPB 3EQ6A 2UUBC 2VQFC 4D4GA 1LCIA 5KYTA 1XMOC 5A1IA 1MKYA 1PG4A 4WV3A 4I9FA 2HHHC 1L2FA 4OXIA 3A9VA 4JI7C 4DV0C 5BUQA 2YWCA 3E7XA 3I07A 3JAMD 3K6RA 4DR4C 4DG9A 1NYEA 1TH5A 4JI0C 2JNVA 3J7AD 3NPDA 3VNRA 3PBKA 5E7QA 5BSRA 1VEHA 4PUHA 5KYVA 3IPLA 4DV4C 3IEVA 1O90A 2E5LC 4D4IA 3UEBA 2UUAC 3UX2A 3NYRA 4OX9C 3E7WA 4DR7C 2E7GA 4DCUA 4IR7A 4MH4A 2WP0C 5IFIA 5K85A 1FJGC 2P02A 1JOSA 3AF6A 2P2JA 4TPSB 2P2BA
chains in the Genus database with same CATH topology
3IMLA 4DCSA 3L8CA 5BSWA 3EERA 3R9XA 4FTFA 2OPLA 4D56A 4X64C 2V7BA 4G37A 1MXBA 1V26A 1YJ7A 2D1RA 4BC7A 1ZB9A 3TDEA 4JI6C 4KTVA 1ZB8A 5BSVA 4ZJZA 2XR1A 1WF3A 4NXMC 4AQYC 4FUQA 4B3TC 1HNWC 4DV2C 4L7IA 4I9GA 1O9TA 1FUGA 4RLFA 4JI5C 1PA4A 2E8EA 4B3SC 4WS9A 5CZXA 4LFCC 3CW9A 2QL8A 5AE2A 2OPLB 4DUYC 4KHPC 1WH9A 1MD9A 1J5EC 5BURA 1I94C 3A9UA 3UZ0A 4G36A 4DCTA 2P2QA 4GS5A 2UUCC 4G1IA 1MDFA 3ETOA 3LGXA 4JI8C 5JRHA 4LF7C 5BSMA 3GR0A 4GXQA 4DCVA 2VSQA 2UU9C 2KZFA 2P2MA 4JV5C 2Y27A 3DLPX 2E0GA 4DV6C 5IWAC 4RVOA 1K0RA 4R1LA 2JMPA 4BCAA 4LF4C 4LFAC 1MDBA 2QVYX 5K8FA 1AMUA 3PROC 4YHHC 5FLXD 4DV3C 2D27A 3UOWA 2YCBA 4DV7C 5LMNC 4DR2C 4FUTA 3I08A 5BSUA 1MXCA 2QVZX 1LQLA 4IZ6A 4X65C 3GR1A 3LAXA 1IBLC 3SO4A 2UXBC 3AF5A 3GKUA 5ADZA 4R1MA 2D7VA 1ML8A 3GPCA 3LNVA 2UXCC 3T1YC 1PG3A 4JI4C 3N2QA 5IT9D 4DR6C 4NDNA 5DV9A 2Y4NA 3DHVA 4B3MC 3PESA 2UXDC 1RG9A 4DR5C 3S82A 2OO4A 4NXNC 1N36C 2ATWA 3RV2A 4L4QA 4LF5C 1N33C 3G7SA 4GKJC 2D1SA 5GTDA 2AYAA 4OYCA 1ULTA 1N34C 3DAYA 4K0BA 2ZM6C 5H9UA 2E8CA 2BJOA 3H2TA 5BR8C 3N54B 3LUSA 1HNZC 2HJGA 3R44A 4ISBA 3J80D 4EATA 1T5DX 3IEUA 4DR1C 5A1GA 1RY2A 4D57A 2Y4OA 4K0KC 3OTOC 4JI2C 4R0MA 4GXRA 1XRAA 2ONFA 4PZPA 4NOZA 4U5YD 4JYAC 1HNXC 4LF8C 2BH1X 2D1QA 1O92A 1UKKA 4YY3C 2DYJA 4JI1C 4B3RC 2VZEA 1N2FA 2DPLA 2F4VC 1XRCA 3B7WA 1O93A 3TUFA 3A4IA 1QM4A 1XMQC 1XRBA 1GPMA 3FCEA 3CW8X 4MTNA 4ODJA 4JI3C 5A19A 2OBVA 3VNQA 4DV1C 4KTTA 5AE3A 3NI2A 3C5EA 4DG8A 3VNSA 4BSZA 4HPVA 1P7LA 3RG2A 2P2FA 2P20A 4DUZC 1EGAA 2PROA 4X62C 2EGTA 1HR0C 1QWIA 3L95X 1BA3A 3R9WA 4LF6C 2PT7G 1T5HX 2ASBA 4X66C 3CJEA 3ETCA 2CXCA 5LMUC 3KXWA 3T1HC 5BUSA 3NYQA 4BBYA 2QW0X 4RLQA 1XNQC 2YWBA 4JM1A 4LF9C 1VLAA 2CY1A 5AE1A 2QVXX 1N32C 2E8FA 1USPA 3J81D 4RVNA 4LFBC 1IBKC 1MXAA 1V25A 1XNRC 2VQEC 4PHTA 3TQIA 4BC9A 4LE5A 4RMNA 1IBMC 2D1TA 5T8TA 5BSTA 4RM3A 4ZLPA 2D28C 4XX2A 2PN2A 3FCCA 4L2ZA 5KEIA 4GKKC 4DR3C 5A2QD 4RM2A 4PROC 5T8SA 4DV5C 2WD9A 1HH2P 5CZVA 1KKGA 1USPB 3EQ6A 2UUBC 2VQFC 4D4GA 1LCIA 5KYTA 1XMOC 5A1IA 1MKYA 1PG4A 4WV3A 4I9FA 2HHHC 1L2FA 4OXIA 3A9VA 4JI7C 4DV0C 5BUQA 2YWCA 3E7XA 3I07A 3JAMD 4DR4C 4DG9A 1NYEA 4JI0C 3J7AD 3NPDA 3VNRA 3PBKA 5E7QA 5BSRA 5KYVA 3IPLA 4DV4C 3IEVA 1O90A 2E5LC 4D4IA 2UUAC 3NYRA 4OX9C 3E7WA 4DR7C 2E7GA 4DCUA 4IR7A 4MH4A 2WP0C 5IFIA 5K85A 1FJGC 2P02A 1JOSA 3AF6A 2P2JA 4TPSB 2P2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DCS A;  4LF4 C;  4K0K C;  4LFA C;  3EER A;  3OTO C;  1IBM C;  4JI2 C;  4XX2 A;  2ONF A;  3R9X A;  4NOZ A;  2PN2 A;  4JYA C;  2OPL A;  1HNX C;  4YHH C;  5FLX D;  4LF8 C;  1UKK A;  4GKK C;  4DR3 C;  4YY3 C;  2DYJ A;  4DV3 C;  4JI1 C;  5A2Q D;  4X64 C;  4B3R C;  1N2F A;  2YCB A;  4DV7 C;  5LMN C;  4DR2 C;  2F4V C;  1ZB9 A;  1LQL A;  4DV5 C;  4JI6 C;  4X65 C;  1XMQ C;  1IBL C;  1ZB8 A;  1HH2 P;  2UXB C;  3AF5 A;  3GKU A;  1KKG A;  2D7V A;  4MTN A;  1USP B;  1ML8 A;  2XR1 A;  4JI3 C;  2UUB C;  2VQF C;  2UXC C;  1WF3 A;  4NXM C;  4AQY C;  3T1Y C;  1XMO C;  4B3T C;  4JI4 C;  1HNW C;  5IT9 D;  4DR6 C;  4DV2 C;  4DV1 C;  1MKY A;  4JI5 C;  1PA4 A;  4BSZ A;  2E8E A;  2HHH C;  4B3M C;  2UXD C;  4B3S C;  1L2F A;  4JI7 C;  4LFC C;  4DV0 C;  4DUZ C;  3I07 A;  2QL8 A;  1EGA A;  2OPL B;  3JAM D;  4X62 C;  2EGT A;  4DUY C;  1HR0 C;  4DR5 C;  4KHP C;  1WH9 A;  1QWI A;  1J5E C;  4DR4 C;  4NXN C;  1NYE A;  1N36 C;  3R9W A;  1I94 C;  4JI0 C;  2PT7 G;  4DCT A;  4LF6 C;  2UUC C;  2ATW A;  4LF5 C;  2ASB A;  4X66 C;  3CJE A;  1N33 C;  3J7A D;  2CXC A;  5LMU C;  3T1H C;  4JI8 C;  4GKJ C;  4LF7 C;  1XNQ C;  4LF9 C;  1VLA A;  1N34 C;  2CY1 A;  4DCV A;  4DV4 C;  2ZM6 C;  3IEV A;  2E8C A;  2BJO A;  2E5L C;  5BR8 C;  2UU9 C;  2KZF A;  2UUA C;  3LUS A;  1HNZ C;  2HJG A;  4JV5 C;  1N32 C;  2E8F A;  1USP A;  4OX9 C;  4DR7 C;  3J81 D;  2E7G A;  4DCU A;  3J80 D;  4MH4 A;  4LFB C;  1IBK C;  4DV6 C;  5IWA C;  1FJG C;  1K0R A;  3IEU A;  4DR1 C;  1JOS A;  1XNR C;  3AF6 A;  2VQE C;  2JMP A; 
#chains in the Genus database with same CATH topology
 3IML A;  4DCS A;  3L8C A;  5BSW A;  3EER A;  3LNO A;  1P4E C;  3R9X A;  2ZZN A;  4FTF A;  2OPL A;  4D56 A;  4X64 C;  2V7B A;  4G37 A;  1MXB A;  1V26 A;  1YJ7 A;  2D1R A;  4BC7 A;  1ZB9 A;  1V60 A;  3TDE A;  4JI6 C;  2DHM A;  2KDN A;  4KTV A;  2CU6 A;  1ZB8 A;  5BSV A;  4ZJZ A;  2XR1 A;  1WF3 A;  1UWD A;  4NXM C;  4AQY C;  4FUQ A;  4B3T C;  1HNW C;  4DV2 C;  4L7I A;  2MM9 A;  4I9G A;  1O9T A;  1FUG A;  4RLF A;  4JI5 C;  1PA4 A;  2NCL A;  2E8E A;  4B3S C;  4WS9 A;  5CZX A;  4LFC C;  3CW9 A;  2QL8 A;  5AE2 A;  2OPL B;  4DUY C;  4KHP C;  1WH9 A;  1MD9 A;  1J5E C;  3FM7 A;  5BUR A;  1I94 C;  3A9U A;  3UZ0 A;  4G36 A;  4DCT A;  2P2Q A;  4GS5 A;  2UUC C;  4G1I A;  1MDF A;  3ETO A;  3LGX A;  5JRH A;  4JI8 C;  2ZZM A;  4LF7 C;  5BSM A;  3GR0 A;  4GXQ A;  4DCV A;  1YGT A;  2VSQ A;  2UU9 C;  2KZF A;  2KZ0 A;  2P2M A;  4JV5 C;  2Y27 A;  3DLP X;  2E0G A;  4DV6 C;  5IWA C;  4RVO A;  1K0R A;  4R1L A;  2JMP A;  4BCA A;  4LF4 C;  4LFA C;  1MDB A;  2QVY X;  5K8F A;  1AMU A;  3PRO C;  4YHH C;  5FLX D;  2M5O A;  4DV3 C;  2D27 A;  3UOW A;  2YCB A;  4DV7 C;  5LMN C;  4DR2 C;  2MMA B;  4FUT A;  3I08 A;  5BSU A;  1MXC A;  2QVZ X;  1LQL A;  4IZ6 A;  4X65 C;  3GR1 A;  3LAX A;  1IBL C;  3SO4 A;  1IB8 A;  2UXB C;  3AF5 A;  3GKU A;  5ADZ A;  4R1M A;  2D7V A;  1ML8 A;  3GPC A;  3LNV A;  2UXC C;  3T1Y C;  1PG3 A;  4JI4 C;  3N2Q A;  1M6X A;  5IT9 D;  4DR6 C;  1PU1 A;  2ZTB A;  4NDN A;  5DV9 A;  2Y4N A;  4PUI A;  3DHV A;  1XHJ A;  4B3M C;  3PES A;  2UXD C;  1RG9 A;  3O2E A;  4DR5 C;  3S82 A;  1M6X C;  2OO4 A;  4NXN C;  1N36 C;  2ATW A;  3RV2 A;  4L4Q A;  4LF5 C;  1N33 C;  3G7S A;  4GKJ C;  2D1S A;  5GTD A;  2AYA A;  4OYC A;  3CQ2 A;  1ULT A;  1N34 C;  3DAY A;  1NY8 A;  4K0B A;  1XDX A;  2ZM6 C;  5H9U A;  2E8C A;  2BJO A;  3H2T A;  5BR8 C;  3AY0 A;  2M5H A;  3N54 B;  3LUS A;  1HNZ C;  2HJG A;  3R44 A;  4ISB A;  3J80 D;  4PUG A;  1T5D X;  3IEU A;  4EAT A;  3CQ3 A;  4DR1 C;  5A1G A;  1RY2 A;  4D57 A;  2Y4O A;  4K0K C;  3OTO C;  4JI2 C;  4R0M A;  4GXR A;  1XRA A;  2ONF A;  4PZP A;  4NOZ A;  4U5Y D;  4JYA C;  1HNX C;  4LF8 C;  2BH1 X;  2D1Q A;  1O92 A;  1UKK A;  4YY3 C;  2DYJ A;  4JI1 C;  4B3R C;  2VZE A;  1N2F A;  1P4E A;  2DPL A;  2YX1 A;  2F4V C;  1WCJ A;  1XRC A;  3B7W A;  1O93 A;  3TUF A;  3A4I A;  1QM4 A;  1XMQ C;  1XRB A;  1GPM A;  3FCE A;  3CW8 X;  4MTN A;  4ODJ A;  4JI3 C;  5A19 A;  2OBV A;  3VNQ A;  4DV1 C;  4KTT A;  5AE3 A;  3NI2 A;  3C5E A;  4DG8 A;  3VNS A;  4BSZ A;  4HPV A;  1P7L A;  3RG2 A;  2P2F A;  2P20 A;  4DUZ C;  1EGA A;  2PRO A;  4X62 C;  2EGT A;  1HR0 C;  1QWI A;  3L95 X;  1BA3 A;  3R9W A;  4LF6 C;  2PT7 G;  1T5H X;  2ASB A;  4X66 C;  3A25 A;  3CJE A;  3ETC A;  2CXC A;  5LMU C;  3KXW A;  3T1H C;  5BUS A;  3NYQ A;  3UX3 A;  4BBY A;  2QW0 X;  2PG1 E;  3TR3 A;  4RLQ A;  1XNQ C;  3A26 A;  2YWB A;  4JM1 A;  4LF9 C;  1VLA A;  2CY1 A;  5AE1 A;  2QVX X;  1N32 C;  2E8F A;  1USP A;  3J81 D;  4RVN A;  4LFB C;  1IBK C;  1MXA A;  1V25 A;  1XNR C;  2VQE C;  4PHT A;  3TQI A;  4BC9 A;  4LE5 A;  4RMN A;  1IBM C;  2D1T A;  5T8T A;  5BST A;  4RM3 A;  4ZLP A;  1XS3 A;  2D28 C;  4XX2 A;  2PN2 A;  3FCC A;  4L2Z A;  5KEI A;  4GKK C;  4DR3 C;  5A2Q D;  2MCQ A;  4RM2 A;  1FLO A;  4PRO C;  3CQ1 A;  5T8S A;  4DV5 C;  2WD9 A;  2Z51 A;  5LCI A;  1HH2 P;  5CZV A;  1KKG A;  1USP B;  3EQ6 A;  2UUB C;  2VQF C;  4D4G A;  1LCI A;  5KYT A;  1XMO C;  5A1I A;  1MKY A;  1PG4 A;  4WV3 A;  4I9F A;  2HHH C;  1L2F A;  4OXI A;  3A9V A;  4JI7 C;  4DV0 C;  5BUQ A;  2YWC A;  3E7X A;  3I07 A;  3JAM D;  3K6R A;  4DR4 C;  4DG9 A;  1NYE A;  1TH5 A;  4JI0 C;  2JNV A;  3J7A D;  3NPD A;  3VNR A;  3PBK A;  5E7Q A;  5BSR A;  1VEH A;  4PUH A;  5KYV A;  3IPL A;  4DV4 C;  3IEV A;  1O90 A;  2E5L C;  4D4I A;  3UEB A;  2UUA C;  3UX2 A;  3NYR A;  4OX9 C;  3E7W A;  4DR7 C;  2E7G A;  4DCU A;  4IR7 A;  4MH4 A;  2WP0 C;  5IFI A;  5K85 A;  1FJG C;  2P02 A;  1JOS A;  3AF6 A;  2P2J A;  4TPS B;  2P2B A; 
#chains in the Genus database with same CATH homology
 3IML A;  4DCS A;  3L8C A;  5BSW A;  3EER A;  3R9X A;  4FTF A;  2OPL A;  4D56 A;  4X64 C;  2V7B A;  4G37 A;  1MXB A;  1V26 A;  1YJ7 A;  2D1R A;  4BC7 A;  1ZB9 A;  3TDE A;  4JI6 C;  4KTV A;  1ZB8 A;  5BSV A;  4ZJZ A;  2XR1 A;  1WF3 A;  4NXM C;  4AQY C;  4FUQ A;  4B3T C;  1HNW C;  4DV2 C;  4L7I A;  4I9G A;  1O9T A;  1FUG A;  4RLF A;  4JI5 C;  1PA4 A;  2E8E A;  4B3S C;  4WS9 A;  5CZX A;  4LFC C;  3CW9 A;  2QL8 A;  5AE2 A;  2OPL B;  4DUY C;  4KHP C;  1WH9 A;  1MD9 A;  1J5E C;  5BUR A;  1I94 C;  3A9U A;  3UZ0 A;  4G36 A;  4DCT A;  2P2Q A;  4GS5 A;  2UUC C;  4G1I A;  1MDF A;  3ETO A;  3LGX A;  4JI8 C;  5JRH A;  4LF7 C;  5BSM A;  3GR0 A;  4GXQ A;  4DCV A;  2VSQ A;  2UU9 C;  2KZF A;  2P2M A;  4JV5 C;  2Y27 A;  3DLP X;  2E0G A;  4DV6 C;  5IWA C;  4RVO A;  1K0R A;  4R1L A;  2JMP A;  4BCA A;  4LF4 C;  4LFA C;  1MDB A;  2QVY X;  5K8F A;  1AMU A;  3PRO C;  4YHH C;  5FLX D;  4DV3 C;  2D27 A;  3UOW A;  2YCB A;  4DV7 C;  5LMN C;  4DR2 C;  4FUT A;  3I08 A;  5BSU A;  1MXC A;  2QVZ X;  1LQL A;  4IZ6 A;  4X65 C;  3GR1 A;  3LAX A;  1IBL C;  3SO4 A;  2UXB C;  3AF5 A;  3GKU A;  5ADZ A;  4R1M A;  2D7V A;  1ML8 A;  3GPC A;  3LNV A;  2UXC C;  3T1Y C;  1PG3 A;  4JI4 C;  3N2Q A;  5IT9 D;  4DR6 C;  4NDN A;  5DV9 A;  2Y4N A;  3DHV A;  4B3M C;  3PES A;  2UXD C;  1RG9 A;  4DR5 C;  3S82 A;  2OO4 A;  4NXN C;  1N36 C;  2ATW A;  3RV2 A;  4L4Q A;  4LF5 C;  1N33 C;  3G7S A;  4GKJ C;  2D1S A;  5GTD A;  2AYA A;  4OYC A;  1ULT A;  1N34 C;  3DAY A;  4K0B A;  2ZM6 C;  5H9U A;  2E8C A;  2BJO A;  3H2T A;  5BR8 C;  3N54 B;  3LUS A;  1HNZ C;  2HJG A;  3R44 A;  4ISB A;  3J80 D;  4EAT A;  1T5D X;  3IEU A;  4DR1 C;  5A1G A;  1RY2 A;  4D57 A;  2Y4O A;  4K0K C;  3OTO C;  4JI2 C;  4R0M A;  4GXR A;  1XRA A;  2ONF A;  4PZP A;  4NOZ A;  4U5Y D;  4JYA C;  1HNX C;  4LF8 C;  2BH1 X;  2D1Q A;  1O92 A;  1UKK A;  4YY3 C;  2DYJ A;  4JI1 C;  4B3R C;  2VZE A;  1N2F A;  2DPL A;  2F4V C;  1XRC A;  3B7W A;  1O93 A;  3TUF A;  3A4I A;  1QM4 A;  1XMQ C;  1XRB A;  1GPM A;  3FCE A;  3CW8 X;  4MTN A;  4ODJ A;  4JI3 C;  5A19 A;  2OBV A;  3VNQ A;  4DV1 C;  4KTT A;  5AE3 A;  3NI2 A;  3C5E A;  4DG8 A;  3VNS A;  4BSZ A;  4HPV A;  1P7L A;  3RG2 A;  2P2F A;  2P20 A;  4DUZ C;  1EGA A;  2PRO A;  4X62 C;  2EGT A;  1HR0 C;  1QWI A;  3L95 X;  1BA3 A;  3R9W A;  4LF6 C;  2PT7 G;  1T5H X;  2ASB A;  4X66 C;  3CJE A;  3ETC A;  2CXC A;  5LMU C;  3KXW A;  3T1H C;  5BUS A;  3NYQ A;  4BBY A;  2QW0 X;  4RLQ A;  1XNQ C;  2YWB A;  4JM1 A;  4LF9 C;  1VLA A;  2CY1 A;  5AE1 A;  2QVX X;  1N32 C;  2E8F A;  1USP A;  3J81 D;  4RVN A;  4LFB C;  1IBK C;  1MXA A;  1V25 A;  1XNR C;  2VQE C;  4PHT A;  3TQI A;  4BC9 A;  4LE5 A;  4RMN A;  1IBM C;  2D1T A;  5T8T A;  5BST A;  4RM3 A;  4ZLP A;  2D28 C;  4XX2 A;  2PN2 A;  3FCC A;  4L2Z A;  5KEI A;  4GKK C;  4DR3 C;  5A2Q D;  4RM2 A;  4PRO C;  5T8S A;  4DV5 C;  2WD9 A;  1HH2 P;  5CZV A;  1KKG A;  1USP B;  3EQ6 A;  2UUB C;  2VQF C;  4D4G A;  1LCI A;  5KYT A;  1XMO C;  5A1I A;  1MKY A;  1PG4 A;  4WV3 A;  4I9F A;  2HHH C;  1L2F A;  4OXI A;  3A9V A;  4JI7 C;  4DV0 C;  5BUQ A;  2YWC A;  3E7X A;  3I07 A;  3JAM D;  4DR4 C;  4DG9 A;  1NYE A;  4JI0 C;  3J7A D;  3NPD A;  3VNR A;  3PBK A;  5E7Q A;  5BSR A;  5KYV A;  3IPL A;  4DV4 C;  3IEV A;  1O90 A;  2E5L C;  4D4I A;  2UUA C;  3NYR A;  4OX9 C;  3E7W A;  4DR7 C;  2E7G A;  4DCU A;  4IR7 A;  4MH4 A;  2WP0 C;  5IFI A;  5K85 A;  1FJG C;  2P02 A;  1JOS A;  3AF6 A;  2P2J A;  4TPS B;  2P2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...