4BSZA

Crystal structure of the yeast ribosomal protein rps3 in complex with its chaperone yar1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
187
structure length
187
Chain Sequence
VADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRATRTQDVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKFADGFLIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRDPAKSRTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords 40S RIBOSOMAL PROTEIN S3
publication title Crystal Structure of the Yeast Ribosomal Protein Rps3 in Complex with its Chaperone Yar1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 35
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4bszA01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4bszA02
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4bszA03
4JI8C 2F4VC 1JOSA 4DV2C 4LF8C 2E7GA 2D7VA 3I07A 2E5LC 2UXDC 4OX9C 4JI4C 2E8EA 4BSZA 3AF5A 2UUAC 1L2FA 3R9XA 2OPLA 2PT7G 4DV4C 1N2FA 4X64C 4DV3C 3J81D 2ATWA 4LF6C 4DR4C 2YCBA 1PA4A 1I94C 4AQYC 4LFAC 1ZB8A 4NOZA 4X65C 2UXCC 4MH4A 1HNWC 4KHPC 4JI1C 1LQLA 1N36C 1USPB 1EGAA 1HH2P 4DCUA 1HNZC 2VQFC 1WH9A 4LFCC 4B3SC 4JI5C 3LUSA 3GKUA 1VLAA 4DCSA 3OTOC 4X66C 4K0KC 4GKJC 2EGTA 2HHHC 2UUBC 3T1HC 2CXCA 1IBLC 2UUCC 4JI7C 1XNRC 3CJEA 3J80D 4DR3C 1XMOC 1KKGA 4B3TC 1IBKC 4LF5C 4DR5C 4XX2A 4DV7C 2ASBA 4DV6C 5IWAC 2XR1A 4B3MC 2E8FA 4JI3C 1HNXC 2QL8A 1K0RA 1ZB9A 3IEUA 1USPA 3JAMD 1WF3A 1XNQC 5FLXD 1NYEA 4DR2C 2ZM6C 2BJOA 1MKYA 3EERA 2OPLB 4NXNC 2UXBC 4DR1C 4DCTA 2CY1A 4DV5C 2KZFA 3J7AD 5IT9D 1N34C 4DV0C 4GKKC 4DR7C 4JI0C 4DV1C 4JV5C 1FJGC 1QWIA 4JI6C 4DR6C 4LF7C 2HJGA 4MTNA 2UU9C 4JI2C 4LF9C 1N33C 4LFBC 1ML8A 5LMNC 4X62C 2DYJA 1IBMC 3AF6A 4YHHC 5LMUC 4JYAC 1J5EC 1HR0C 1N32C 3IEVA 1UKKA 5BR8C 2PN2A 4LF4C 2E8CA 3R9WA 4NXMC 5A2QD 4YY3C 4DUYC 4DCVA 3T1YC 4B3RC 1XMQC 2VQEC 4DUZC 2ONFA 2JMPA
chains in the Genus database with same CATH superfamily
3UOWA 4IZ6A 2JNVA 2QW0X 1JOSA 4RLQA 2OO4A 4DV2C 4LF8C 5A1GA 2D7VA 2E5LC 4OX9C 4BSZA 1L2FA 3R9XA 3SO4A 4K0BA 3TQIA 1RY2A 1V60A 4DR4C 3IMLA 1VEHA 5AE3A 5LCIA 2WD9A 1EGAA 3L95X 4GS5A 4BC9A 1WH9A 3A9UA 4LFCC 5T8TA 4B3SC 1YJ7A 1VLAA 4X66C 4K0KC 4RLFA 4GKJC 2HHHC 4DG8A 4PHTA 1IBLC 2Y27A 4JI7C 3CJEA 5JRHA 1MXBA 5IWAC 4B3MC 3KXWA 1ZB9A 4ZJZA 1USPA 2Y4OA 3LAXA 1XHJA 1UWDA 3CQ2A 3PROC 1MKYA 3EERA 2OPLB 3CQ1A 3R44A 1XRCA 1T5DX 4KTVA 1O92A 4DV0C 4GKKC 3DHVA 4FTFA 1QWIA 4NDNA 2MMAB 4LF7C 4MTNA 4DG9A 1V26A 4DUYC 4DCVA 4FUTA 3NPDA 2VZEA 3UX3A 4B3RC 4I9GA 2JMPA 2D28C 1PU1A 4R0MA 2F4VC 1BA3A 2ZZMA 3GR0A 3FCCA 3A9VA 2UXDC 2OBVA 2D1RA 2E0GA 2UUAC 1FUGA 2ZTBA 3H2TA 1XS3A 4LE5A 5KYVA 2PROA 4X64C 2YCBA 4AQYC 4LFAC 1ZB8A 5K8FA 3O2EA 4MH4A 2D27A 5H9UA 1HNZC 4G1IA 4ISBA 2QVXX 3LUSA 3GKUA 5CZVA 1YGTA 2EGTA 1O93A 3T1HC 5ADZA 3LGXA 5BUSA 3TDEA 3J80D 1XMOC 4PZPA 4HPVA 4B3TC 4OYCA 1IBKC 4XX2A 3UX2A 4DV6C 5GTDA 5DV9A 3PESA 2E8FA 1PG4A 2P2MA 1QM4A 5A19A 1AMUA 4R1MA 4WV3A 2YWBA 2ZM6C 4NXNC 2D1TA 4DV5C 2CY1A 2KZFA 1XRBA 1T5HX 2YWCA 4DR7C 4JV5C 1FJGC 2P20A 4DR6C 2HJGA 4JI2C 1P4EA 1ULTA 4RVNA 5LMNC 2DHMA 2BH1X 3AF6A 3G7SA 4JYAC 1J5EC 1HR0C 1N32C 3IEVA 4GXRA 2E8CA 3LNVA 4NXMC 3I08A 1M6XA 1GPMA 4L7IA 5A1IA 1XMQC 2ONFA 1O90A 4BCAA 5KEIA 1XRAA 5K85A 3GR1A 3UZ0A 2E7GA 3I07A 4JI4C 2E8EA 3VNQA 3AF5A 3L8CA 4WS9A 1MXCA 2YX1A 2PT7G 3C5EA 2PG1E 4DV4C 2P2FA 1N2FA 2M5OA 3VNRA 2ATWA 1PA4A 4G37A 1I94C 4PROC 1WCJA 2UXCC 1HNWC 5KYTA 1LQLA 3CQ3A 3A4IA 5BUQA 4JM1A 5IFIA 4JI5C 2KZ0A 3OTOC 4PUHA 2UUBC 2KDNA 2UUCC 4D56A 4RM2A 5AE1A 2P2QA 4G36A 4IR7A 4D4GA 4DR3C 3N54B 4ZLPA 4LF5C 3NYRA 2XR1A 4JI3C 1HNXC 2QL8A 2QVZX 1TH5A 3AY0A 5FLXD 1NYEA 4FUQA 4I9FA 3DAYA 1FLOA 4OXIA 4L2ZA 4TPSB 3A25A 5BSRA 1MXAA 4RVOA 4DCTA 2AYAA 5IT9D 1RG9A 5BURA 1XDXA 4ODJA 4DV1C 3K6RA 1N33C 4LF9C 4LFBC 1ML8A 2DYJA 4GXQA 4YHHC 2CU6A 1LCIA 2QVYX 2PN2A 3R9WA 2NCLA 2MM9A 2V7BA 4YY3C 3T1YC 3VNSA 4DUZC 4D57A 4JI8C 1P7LA 3TUFA 3RV2A 2WP0C 2VSQA 4D4IA 1NY8A 2OPLA 4BC7A 4DV3C 3J81D 4L4QA 2D1SA 5E7QA 4LF6C 1MDBA 3PBKA 4NOZA 4X65C 3N2QA 3B7WA 4PUIA 4JI1C 4KHPC 4RM3A 1USPB 1N36C 1HH2P 4DCUA 2P2BA 2VQFC 5BSVA 4PUGA 3TR3A 3FCEA 4DCSA 1MD9A 3NYQA 3IPLA 2CXCA 3DLPX 5BSMA 2MCQA 2Y4NA 1XNRC 4BBYA 2M5HA 1IB8A 1KKGA 4DR5C 3GPCA 4RMNA 4DV7C 2ASBA 2DPLA 3IEUA 1K0RA 3E7WA 3E7XA 4U5YD 3JAMD 2P02A 1WF3A 1P4EC 5BSUA 1XNQC 1MDFA 2P2JA 4DR2C 2BJOA 3EQ6A 5T8SA 2ZZNA 2UXBC 4DR1C 1O9TA 3CW9A 3UEBA 3J7AD 1N34C 1M6XC 1V25A 3FM7A 3ETOA 4JI0C 3ETCA 5BSWA 4EATA 3A26A 4JI6C 2UU9C 4X62C 1IBMC 4R1LA 5AE2A 1PG3A 5LMUC 1UKKA 3CW8X 5BR8C 5BSTA 4LF4C 2D1QA 5A2QD 3NI2A 3LNOA 2Z51A 5CZXA 2VQEC 3RG2A 4KTTA 3S82A
chains in the Genus database with same CATH topology
3UOWA 4IZ6A 2QW0X 1JOSA 4RLQA 2OO4A 4DV2C 4LF8C 5A1GA 2D7VA 2E5LC 4OX9C 4BSZA 1L2FA 3R9XA 3SO4A 4K0BA 3TQIA 1RY2A 4DR4C 3IMLA 5AE3A 2WD9A 1EGAA 3L95X 4GS5A 4BC9A 1WH9A 3A9UA 4LFCC 5T8TA 4B3SC 1YJ7A 1VLAA 4X66C 4K0KC 4RLFA 4GKJC 2HHHC 4DG8A 4PHTA 1IBLC 2Y27A 4JI7C 3CJEA 5JRHA 1MXBA 5IWAC 4B3MC 3KXWA 1ZB9A 4ZJZA 1USPA 2Y4OA 3LAXA 3PROC 1MKYA 3EERA 2OPLB 3R44A 1XRCA 1T5DX 4KTVA 1O92A 4DV0C 4GKKC 3DHVA 4FTFA 1QWIA 4NDNA 4LF7C 4MTNA 4DG9A 1V26A 4DUYC 4DCVA 4FUTA 3NPDA 2VZEA 4B3RC 4I9GA 2JMPA 2D28C 4R0MA 2F4VC 1BA3A 3GR0A 3FCCA 3A9VA 2UXDC 2OBVA 2D1RA 2E0GA 2UUAC 1FUGA 3H2TA 4LE5A 5KYVA 2PROA 4X64C 2YCBA 4AQYC 4LFAC 1ZB8A 5K8FA 4MH4A 2D27A 5H9UA 1HNZC 4G1IA 4ISBA 2QVXX 3LUSA 3GKUA 5CZVA 2EGTA 1O93A 3T1HC 5ADZA 3LGXA 5BUSA 3TDEA 3J80D 1XMOC 4PZPA 4HPVA 4B3TC 4OYCA 1IBKC 4XX2A 4DV6C 5GTDA 5DV9A 3PESA 2E8FA 1PG4A 2P2MA 1QM4A 5A19A 1AMUA 4R1MA 4WV3A 2YWBA 2ZM6C 4NXNC 2D1TA 4DV5C 2CY1A 2KZFA 1XRBA 1T5HX 2YWCA 4DR7C 4JV5C 1FJGC 2P20A 4DR6C 2HJGA 4JI2C 1ULTA 4RVNA 5LMNC 2BH1X 3AF6A 3G7SA 4JYAC 1J5EC 1HR0C 1N32C 3IEVA 4GXRA 2E8CA 3LNVA 4NXMC 3I08A 1GPMA 4L7IA 5A1IA 1XMQC 2ONFA 1O90A 4BCAA 5KEIA 1XRAA 5K85A 3GR1A 3UZ0A 2E7GA 3I07A 4JI4C 2E8EA 3VNQA 3AF5A 3L8CA 4WS9A 1MXCA 2PT7G 3C5EA 4DV4C 2P2FA 1N2FA 3VNRA 2ATWA 1PA4A 4G37A 1I94C 4PROC 2UXCC 1HNWC 5KYTA 1LQLA 3A4IA 5BUQA 4JM1A 5IFIA 4JI5C 3OTOC 2UUBC 2UUCC 4D56A 4RM2A 5AE1A 2P2QA 4G36A 4IR7A 4D4GA 4DR3C 3N54B 4ZLPA 4LF5C 3NYRA 2XR1A 4JI3C 1HNXC 2QL8A 2QVZX 5FLXD 1NYEA 4FUQA 4I9FA 3DAYA 4OXIA 4L2ZA 4TPSB 5BSRA 1MXAA 4RVOA 4DCTA 2AYAA 5IT9D 1RG9A 5BURA 4ODJA 4DV1C 1N33C 4LF9C 4LFBC 1ML8A 2DYJA 4GXQA 4YHHC 1LCIA 2QVYX 2PN2A 3R9WA 2V7BA 4YY3C 3T1YC 3VNSA 4DUZC 4D57A 4JI8C 1P7LA 3TUFA 3RV2A 2WP0C 2VSQA 4D4IA 2OPLA 4BC7A 4DV3C 3J81D 4L4QA 2D1SA 5E7QA 4LF6C 1MDBA 3PBKA 4NOZA 4X65C 3N2QA 3B7WA 4JI1C 4KHPC 4RM3A 1USPB 1N36C 1HH2P 4DCUA 2P2BA 2VQFC 5BSVA 3FCEA 4DCSA 1MD9A 3NYQA 3IPLA 2CXCA 3DLPX 5BSMA 2Y4NA 1XNRC 4BBYA 1KKGA 4DR5C 3GPCA 4RMNA 4DV7C 2ASBA 2DPLA 3IEUA 1K0RA 3E7WA 3E7XA 4U5YD 3JAMD 2P02A 1WF3A 5BSUA 1XNQC 4DR2C 1MDFA 2P2JA 2BJOA 3EQ6A 5T8SA 2UXBC 4DR1C 1O9TA 3CW9A 3J7AD 1N34C 1V25A 3ETOA 4JI0C 3ETCA 5BSWA 4EATA 4JI6C 2UU9C 4X62C 1IBMC 4R1LA 5AE2A 1PG3A 5LMUC 1UKKA 3CW8X 5BR8C 5BSTA 4LF4C 2D1QA 5A2QD 3NI2A 5CZXA 2VQEC 3RG2A 4KTTA 3S82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 C;  2F4V C;  1JOS A;  4DV2 C;  4LF8 C;  2E7G A;  2D7V A;  3I07 A;  2E5L C;  2UXD C;  4OX9 C;  4JI4 C;  2E8E A;  4BSZ A;  3AF5 A;  2UUA C;  1L2F A;  3R9X A;  2OPL A;  2PT7 G;  4DV4 C;  1N2F A;  4X64 C;  4DV3 C;  3J81 D;  2ATW A;  4LF6 C;  4DR4 C;  2YCB A;  1PA4 A;  1I94 C;  4AQY C;  4LFA C;  1ZB8 A;  4NOZ A;  4X65 C;  2UXC C;  4MH4 A;  1HNW C;  4KHP C;  4JI1 C;  1LQL A;  1N36 C;  1USP B;  1EGA A;  1HH2 P;  4DCU A;  1HNZ C;  2VQF C;  1WH9 A;  4LFC C;  4B3S C;  4JI5 C;  3LUS A;  3GKU A;  1VLA A;  4DCS A;  3OTO C;  4X66 C;  4K0K C;  4GKJ C;  2EGT A;  2HHH C;  2UUB C;  3T1H C;  2CXC A;  1IBL C;  2UUC C;  4JI7 C;  1XNR C;  3CJE A;  3J80 D;  4DR3 C;  1XMO C;  1KKG A;  4B3T C;  1IBK C;  4LF5 C;  4DR5 C;  4XX2 A;  4DV7 C;  2ASB A;  4DV6 C;  5IWA C;  2XR1 A;  4B3M C;  2E8F A;  4JI3 C;  1HNX C;  2QL8 A;  1K0R A;  1ZB9 A;  3IEU A;  1USP A;  3JAM D;  1WF3 A;  1XNQ C;  5FLX D;  1NYE A;  4DR2 C;  2ZM6 C;  2BJO A;  1MKY A;  3EER A;  2OPL B;  4NXN C;  2UXB C;  4DR1 C;  4DCT A;  2CY1 A;  4DV5 C;  2KZF A;  3J7A D;  5IT9 D;  1N34 C;  4DV0 C;  4GKK C;  4DR7 C;  4JI0 C;  4DV1 C;  4JV5 C;  1FJG C;  1QWI A;  4JI6 C;  4DR6 C;  4LF7 C;  2HJG A;  4MTN A;  2UU9 C;  4JI2 C;  4LF9 C;  1N33 C;  4LFB C;  1ML8 A;  5LMN C;  4X62 C;  2DYJ A;  1IBM C;  3AF6 A;  4YHH C;  5LMU C;  4JYA C;  1J5E C;  1HR0 C;  1N32 C;  3IEV A;  1UKK A;  5BR8 C;  2PN2 A;  4LF4 C;  2E8C A;  3R9W A;  4NXM C;  5A2Q D;  4YY3 C;  4DUY C;  4DCV A;  3T1Y C;  4B3R C;  1XMQ C;  2VQE C;  4DUZ C;  2ONF A;  2JMP A; 
#chains in the Genus database with same CATH topology
 3UOW A;  4IZ6 A;  2JNV A;  2QW0 X;  1JOS A;  4RLQ A;  2OO4 A;  4DV2 C;  4LF8 C;  5A1G A;  2D7V A;  2E5L C;  4OX9 C;  4BSZ A;  1L2F A;  3R9X A;  3SO4 A;  4K0B A;  3TQI A;  1RY2 A;  1V60 A;  4DR4 C;  3IML A;  1VEH A;  5AE3 A;  5LCI A;  2WD9 A;  1EGA A;  3L95 X;  4GS5 A;  4BC9 A;  1WH9 A;  3A9U A;  4LFC C;  5T8T A;  4B3S C;  1YJ7 A;  1VLA A;  4X66 C;  4K0K C;  4RLF A;  4GKJ C;  2HHH C;  4DG8 A;  4PHT A;  1IBL C;  2Y27 A;  4JI7 C;  3CJE A;  5JRH A;  1MXB A;  5IWA C;  4B3M C;  3KXW A;  1ZB9 A;  4ZJZ A;  1USP A;  2Y4O A;  3LAX A;  1XHJ A;  1UWD A;  3CQ2 A;  3PRO C;  1MKY A;  3EER A;  2OPL B;  3CQ1 A;  3R44 A;  1XRC A;  1T5D X;  4KTV A;  1O92 A;  4DV0 C;  4GKK C;  3DHV A;  4FTF A;  1QWI A;  4NDN A;  2MMA B;  4LF7 C;  4MTN A;  4DG9 A;  1V26 A;  4DUY C;  4DCV A;  4FUT A;  3NPD A;  2VZE A;  3UX3 A;  4B3R C;  4I9G A;  2JMP A;  2D28 C;  1PU1 A;  4R0M A;  2F4V C;  1BA3 A;  2ZZM A;  3GR0 A;  3FCC A;  3A9V A;  2UXD C;  2OBV A;  2D1R A;  2E0G A;  2UUA C;  1FUG A;  2ZTB A;  3H2T A;  1XS3 A;  4LE5 A;  5KYV A;  2PRO A;  4X64 C;  2YCB A;  4AQY C;  4LFA C;  1ZB8 A;  5K8F A;  3O2E A;  4MH4 A;  2D27 A;  5H9U A;  1HNZ C;  4G1I A;  4ISB A;  2QVX X;  3LUS A;  3GKU A;  5CZV A;  1YGT A;  2EGT A;  1O93 A;  3T1H C;  5ADZ A;  3LGX A;  5BUS A;  3TDE A;  3J80 D;  1XMO C;  4PZP A;  4HPV A;  4B3T C;  4OYC A;  1IBK C;  4XX2 A;  3UX2 A;  4DV6 C;  5GTD A;  5DV9 A;  3PES A;  2E8F A;  1PG4 A;  2P2M A;  1QM4 A;  5A19 A;  1AMU A;  4R1M A;  4WV3 A;  2YWB A;  2ZM6 C;  4NXN C;  2D1T A;  4DV5 C;  2CY1 A;  2KZF A;  1XRB A;  1T5H X;  2YWC A;  4DR7 C;  4JV5 C;  1FJG C;  2P20 A;  4DR6 C;  2HJG A;  4JI2 C;  1P4E A;  1ULT A;  4RVN A;  5LMN C;  2DHM A;  2BH1 X;  3AF6 A;  3G7S A;  4JYA C;  1J5E C;  1HR0 C;  1N32 C;  3IEV A;  4GXR A;  2E8C A;  3LNV A;  4NXM C;  3I08 A;  1M6X A;  1GPM A;  4L7I A;  5A1I A;  1XMQ C;  2ONF A;  1O90 A;  4BCA A;  5KEI A;  1XRA A;  5K85 A;  3GR1 A;  3UZ0 A;  2E7G A;  3I07 A;  4JI4 C;  2E8E A;  3VNQ A;  3AF5 A;  3L8C A;  4WS9 A;  1MXC A;  2YX1 A;  2PT7 G;  3C5E A;  2PG1 E;  4DV4 C;  2P2F A;  1N2F A;  2M5O A;  3VNR A;  2ATW A;  1PA4 A;  4G37 A;  1I94 C;  4PRO C;  1WCJ A;  2UXC C;  1HNW C;  5KYT A;  1LQL A;  3CQ3 A;  3A4I A;  5BUQ A;  4JM1 A;  5IFI A;  4JI5 C;  2KZ0 A;  3OTO C;  4PUH A;  2UUB C;  2KDN A;  2UUC C;  4D56 A;  4RM2 A;  5AE1 A;  2P2Q A;  4G36 A;  4IR7 A;  4D4G A;  4DR3 C;  3N54 B;  4ZLP A;  4LF5 C;  3NYR A;  2XR1 A;  4JI3 C;  1HNX C;  2QL8 A;  2QVZ X;  1TH5 A;  3AY0 A;  5FLX D;  1NYE A;  4FUQ A;  4I9F A;  3DAY A;  1FLO A;  4OXI A;  4L2Z A;  4TPS B;  3A25 A;  5BSR A;  1MXA A;  4RVO A;  4DCT A;  2AYA A;  5IT9 D;  1RG9 A;  5BUR A;  1XDX A;  4ODJ A;  4DV1 C;  3K6R A;  1N33 C;  4LF9 C;  4LFB C;  1ML8 A;  2DYJ A;  4GXQ A;  4YHH C;  2CU6 A;  1LCI A;  2QVY X;  2PN2 A;  3R9W A;  2NCL A;  2MM9 A;  2V7B A;  4YY3 C;  3T1Y C;  3VNS A;  4DUZ C;  4D57 A;  4JI8 C;  1P7L A;  3TUF A;  3RV2 A;  2WP0 C;  2VSQ A;  4D4I A;  1NY8 A;  2OPL A;  4BC7 A;  4DV3 C;  3J81 D;  4L4Q A;  2D1S A;  5E7Q A;  4LF6 C;  1MDB A;  3PBK A;  4NOZ A;  4X65 C;  3N2Q A;  3B7W A;  4PUI A;  4JI1 C;  4KHP C;  4RM3 A;  1USP B;  1N36 C;  1HH2 P;  4DCU A;  2P2B A;  2VQF C;  5BSV A;  4PUG A;  3TR3 A;  3FCE A;  4DCS A;  1MD9 A;  3NYQ A;  3IPL A;  2CXC A;  3DLP X;  5BSM A;  2MCQ A;  2Y4N A;  1XNR C;  4BBY A;  2M5H A;  1IB8 A;  1KKG A;  4DR5 C;  3GPC A;  4RMN A;  4DV7 C;  2ASB A;  2DPL A;  3IEU A;  1K0R A;  3E7W A;  3E7X A;  4U5Y D;  3JAM D;  2P02 A;  1WF3 A;  1P4E C;  5BSU A;  1XNQ C;  1MDF A;  2P2J A;  4DR2 C;  2BJO A;  3EQ6 A;  5T8S A;  2ZZN A;  2UXB C;  4DR1 C;  1O9T A;  3CW9 A;  3UEB A;  3J7A D;  1N34 C;  1M6X C;  1V25 A;  3FM7 A;  3ETO A;  4JI0 C;  3ETC A;  5BSW A;  4EAT A;  3A26 A;  4JI6 C;  2UU9 C;  4X62 C;  1IBM C;  4R1L A;  5AE2 A;  1PG3 A;  5LMU C;  1UKK A;  3CW8 X;  5BR8 C;  5BST A;  4LF4 C;  2D1Q A;  5A2Q D;  3NI2 A;  3LNO A;  2Z51 A;  5CZX A;  2VQE C;  3RG2 A;  4KTT A;  3S82 A; 
#chains in the Genus database with same CATH homology
 3UOW A;  4IZ6 A;  2QW0 X;  1JOS A;  4RLQ A;  2OO4 A;  4DV2 C;  4LF8 C;  5A1G A;  2D7V A;  2E5L C;  4OX9 C;  4BSZ A;  1L2F A;  3R9X A;  3SO4 A;  4K0B A;  3TQI A;  1RY2 A;  4DR4 C;  3IML A;  5AE3 A;  2WD9 A;  1EGA A;  3L95 X;  4GS5 A;  4BC9 A;  1WH9 A;  3A9U A;  4LFC C;  5T8T A;  4B3S C;  1YJ7 A;  1VLA A;  4X66 C;  4K0K C;  4RLF A;  4GKJ C;  2HHH C;  4DG8 A;  4PHT A;  1IBL C;  2Y27 A;  4JI7 C;  3CJE A;  5JRH A;  1MXB A;  5IWA C;  4B3M C;  3KXW A;  1ZB9 A;  4ZJZ A;  1USP A;  2Y4O A;  3LAX A;  3PRO C;  1MKY A;  3EER A;  2OPL B;  3R44 A;  1XRC A;  1T5D X;  4KTV A;  1O92 A;  4DV0 C;  4GKK C;  3DHV A;  4FTF A;  1QWI A;  4NDN A;  4LF7 C;  4MTN A;  4DG9 A;  1V26 A;  4DUY C;  4DCV A;  4FUT A;  3NPD A;  2VZE A;  4B3R C;  4I9G A;  2JMP A;  2D28 C;  4R0M A;  2F4V C;  1BA3 A;  3GR0 A;  3FCC A;  3A9V A;  2UXD C;  2OBV A;  2D1R A;  2E0G A;  2UUA C;  1FUG A;  3H2T A;  4LE5 A;  5KYV A;  2PRO A;  4X64 C;  2YCB A;  4AQY C;  4LFA C;  1ZB8 A;  5K8F A;  4MH4 A;  2D27 A;  5H9U A;  1HNZ C;  4G1I A;  4ISB A;  2QVX X;  3LUS A;  3GKU A;  5CZV A;  2EGT A;  1O93 A;  3T1H C;  5ADZ A;  3LGX A;  5BUS A;  3TDE A;  3J80 D;  1XMO C;  4PZP A;  4HPV A;  4B3T C;  4OYC A;  1IBK C;  4XX2 A;  4DV6 C;  5GTD A;  5DV9 A;  3PES A;  2E8F A;  1PG4 A;  2P2M A;  1QM4 A;  5A19 A;  1AMU A;  4R1M A;  4WV3 A;  2YWB A;  2ZM6 C;  4NXN C;  2D1T A;  4DV5 C;  2CY1 A;  2KZF A;  1XRB A;  1T5H X;  2YWC A;  4DR7 C;  4JV5 C;  1FJG C;  2P20 A;  4DR6 C;  2HJG A;  4JI2 C;  1ULT A;  4RVN A;  5LMN C;  2BH1 X;  3AF6 A;  3G7S A;  4JYA C;  1J5E C;  1HR0 C;  1N32 C;  3IEV A;  4GXR A;  2E8C A;  3LNV A;  4NXM C;  3I08 A;  1GPM A;  4L7I A;  5A1I A;  1XMQ C;  2ONF A;  1O90 A;  4BCA A;  5KEI A;  1XRA A;  5K85 A;  3GR1 A;  3UZ0 A;  2E7G A;  3I07 A;  4JI4 C;  2E8E A;  3VNQ A;  3AF5 A;  3L8C A;  4WS9 A;  1MXC A;  2PT7 G;  3C5E A;  4DV4 C;  2P2F A;  1N2F A;  3VNR A;  2ATW A;  1PA4 A;  4G37 A;  1I94 C;  4PRO C;  2UXC C;  1HNW C;  5KYT A;  1LQL A;  3A4I A;  5BUQ A;  4JM1 A;  5IFI A;  4JI5 C;  3OTO C;  2UUB C;  2UUC C;  4D56 A;  4RM2 A;  5AE1 A;  2P2Q A;  4G36 A;  4IR7 A;  4D4G A;  4DR3 C;  3N54 B;  4ZLP A;  4LF5 C;  3NYR A;  2XR1 A;  4JI3 C;  1HNX C;  2QL8 A;  2QVZ X;  5FLX D;  1NYE A;  4FUQ A;  4I9F A;  3DAY A;  4OXI A;  4L2Z A;  4TPS B;  5BSR A;  1MXA A;  4RVO A;  4DCT A;  2AYA A;  5IT9 D;  1RG9 A;  5BUR A;  4ODJ A;  4DV1 C;  1N33 C;  4LF9 C;  4LFB C;  1ML8 A;  2DYJ A;  4GXQ A;  4YHH C;  1LCI A;  2QVY X;  2PN2 A;  3R9W A;  2V7B A;  4YY3 C;  3T1Y C;  3VNS A;  4DUZ C;  4D57 A;  4JI8 C;  1P7L A;  3TUF A;  3RV2 A;  2WP0 C;  2VSQ A;  4D4I A;  2OPL A;  4BC7 A;  4DV3 C;  3J81 D;  4L4Q A;  2D1S A;  5E7Q A;  4LF6 C;  1MDB A;  3PBK A;  4NOZ A;  4X65 C;  3N2Q A;  3B7W A;  4JI1 C;  4KHP C;  4RM3 A;  1USP B;  1N36 C;  1HH2 P;  4DCU A;  2P2B A;  2VQF C;  5BSV A;  3FCE A;  4DCS A;  1MD9 A;  3NYQ A;  3IPL A;  2CXC A;  3DLP X;  5BSM A;  2Y4N A;  1XNR C;  4BBY A;  1KKG A;  4DR5 C;  3GPC A;  4RMN A;  4DV7 C;  2ASB A;  2DPL A;  3IEU A;  1K0R A;  3E7W A;  3E7X A;  4U5Y D;  3JAM D;  2P02 A;  1WF3 A;  5BSU A;  1XNQ C;  4DR2 C;  1MDF A;  2P2J A;  2BJO A;  3EQ6 A;  5T8S A;  2UXB C;  4DR1 C;  1O9T A;  3CW9 A;  3J7A D;  1N34 C;  1V25 A;  3ETO A;  4JI0 C;  3ETC A;  5BSW A;  4EAT A;  4JI6 C;  2UU9 C;  4X62 C;  1IBM C;  4R1L A;  5AE2 A;  1PG3 A;  5LMU C;  1UKK A;  3CW8 X;  5BR8 C;  5BST A;  4LF4 C;  2D1Q A;  5A2Q D;  3NI2 A;  5CZX A;  2VQE C;  3RG2 A;  4KTT A;  3S82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...