4B3MC

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4b3mC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4b3mC02
2ONFA 4DV6C 4LF4C 4X64C 3J80D 4JI6C 4JYAC 2XR1A 4DR2C 5LMNC 1XMQC 2OPLB 1N34C 2CXCA 3GKUA 3OTOC 4JI3C 2ZM6C 3I07A 3J81D 2JMPA 1HNZC 2UU9C 2KZFA 1KKGA 4MH4A 4KHPC 4DV5C 4B3SC 2OPLA 1N36C 2D7VA 4X66C 3R9WA 1HH2P 2YCBA 1N33C 4DV4C 3T1HC 5A2QD 2VQEC 2QL8A 2PN2A 1IBKC 4DR5C 4JV5C 4JI2C 4X65C 4AQYC 3EERA 2HJGA 4YY3C 4NOZA 4DV1C 4LFBC 2UXDC 5BR8C 5IT9D 1L2FA 4LF8C 2CY1A 4JI5C 2UUBC 2UXCC 1HNWC 1N32C 4DR1C 5LMUC 3IEUA 4DCVA 4JI4C 1XNQC 1EGAA 3CJEA 2E5LC 4B3TC 1USPA 4DV7C 4JI8C 4JI1C 2EGTA 2F4VC 2E8CA 1QWIA 4DUYC 3JAMD 1ZB9A 4JI0C 1K0RA 4LF9C 2ASBA 4GKJC 4NXMC 2ATWA 3AF6A 3T1YC 4NXNC 1JOSA 1HNXC 4OX9C 4XX2A 4B3RC 2E8EA 1UKKA 1XNRC 1WH9A 1VLAA 4DV2C 4LFCC 4BSZA 4DR7C 4DR4C 1PA4A 4LF5C 3IEVA 2E7GA 2BJOA 1LQLA 1FJGC 2UXBC 4LFAC 1IBLC 4DR6C 4GKKC 4YHHC 1XMOC 4DUZC 3J7AD 5FLXD 1J5EC 4LF7C 1MKYA 4DCUA 2UUCC 3AF5A 2PT7G 4JI7C 4DV3C 3LUSA 1HR0C 1USPB 1NYEA 3R9XA 4DCSA 4X62C 2UUAC 4K0KC 2HHHC 1WF3A 2VQFC 4B3MC 2E8FA 1N2FA 4MTNA 1ZB8A 4LF6C 2DYJA 4DV0C 1ML8A 1IBMC 4DCTA 5IWAC 4DR3C 1I94C
chains in the Genus database with same CATH superfamily
3E7WA 3J80D 3L95X 3A9VA 2ZZMA 4BC9A 2WD9A 3RV2A 3OTOC 2ZM6C 3I07A 3NPDA 4B3SC 3E7XA 1N36C 2YCBA 5A1GA 4DV4C 3K6RA 1YGTA 3I08A 1O9TA 3G7SA 5BSVA 2PN2A 4JV5C 4JI2C 4X65C 4AQYC 4L4QA 1PU1A 2Y27A 3SO4A 3NYRA 2VZEA 3GR1A 4WV3A 2V7BA 2E5LC 1T5DX 5E7QA 4TPSB 1XRBA 1MXBA 2BH1X 4GS5A 4DV7C 3TR3A 2E8CA 3UEBA 5H9UA 4R0MA 4ISBA 4LF9C 4D57A 2ASBA 3H2TA 4NXMC 3GPCA 3UX2A 4FUQA 2ZTBA 4OX9C 4BBYA 3B7WA 1IB8A 1XNRC 4L7IA 2NCLA 4BSZA 1PA4A 2P2JA 4L2ZA 5T8TA 2WP0C 2Z51A 1IBLC 2YWCA 3J7AD 4U5YD 5FLXD 1J5EC 4LE5A 5BURA 3IMLA 3CQ1A 2P2BA 2PT7G 4I9FA 3C5EA 4JI7C 3CQ2A 2QW0X 1V25A 2YX1A 1WF3A 1N2FA 2P2QA 2DYJA 4DG9A 3N2QA 3FM7A 5BSRA 4X64C 4JYAC 1XMQC 2OPLB 4PUGA 3R44A 3GKUA 5BSTA 1BA3A 3DAYA 2JMPA 1HNZC 2UU9C 2KZFA 3S82A 4MH4A 4DV5C 3ETCA 4X66C 5AE1A 2KZ0A 4PROC 3LAXA 5JRHA 2VQEC 3RG2A 2QVXX 4LFBC 1MXCA 1L2FA 2M5HA 4BCAA 2CY1A 5A1IA 3O2EA 2UUBC 5KYTA 4FTFA 1N32C 2E0GA 1RG9A 5LMUC 3IEUA 4JI4C 5AE3A 5CZVA 3ETOA 5T8SA 2PG1E 4JI8C 2AYAA 4DUYC 5IFIA 2MMAB 4JI0C 1K0RA 1FLOA 3VNQA 3PESA 2JNVA 5LCIA 3FCEA 4XX2A 3TDEA 1O92A 2D27A 1MDFA 4ZLPA 1XDXA 2Y4OA 3NI2A 4LFCC 2MM9A 1P4EC 2BJOA 2UXBC 4LFAC 1M6XA 4GKKC 4YHHC 1XMOC 3A9UA 2QVZX 5K8FA 2Y4NA 5CZXA 3AF5A 4GXQA 1USPB 4X62C 4B3MC 3CQ3A 4PHTA 3DLPX 4MTNA 2D1TA 1ZB8A 4DV0C 1LCIA 4DR3C 3A26A 1MXAA 2ONFA 4KTTA 4I9GA 1NY8A 2XR1A 3VNRA 3TQIA 5LMNC 1XS3A 4FUTA 4RLFA 1N34C 2CXCA 3N54B 5BUSA 4WS9A 2P2MA 1P4EA 1KKGA 1WCJA 4KHPC 1M6XC 2MCQA 5DV9A 2VSQA 2QVYX 1MD9A 3R9WA 1N33C 5BSWA 3L8CA 3A25A 2QL8A 1IBKC 4DR5C 3UOWA 2P2FA 5GTDA 1PG4A 4YY3C 4NOZA 4DV1C 5IT9D 4LF8C 5BSUA 4D4IA 4RLQA 4DG8A 4EATA 2UXCC 4DR1C 4DCVA 4PUHA 3CJEA 1USPA 1MDBA 4BC7A 1O90A 1QWIA 4ODJA 1V26A 2ATWA 3AF6A 4NXNC 1JOSA 3AY0A 1O93A 1FUGA 2D1RA 4D4GA 4RM3A 1UKKA 1XRCA 1UWDA 1VLAA 4DV2C 3IEVA 2E7GA 5ADZA 1YJ7A 2P02A 1LQLA 2DHMA 4DR6C 4OYCA 1MKYA 4DCUA 4G37A 3CW8X 5A19A 2UUCC 5KYVA 4K0BA 3LUSA 1HR0C 4DCSA 4K0KC 2HHHC 2E8FA 2M5OA 1ULTA 3UX3A 1IBMC 4DCTA 3A4IA 5IWAC 5BUQA 1I94C 3LGXA 4JM1A 4DV6C 4LF4C 3EQ6A 5AE2A 4JI6C 4DR2C 1T5HX 4RMNA 1XRAA 4JI3C 1RY2A 3FCCA 3J81D 1P7LA 5KEIA 2OPLA 4IR7A 3VNSA 2D7VA 3IPLA 1HH2P 4G1IA 3T1HC 4R1MA 5A2QD 4RM2A 3PBKA 3GR0A 2D1QA 2ZZNA 3DHVA 3EERA 2HJGA 2UXDC 5BR8C 1VEHA 4KTVA 4JI5C 1QM4A 1HNWC 2DPLA 5BSMA 1XHJA 1V60A 1XNQC 1EGAA 4B3TC 1TH5A 4R1LA 3PROC 4G36A 4JI1C 2EGTA 2F4VC 4NDNA 3NYQA 4IZ6A 3JAMD 3LNVA 1ZB9A 3KXWA 4GKJC 2OBVA 3UZ0A 3T1YC 1HNXC 4PZPA 4RVOA 2KDNA 4B3RC 3LNOA 2D28C 2E8EA 4GXRA 1WH9A 4D56A 4PUIA 4DR7C 2OO4A 1AMUA 4DR4C 4LF5C 1FJGC 5K85A 4ZJZA 4DUZC 3CW9A 4LF7C 4RVNA 4HPVA 1PG3A 4DV3C 2PROA 2D1SA 2YWBA 1NYEA 3R9XA 2UUAC 3TUFA 2P20A 2VQFC 4OXIA 1GPMA 4LF6C 1ML8A 2CU6A
chains in the Genus database with same CATH topology
3E7WA 3J80D 3L95X 3A9VA 4BC9A 2WD9A 3RV2A 3OTOC 2ZM6C 3I07A 3NPDA 4B3SC 3E7XA 1N36C 2YCBA 5A1GA 4DV4C 3I08A 1O9TA 3G7SA 5BSVA 2PN2A 4JV5C 4JI2C 4X65C 4AQYC 4L4QA 2Y27A 3SO4A 3NYRA 2VZEA 3GR1A 4WV3A 2V7BA 2E5LC 1T5DX 5E7QA 4TPSB 1XRBA 1MXBA 2BH1X 4GS5A 4DV7C 2E8CA 5H9UA 4R0MA 4ISBA 4LF9C 4D57A 2ASBA 3H2TA 4NXMC 3GPCA 4FUQA 4OX9C 4BBYA 3B7WA 1XNRC 4L7IA 4BSZA 1PA4A 2P2JA 4L2ZA 5T8TA 2WP0C 1IBLC 2YWCA 3J7AD 4U5YD 5FLXD 1J5EC 4LE5A 5BURA 3IMLA 2P2BA 2PT7G 4I9FA 3C5EA 4JI7C 2QW0X 1V25A 1WF3A 1N2FA 2P2QA 2DYJA 4DG9A 3N2QA 5BSRA 4X64C 4JYAC 1XMQC 2OPLB 3R44A 3GKUA 5BSTA 1BA3A 3DAYA 2JMPA 1HNZC 2UU9C 2KZFA 3S82A 4MH4A 4DV5C 3ETCA 4X66C 5AE1A 4PROC 3LAXA 5JRHA 2VQEC 3RG2A 2QVXX 4LFBC 1MXCA 1L2FA 4BCAA 2CY1A 5A1IA 2UUBC 5KYTA 4FTFA 1N32C 2E0GA 1RG9A 5LMUC 3IEUA 4JI4C 5AE3A 5CZVA 3ETOA 5T8SA 4JI8C 2AYAA 4DUYC 5IFIA 4JI0C 1K0RA 3VNQA 3PESA 3FCEA 4XX2A 3TDEA 1O92A 2D27A 1MDFA 4ZLPA 2Y4OA 3NI2A 4LFCC 2BJOA 2UXBC 4LFAC 4GKKC 4YHHC 1XMOC 3A9UA 2QVZX 5K8FA 2Y4NA 5CZXA 3AF5A 4GXQA 1USPB 4X62C 4B3MC 4PHTA 3DLPX 4MTNA 2D1TA 1ZB8A 4DV0C 1LCIA 4DR3C 1MXAA 2ONFA 4KTTA 4I9GA 2XR1A 3VNRA 3TQIA 5LMNC 4FUTA 4RLFA 1N34C 2CXCA 3N54B 5BUSA 4WS9A 2P2MA 1KKGA 4KHPC 5DV9A 2VSQA 2QVYX 1MD9A 3R9WA 1N33C 5BSWA 3L8CA 2QL8A 1IBKC 4DR5C 3UOWA 2P2FA 5GTDA 1PG4A 4YY3C 4NOZA 4DV1C 5IT9D 4LF8C 5BSUA 4D4IA 4RLQA 4DG8A 4EATA 2UXCC 4DR1C 4DCVA 3CJEA 1USPA 1MDBA 4BC7A 1O90A 1QWIA 4ODJA 1V26A 2ATWA 3AF6A 4NXNC 1JOSA 1O93A 1FUGA 2D1RA 4D4GA 4RM3A 1UKKA 1XRCA 1VLAA 4DV2C 3IEVA 2E7GA 5ADZA 1YJ7A 2P02A 1LQLA 4DR6C 4OYCA 1MKYA 4DCUA 4G37A 3CW8X 5A19A 2UUCC 5KYVA 4K0BA 3LUSA 1HR0C 4DCSA 4K0KC 2HHHC 2E8FA 1ULTA 1IBMC 4DCTA 3A4IA 5IWAC 5BUQA 1I94C 3LGXA 4JM1A 4DV6C 4LF4C 3EQ6A 5AE2A 4JI6C 4DR2C 1T5HX 4RMNA 1XRAA 4JI3C 1RY2A 3FCCA 3J81D 1P7LA 5KEIA 2OPLA 4IR7A 3VNSA 2D7VA 3IPLA 1HH2P 4G1IA 3T1HC 4R1MA 5A2QD 4RM2A 3PBKA 3GR0A 2D1QA 3DHVA 3EERA 2HJGA 2UXDC 5BR8C 4KTVA 4JI5C 1QM4A 1HNWC 2DPLA 5BSMA 1XNQC 1EGAA 4B3TC 4R1LA 3PROC 4G36A 4JI1C 2EGTA 2F4VC 4NDNA 3NYQA 4IZ6A 3JAMD 3LNVA 1ZB9A 3KXWA 4GKJC 2OBVA 3UZ0A 3T1YC 1HNXC 4PZPA 4RVOA 4B3RC 2D28C 2E8EA 4GXRA 1WH9A 4D56A 4DR7C 2OO4A 1AMUA 4DR4C 4LF5C 1FJGC 5K85A 4ZJZA 4DUZC 3CW9A 4LF7C 4RVNA 4HPVA 1PG3A 4DV3C 2PROA 2D1SA 2YWBA 1NYEA 3R9XA 2UUAC 3TUFA 2P20A 2VQFC 4OXIA 1GPMA 4LF6C 1ML8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ONF A;  4DV6 C;  4LF4 C;  4X64 C;  3J80 D;  4JI6 C;  4JYA C;  2XR1 A;  4DR2 C;  5LMN C;  1XMQ C;  2OPL B;  1N34 C;  2CXC A;  3GKU A;  3OTO C;  4JI3 C;  2ZM6 C;  3I07 A;  3J81 D;  2JMP A;  1HNZ C;  2UU9 C;  2KZF A;  1KKG A;  4MH4 A;  4KHP C;  4DV5 C;  4B3S C;  2OPL A;  1N36 C;  2D7V A;  4X66 C;  3R9W A;  1HH2 P;  2YCB A;  1N33 C;  4DV4 C;  3T1H C;  5A2Q D;  2VQE C;  2QL8 A;  2PN2 A;  1IBK C;  4DR5 C;  4JV5 C;  4JI2 C;  4X65 C;  4AQY C;  3EER A;  2HJG A;  4YY3 C;  4NOZ A;  4DV1 C;  4LFB C;  2UXD C;  5BR8 C;  5IT9 D;  1L2F A;  4LF8 C;  2CY1 A;  4JI5 C;  2UUB C;  2UXC C;  1HNW C;  1N32 C;  4DR1 C;  5LMU C;  3IEU A;  4DCV A;  4JI4 C;  1XNQ C;  1EGA A;  3CJE A;  2E5L C;  4B3T C;  1USP A;  4DV7 C;  4JI8 C;  4JI1 C;  2EGT A;  2F4V C;  2E8C A;  1QWI A;  4DUY C;  3JAM D;  1ZB9 A;  4JI0 C;  1K0R A;  4LF9 C;  2ASB A;  4GKJ C;  4NXM C;  2ATW A;  3AF6 A;  3T1Y C;  4NXN C;  1JOS A;  1HNX C;  4OX9 C;  4XX2 A;  4B3R C;  2E8E A;  1UKK A;  1XNR C;  1WH9 A;  1VLA A;  4DV2 C;  4LFC C;  4BSZ A;  4DR7 C;  4DR4 C;  1PA4 A;  4LF5 C;  3IEV A;  2E7G A;  2BJO A;  1LQL A;  1FJG C;  2UXB C;  4LFA C;  1IBL C;  4DR6 C;  4GKK C;  4YHH C;  1XMO C;  4DUZ C;  3J7A D;  5FLX D;  1J5E C;  4LF7 C;  1MKY A;  4DCU A;  2UUC C;  3AF5 A;  2PT7 G;  4JI7 C;  4DV3 C;  3LUS A;  1HR0 C;  1USP B;  1NYE A;  3R9X A;  4DCS A;  4X62 C;  2UUA C;  4K0K C;  2HHH C;  1WF3 A;  2VQF C;  4B3M C;  2E8F A;  1N2F A;  4MTN A;  1ZB8 A;  4LF6 C;  2DYJ A;  4DV0 C;  1ML8 A;  1IBM C;  4DCT A;  5IWA C;  4DR3 C;  1I94 C; 
#chains in the Genus database with same CATH topology
 3E7W A;  3J80 D;  3L95 X;  3A9V A;  2ZZM A;  4BC9 A;  2WD9 A;  3RV2 A;  3OTO C;  2ZM6 C;  3I07 A;  3NPD A;  4B3S C;  3E7X A;  1N36 C;  2YCB A;  5A1G A;  4DV4 C;  3K6R A;  1YGT A;  3I08 A;  1O9T A;  3G7S A;  5BSV A;  2PN2 A;  4JV5 C;  4JI2 C;  4X65 C;  4AQY C;  4L4Q A;  1PU1 A;  2Y27 A;  3SO4 A;  3NYR A;  2VZE A;  3GR1 A;  4WV3 A;  2V7B A;  2E5L C;  1T5D X;  5E7Q A;  4TPS B;  1XRB A;  1MXB A;  2BH1 X;  4GS5 A;  4DV7 C;  3TR3 A;  2E8C A;  3UEB A;  5H9U A;  4R0M A;  4ISB A;  4LF9 C;  4D57 A;  2ASB A;  3H2T A;  4NXM C;  3GPC A;  3UX2 A;  4FUQ A;  2ZTB A;  4OX9 C;  4BBY A;  3B7W A;  1IB8 A;  1XNR C;  4L7I A;  2NCL A;  4BSZ A;  1PA4 A;  2P2J A;  4L2Z A;  5T8T A;  2WP0 C;  2Z51 A;  1IBL C;  2YWC A;  3J7A D;  4U5Y D;  5FLX D;  1J5E C;  4LE5 A;  5BUR A;  3IML A;  3CQ1 A;  2P2B A;  2PT7 G;  4I9F A;  3C5E A;  4JI7 C;  3CQ2 A;  2QW0 X;  1V25 A;  2YX1 A;  1WF3 A;  1N2F A;  2P2Q A;  2DYJ A;  4DG9 A;  3N2Q A;  3FM7 A;  5BSR A;  4X64 C;  4JYA C;  1XMQ C;  2OPL B;  4PUG A;  3R44 A;  3GKU A;  5BST A;  1BA3 A;  3DAY A;  2JMP A;  1HNZ C;  2UU9 C;  2KZF A;  3S82 A;  4MH4 A;  4DV5 C;  3ETC A;  4X66 C;  5AE1 A;  2KZ0 A;  4PRO C;  3LAX A;  5JRH A;  2VQE C;  3RG2 A;  2QVX X;  4LFB C;  1MXC A;  1L2F A;  2M5H A;  4BCA A;  2CY1 A;  5A1I A;  3O2E A;  2UUB C;  5KYT A;  4FTF A;  1N32 C;  2E0G A;  1RG9 A;  5LMU C;  3IEU A;  4JI4 C;  5AE3 A;  5CZV A;  3ETO A;  5T8S A;  2PG1 E;  4JI8 C;  2AYA A;  4DUY C;  5IFI A;  2MMA B;  4JI0 C;  1K0R A;  1FLO A;  3VNQ A;  3PES A;  2JNV A;  5LCI A;  3FCE A;  4XX2 A;  3TDE A;  1O92 A;  2D27 A;  1MDF A;  4ZLP A;  1XDX A;  2Y4O A;  3NI2 A;  4LFC C;  2MM9 A;  1P4E C;  2BJO A;  2UXB C;  4LFA C;  1M6X A;  4GKK C;  4YHH C;  1XMO C;  3A9U A;  2QVZ X;  5K8F A;  2Y4N A;  5CZX A;  3AF5 A;  4GXQ A;  1USP B;  4X62 C;  4B3M C;  3CQ3 A;  4PHT A;  3DLP X;  4MTN A;  2D1T A;  1ZB8 A;  4DV0 C;  1LCI A;  4DR3 C;  3A26 A;  1MXA A;  2ONF A;  4KTT A;  4I9G A;  1NY8 A;  2XR1 A;  3VNR A;  3TQI A;  5LMN C;  1XS3 A;  4FUT A;  4RLF A;  1N34 C;  2CXC A;  3N54 B;  5BUS A;  4WS9 A;  2P2M A;  1P4E A;  1KKG A;  1WCJ A;  4KHP C;  1M6X C;  2MCQ A;  5DV9 A;  2VSQ A;  2QVY X;  1MD9 A;  3R9W A;  1N33 C;  5BSW A;  3L8C A;  3A25 A;  2QL8 A;  1IBK C;  4DR5 C;  3UOW A;  2P2F A;  5GTD A;  1PG4 A;  4YY3 C;  4NOZ A;  4DV1 C;  5IT9 D;  4LF8 C;  5BSU A;  4D4I A;  4RLQ A;  4DG8 A;  4EAT A;  2UXC C;  4DR1 C;  4DCV A;  4PUH A;  3CJE A;  1USP A;  1MDB A;  4BC7 A;  1O90 A;  1QWI A;  4ODJ A;  1V26 A;  2ATW A;  3AF6 A;  4NXN C;  1JOS A;  3AY0 A;  1O93 A;  1FUG A;  2D1R A;  4D4G A;  4RM3 A;  1UKK A;  1XRC A;  1UWD A;  1VLA A;  4DV2 C;  3IEV A;  2E7G A;  5ADZ A;  1YJ7 A;  2P02 A;  1LQL A;  2DHM A;  4DR6 C;  4OYC A;  1MKY A;  4DCU A;  4G37 A;  3CW8 X;  5A19 A;  2UUC C;  5KYV A;  4K0B A;  3LUS A;  1HR0 C;  4DCS A;  4K0K C;  2HHH C;  2E8F A;  2M5O A;  1ULT A;  3UX3 A;  1IBM C;  4DCT A;  3A4I A;  5IWA C;  5BUQ A;  1I94 C;  3LGX A;  4JM1 A;  4DV6 C;  4LF4 C;  3EQ6 A;  5AE2 A;  4JI6 C;  4DR2 C;  1T5H X;  4RMN A;  1XRA A;  4JI3 C;  1RY2 A;  3FCC A;  3J81 D;  1P7L A;  5KEI A;  2OPL A;  4IR7 A;  3VNS A;  2D7V A;  3IPL A;  1HH2 P;  4G1I A;  3T1H C;  4R1M A;  5A2Q D;  4RM2 A;  3PBK A;  3GR0 A;  2D1Q A;  2ZZN A;  3DHV A;  3EER A;  2HJG A;  2UXD C;  5BR8 C;  1VEH A;  4KTV A;  4JI5 C;  1QM4 A;  1HNW C;  2DPL A;  5BSM A;  1XHJ A;  1V60 A;  1XNQ C;  1EGA A;  4B3T C;  1TH5 A;  4R1L A;  3PRO C;  4G36 A;  4JI1 C;  2EGT A;  2F4V C;  4NDN A;  3NYQ A;  4IZ6 A;  3JAM D;  3LNV A;  1ZB9 A;  3KXW A;  4GKJ C;  2OBV A;  3UZ0 A;  3T1Y C;  1HNX C;  4PZP A;  4RVO A;  2KDN A;  4B3R C;  3LNO A;  2D28 C;  2E8E A;  4GXR A;  1WH9 A;  4D56 A;  4PUI A;  4DR7 C;  2OO4 A;  1AMU A;  4DR4 C;  4LF5 C;  1FJG C;  5K85 A;  4ZJZ A;  4DUZ C;  3CW9 A;  4LF7 C;  4RVN A;  4HPV A;  1PG3 A;  4DV3 C;  2PRO A;  2D1S A;  2YWB A;  1NYE A;  3R9X A;  2UUA C;  3TUF A;  2P20 A;  2VQF C;  4OXI A;  1GPM A;  4LF6 C;  1ML8 A;  2CU6 A; 
#chains in the Genus database with same CATH homology
 3E7W A;  3J80 D;  3L95 X;  3A9V A;  4BC9 A;  2WD9 A;  3RV2 A;  3OTO C;  2ZM6 C;  3I07 A;  3NPD A;  4B3S C;  3E7X A;  1N36 C;  2YCB A;  5A1G A;  4DV4 C;  3I08 A;  1O9T A;  3G7S A;  5BSV A;  2PN2 A;  4JV5 C;  4JI2 C;  4X65 C;  4AQY C;  4L4Q A;  2Y27 A;  3SO4 A;  3NYR A;  2VZE A;  3GR1 A;  4WV3 A;  2V7B A;  2E5L C;  1T5D X;  5E7Q A;  4TPS B;  1XRB A;  1MXB A;  2BH1 X;  4GS5 A;  4DV7 C;  2E8C A;  5H9U A;  4R0M A;  4ISB A;  4LF9 C;  4D57 A;  2ASB A;  3H2T A;  4NXM C;  3GPC A;  4FUQ A;  4OX9 C;  4BBY A;  3B7W A;  1XNR C;  4L7I A;  4BSZ A;  1PA4 A;  2P2J A;  4L2Z A;  5T8T A;  2WP0 C;  1IBL C;  2YWC A;  3J7A D;  4U5Y D;  5FLX D;  1J5E C;  4LE5 A;  5BUR A;  3IML A;  2P2B A;  2PT7 G;  4I9F A;  3C5E A;  4JI7 C;  2QW0 X;  1V25 A;  1WF3 A;  1N2F A;  2P2Q A;  2DYJ A;  4DG9 A;  3N2Q A;  5BSR A;  4X64 C;  4JYA C;  1XMQ C;  2OPL B;  3R44 A;  3GKU A;  5BST A;  1BA3 A;  3DAY A;  2JMP A;  1HNZ C;  2UU9 C;  2KZF A;  3S82 A;  4MH4 A;  4DV5 C;  3ETC A;  4X66 C;  5AE1 A;  4PRO C;  3LAX A;  5JRH A;  2VQE C;  3RG2 A;  2QVX X;  4LFB C;  1MXC A;  1L2F A;  4BCA A;  2CY1 A;  5A1I A;  2UUB C;  5KYT A;  4FTF A;  1N32 C;  2E0G A;  1RG9 A;  5LMU C;  3IEU A;  4JI4 C;  5AE3 A;  5CZV A;  3ETO A;  5T8S A;  4JI8 C;  2AYA A;  4DUY C;  5IFI A;  4JI0 C;  1K0R A;  3VNQ A;  3PES A;  3FCE A;  4XX2 A;  3TDE A;  1O92 A;  2D27 A;  1MDF A;  4ZLP A;  2Y4O A;  3NI2 A;  4LFC C;  2BJO A;  2UXB C;  4LFA C;  4GKK C;  4YHH C;  1XMO C;  3A9U A;  2QVZ X;  5K8F A;  2Y4N A;  5CZX A;  3AF5 A;  4GXQ A;  1USP B;  4X62 C;  4B3M C;  4PHT A;  3DLP X;  4MTN A;  2D1T A;  1ZB8 A;  4DV0 C;  1LCI A;  4DR3 C;  1MXA A;  2ONF A;  4KTT A;  4I9G A;  2XR1 A;  3VNR A;  3TQI A;  5LMN C;  4FUT A;  4RLF A;  1N34 C;  2CXC A;  3N54 B;  5BUS A;  4WS9 A;  2P2M A;  1KKG A;  4KHP C;  5DV9 A;  2VSQ A;  2QVY X;  1MD9 A;  3R9W A;  1N33 C;  5BSW A;  3L8C A;  2QL8 A;  1IBK C;  4DR5 C;  3UOW A;  2P2F A;  5GTD A;  1PG4 A;  4YY3 C;  4NOZ A;  4DV1 C;  5IT9 D;  4LF8 C;  5BSU A;  4D4I A;  4RLQ A;  4DG8 A;  4EAT A;  2UXC C;  4DR1 C;  4DCV A;  3CJE A;  1USP A;  1MDB A;  4BC7 A;  1O90 A;  1QWI A;  4ODJ A;  1V26 A;  2ATW A;  3AF6 A;  4NXN C;  1JOS A;  1O93 A;  1FUG A;  2D1R A;  4D4G A;  4RM3 A;  1UKK A;  1XRC A;  1VLA A;  4DV2 C;  3IEV A;  2E7G A;  5ADZ A;  1YJ7 A;  2P02 A;  1LQL A;  4DR6 C;  4OYC A;  1MKY A;  4DCU A;  4G37 A;  3CW8 X;  5A19 A;  2UUC C;  5KYV A;  4K0B A;  3LUS A;  1HR0 C;  4DCS A;  4K0K C;  2HHH C;  2E8F A;  1ULT A;  1IBM C;  4DCT A;  3A4I A;  5IWA C;  5BUQ A;  1I94 C;  3LGX A;  4JM1 A;  4DV6 C;  4LF4 C;  3EQ6 A;  5AE2 A;  4JI6 C;  4DR2 C;  1T5H X;  4RMN A;  1XRA A;  4JI3 C;  1RY2 A;  3FCC A;  3J81 D;  1P7L A;  5KEI A;  2OPL A;  4IR7 A;  3VNS A;  2D7V A;  3IPL A;  1HH2 P;  4G1I A;  3T1H C;  4R1M A;  5A2Q D;  4RM2 A;  3PBK A;  3GR0 A;  2D1Q A;  3DHV A;  3EER A;  2HJG A;  2UXD C;  5BR8 C;  4KTV A;  4JI5 C;  1QM4 A;  1HNW C;  2DPL A;  5BSM A;  1XNQ C;  1EGA A;  4B3T C;  4R1L A;  3PRO C;  4G36 A;  4JI1 C;  2EGT A;  2F4V C;  4NDN A;  3NYQ A;  4IZ6 A;  3JAM D;  3LNV A;  1ZB9 A;  3KXW A;  4GKJ C;  2OBV A;  3UZ0 A;  3T1Y C;  1HNX C;  4PZP A;  4RVO A;  4B3R C;  2D28 C;  2E8E A;  4GXR A;  1WH9 A;  4D56 A;  4DR7 C;  2OO4 A;  1AMU A;  4DR4 C;  4LF5 C;  1FJG C;  5K85 A;  4ZJZ A;  4DUZ C;  3CW9 A;  4LF7 C;  4RVN A;  4HPV A;  1PG3 A;  4DV3 C;  2PRO A;  2D1S A;  2YWB A;  1NYE A;  3R9X A;  2UUA C;  3TUF A;  2P20 A;  2VQF C;  4OXI A;  1GPM A;  4LF6 C;  1ML8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...