4B3MC

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4b3mC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4b3mC02
2CY1A 3R9XA 4NXNC 2UXCC 2UXDC 2UU9C 5BR8C 4DR3C 1IBKC 1KKGA 3J7AD 2UUAC 4DV6C 4JI0C 4DV1C 2E8CA 4DV3C 4JI8C 2HHHC 4LFBC 1ML8A 2EGTA 1XMQC 4LF8C 4DV2C 4YHHC 2HJGA 5FLXD 3J81D 4DCTA 4JI3C 3EERA 4B3SC 4GKKC 1FJGC 4YY3C 4B3RC 1IBMC 2UUBC 4K0KC 2CXCA 5IT9D 3JAMD 1IBLC 4DR5C 4GKJC 3LUSA 4KHPC 3R9WA 4AQYC 2ASBA 1N34C 2UXBC 1ZB9A 4DUZC 4DUYC 1HNXC 1HR0C 2E7GA 4NXMC 4DCVA 4DR6C 4LF7C 4DR7C 1N2FA 1QWIA 4JV5C 3T1YC 4LF4C 4DCUA 4XX2A 3AF5A 3IEVA 1HH2P 1WH9A 2DYJA 4LF9C 1XNQC 4DR2C 2JMPA 2E8FA 1EGAA 2VQEC 4B3TC 2UUCC 2PT7G 1K0RA 1HNZC 4DR1C 4LF5C 1MKYA 4LFCC 4NOZA 1VLAA 2F4VC 2BJOA 4JI4C 1PA4A 3CJEA 4JI7C 1UKKA 3T1HC 2KZFA 2ONFA 2OPLA 4X64C 4LFAC 3OTOC 5LMUC 1WF3A 4DR4C 4BSZA 1NYEA 5IWAC 2ZM6C 4X62C 1N33C 4JI2C 1N32C 3J80D 1XMOC 5LMNC 2E5LC 4MTNA 1USPB 1ZB8A 4LF6C 2YCBA 4DCSA 1J5EC 3IEUA 4JI1C 4JI6C 4MH4A 2OPLB 4DV7C 2ATWA 4JYAC 4OX9C 1HNWC 1LQLA 4DV0C 2D7VA 1JOSA 4X66C 3GKUA 4DV4C 2E8EA 4B3MC 1I94C 5A2QD 1N36C 1USPA 2QL8A 1L2FA 3AF6A 4JI5C 4X65C 2VQFC 3I07A 4DV5C 2PN2A 2XR1A 1XNRC
chains in the Genus database with same CATH superfamily
2YX1A 3R9XA 1YGTA 1NY8A 3UOWA 3FM7A 4ISBA 2UUAC 2D27A 4DV1C 5CZVA 2OBVA 4LF8C 4YHHC 2HJGA 5BSRA 4JI3C 2DHMA 1FJGC 4GKKC 4YY3C 2QW0X 4RVNA 4KTVA 4G37A 5IT9D 4ZJZA 1IBLC 4GKJC 1VEHA 3LGXA 1N34C 3SO4A 4JV5C 2CU6A 3AF5A 3IEVA 2YWBA 3UX2A 2DYJA 2JMPA 4PZPA 3I08A 4GXQA 2UUCC 2PG1E 2QVXX 4RLQA 3TR3A 1MKYA 1VLAA 3ETCA 4JI4C 3CJEA 1UKKA 4LFAC 5BUQA 5LMUC 3AY0A 4BSZA 1MDBA 3DHVA 4HPVA 1BA3A 2M5OA 2E5LC 4FUQA 5H9UA 2YCBA 3PBKA 3H2TA 1J5EC 3GR0A 3A4IA 3VNSA 4JI6C 4MH4A 3RV2A 2D7VA 1JOSA 5KYTA 1M6XC 2E8EA 3PROC 5A2QD 2QL8A 4JI5C 4BBYA 4ODJA 5AE2A 2KZ0A 3I07A 4DV5C 1PG4A 4BC7A 1P4EC 4I9GA 3VNQA 4IR7A 2UXDC 4NDNA 2UU9C 1XRCA 1XHJA 2P2JA 3L95X 4JI0C 2E8CA 4DV3C 4WV3A 1ML8A 3UX3A 5FLXD 1V25A 4DCTA 4G1IA 3EERA 3G7SA 4PUIA 3FCCA 1IBMC 4K0KC 4D4GA 3JAMD 4PUHA 4DR5C 4K0BA 1MXCA 2UXBC 1PU1A 1ZB9A 4JM1A 5BURA 5CZXA 4DCVA 3L8CA 4RVOA 1QWIA 3LNVA 3T1YC 2QVYX 4LF4C 4DCUA 2Y4NA 1WCJA 1WH9A 4LF9C 4DR2C 4GS5A 4R1LA 1EGAA 4B3TC 2PT7G 1K0RA 4L7IA 4DR1C 4BCAA 5A1IA 4LFCC 4NOZA 2D1RA 1T5DX 2KZFA 4D56A 4WS9A 2OPLA 5BSWA 1QM4A 4R0MA 3IMLA 4RM3A 4G36A 3CW8X 4DR4C 1NYEA 5LCIA 4FTFA 5IWAC 4OYCA 4D57A 3S82A 1FLOA 1XS3A 2D28C 2PROA 4MTNA 1FUGA 4DCSA 3IEUA 5T8SA 1XDXA 3TUFA 2P20A 4JYAC 4OX9C 1HNWC 4DG9A 2QVZX 3NYQA 2MCQA 4X66C 4DV4C 4B3MC 3CQ1A 1USPA 2D1QA 3AF6A 2BH1X 4X65C 5BSTA 2VQFC 3UZ0A 2PN2A 2CY1A 3CQ2A 4NXNC 3K6RA 4D4IA 5BR8C 5BSVA 4DR3C 1KKGA 1XRAA 1IB8A 1M6XA 4DV6C 3UEBA 3A26A 5GTDA 4KTTA 4L2ZA 2EGTA 3ETOA 4DV2C 3J81D 4U5YD 2ZZMA 2ZTBA 3EQ6A 4B3SC 4B3RC 3KXWA 4PHTA 2KDNA 3O2EA 5JRHA 3NI2A 3LUSA 4KHPC 3R9WA 2AYAA 2ASBA 5AE3A 4DUZC 3N2QA 2E7GA 4NXMC 4DR6C 1N2FA 5ADZA 1MXAA 5K85A 4XX2A 5KEIA 1HH2P 3VNRA 3PESA 1XNQC 3B7WA 2E8FA 5A19A 2P2MA 2VQEC 3R44A 3CW9A 3DLPX 3NYRA 1RG9A 1V26A 1PG3A 4TPSB 3GPCA 3LNOA 4I9FA 2JNVA 1PA4A 4JI7C 3T1HC 2ONFA 2D1TA 1TH5A 4RMNA 2MMAB 4X64C 2E0GA 4IZ6A 3E7WA 1WF3A 2Z51A 3GR1A 2VSQA 3RG2A 2ZM6C 4X62C 1N32C 4JI2C 3CQ3A 5LMNC 4EATA 5A1GA 1USPB 1ZB8A 4LF6C 5BSUA 2P02A 4RLFA 4DV7C 1ULTA 2WP0C 1UWDA 4FUTA 1L2FA 2P2QA 2ZZNA 1T5HX 1V60A 2XR1A 1RY2A 1XNRC 1MD9A 2UXCC 4DG8A 1IBKC 3J7AD 1GPMA 2D1SA 5K8FA 2OO4A 1O92A 4JI8C 2HHHC 1O90A 4LFBC 1XMQC 2Y27A 5E7QA 4ZLPA 3E7XA 2UUBC 2CXCA 1YJ7A 5AE1A 4AQYC 4BC9A 2Y4OA 4DUYC 1HNXC 2V7BA 1HR0C 4DR7C 4LF7C 3FCEA 2MM9A 2NCLA 5BSMA 5BUSA 1P4EA 4RM2A 4L4QA 1AMUA 3LAXA 3IPLA 4OXIA 3A25A 1HNZC 5IFIA 4LF5C 3A9VA 2F4VC 2BJOA 1MXBA 1XRBA 2WD9A 3NPDA 5DV9A 3OTOC 4LE5A 2P2FA 1LCIA 5T8TA 1N33C 3J80D 1XMOC 1O9TA 2P2BA 2DPLA 3DAYA 4R1MA 3TDEA 3C5EA 4JI1C 4PROC 1O93A 2OPLB 2ATWA 3N54B 5KYVA 1LQLA 4DV0C 3TQIA 2VZEA 1MDFA 3GKUA 3A9UA 4GXRA 1I94C 1N36C 1P7LA 2YWCA 2M5HA 4PUGA
chains in the Genus database with same CATH topology
3R9XA 3UOWA 4ISBA 2UUAC 2D27A 4DV1C 5CZVA 2OBVA 4LF8C 4YHHC 2HJGA 5BSRA 4JI3C 1FJGC 4GKKC 4YY3C 2QW0X 4RVNA 4KTVA 4G37A 5IT9D 4ZJZA 1IBLC 4GKJC 3LGXA 1N34C 3SO4A 4JV5C 3AF5A 3IEVA 2YWBA 2DYJA 2JMPA 4PZPA 3I08A 4GXQA 2UUCC 2QVXX 4RLQA 1MKYA 1VLAA 3ETCA 4JI4C 3CJEA 1UKKA 4LFAC 5BUQA 5LMUC 4BSZA 1MDBA 3DHVA 4HPVA 1BA3A 2E5LC 4FUQA 5H9UA 2YCBA 3PBKA 3H2TA 1J5EC 3GR0A 3A4IA 3VNSA 4JI6C 4MH4A 3RV2A 2D7VA 1JOSA 5KYTA 2E8EA 3PROC 5A2QD 2QL8A 4JI5C 4BBYA 4ODJA 5AE2A 3I07A 4DV5C 1PG4A 4BC7A 4I9GA 3VNQA 4IR7A 2UXDC 4NDNA 2UU9C 1XRCA 2P2JA 3L95X 4JI0C 2E8CA 4DV3C 4WV3A 1ML8A 5FLXD 1V25A 4DCTA 4G1IA 3EERA 3G7SA 3FCCA 1IBMC 4K0KC 4D4GA 3JAMD 4DR5C 4K0BA 1MXCA 2UXBC 1ZB9A 4JM1A 5BURA 5CZXA 4DCVA 3L8CA 4RVOA 1QWIA 3LNVA 3T1YC 2QVYX 4LF4C 4DCUA 2Y4NA 1WH9A 4LF9C 4DR2C 4GS5A 4R1LA 1EGAA 4B3TC 2PT7G 1K0RA 4L7IA 4DR1C 4BCAA 5A1IA 4LFCC 4NOZA 2D1RA 1T5DX 2KZFA 4D56A 4WS9A 2OPLA 5BSWA 1QM4A 4R0MA 3IMLA 4RM3A 4G36A 3CW8X 4DR4C 1NYEA 4FTFA 5IWAC 4OYCA 4D57A 3S82A 2D28C 2PROA 4MTNA 1FUGA 4DCSA 3IEUA 5T8SA 3TUFA 2P20A 4JYAC 4OX9C 1HNWC 4DG9A 2QVZX 3NYQA 4X66C 4DV4C 4B3MC 1USPA 2D1QA 3AF6A 2BH1X 4X65C 5BSTA 2VQFC 3UZ0A 2PN2A 2CY1A 4NXNC 4D4IA 5BR8C 5BSVA 4DR3C 1KKGA 1XRAA 4DV6C 5GTDA 4KTTA 4L2ZA 2EGTA 3ETOA 4DV2C 3J81D 4U5YD 3EQ6A 4B3SC 4B3RC 3KXWA 4PHTA 5JRHA 3NI2A 3LUSA 4KHPC 3R9WA 2AYAA 2ASBA 5AE3A 4DUZC 3N2QA 2E7GA 4NXMC 4DR6C 1N2FA 5ADZA 1MXAA 5K85A 4XX2A 5KEIA 1HH2P 3VNRA 3PESA 1XNQC 3B7WA 2E8FA 5A19A 2P2MA 2VQEC 3R44A 3CW9A 3DLPX 3NYRA 1RG9A 1V26A 1PG3A 4TPSB 3GPCA 4I9FA 1PA4A 4JI7C 3T1HC 2ONFA 2D1TA 4RMNA 4X64C 2E0GA 4IZ6A 3E7WA 1WF3A 3GR1A 2VSQA 3RG2A 2ZM6C 4X62C 1N32C 4JI2C 5LMNC 4EATA 5A1GA 1USPB 1ZB8A 4LF6C 5BSUA 2P02A 4RLFA 4DV7C 1ULTA 2WP0C 4FUTA 1L2FA 2P2QA 1T5HX 2XR1A 1RY2A 1XNRC 1MD9A 2UXCC 4DG8A 1IBKC 3J7AD 1GPMA 2D1SA 5K8FA 2OO4A 1O92A 4JI8C 2HHHC 1O90A 4LFBC 1XMQC 2Y27A 5E7QA 4ZLPA 3E7XA 2UUBC 2CXCA 1YJ7A 5AE1A 4AQYC 4BC9A 2Y4OA 4DUYC 1HNXC 2V7BA 1HR0C 4DR7C 4LF7C 3FCEA 5BSMA 5BUSA 4RM2A 4L4QA 1AMUA 3LAXA 3IPLA 4OXIA 1HNZC 5IFIA 4LF5C 3A9VA 2F4VC 2BJOA 1MXBA 1XRBA 2WD9A 3NPDA 5DV9A 3OTOC 4LE5A 2P2FA 1LCIA 5T8TA 1N33C 3J80D 1XMOC 1O9TA 2P2BA 2DPLA 3DAYA 4R1MA 3TDEA 3C5EA 4JI1C 4PROC 1O93A 2OPLB 2ATWA 3N54B 5KYVA 1LQLA 4DV0C 3TQIA 2VZEA 1MDFA 3GKUA 3A9UA 4GXRA 1I94C 1N36C 1P7LA 2YWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CY1 A;  3R9X A;  4NXN C;  2UXC C;  2UXD C;  2UU9 C;  5BR8 C;  4DR3 C;  1IBK C;  1KKG A;  3J7A D;  2UUA C;  4DV6 C;  4JI0 C;  4DV1 C;  2E8C A;  4DV3 C;  4JI8 C;  2HHH C;  4LFB C;  1ML8 A;  2EGT A;  1XMQ C;  4LF8 C;  4DV2 C;  4YHH C;  2HJG A;  5FLX D;  3J81 D;  4DCT A;  4JI3 C;  3EER A;  4B3S C;  4GKK C;  1FJG C;  4YY3 C;  4B3R C;  1IBM C;  2UUB C;  4K0K C;  2CXC A;  5IT9 D;  3JAM D;  1IBL C;  4DR5 C;  4GKJ C;  3LUS A;  4KHP C;  3R9W A;  4AQY C;  2ASB A;  1N34 C;  2UXB C;  1ZB9 A;  4DUZ C;  4DUY C;  1HNX C;  1HR0 C;  2E7G A;  4NXM C;  4DCV A;  4DR6 C;  4LF7 C;  4DR7 C;  1N2F A;  1QWI A;  4JV5 C;  3T1Y C;  4LF4 C;  4DCU A;  4XX2 A;  3AF5 A;  3IEV A;  1HH2 P;  1WH9 A;  2DYJ A;  4LF9 C;  1XNQ C;  4DR2 C;  2JMP A;  2E8F A;  1EGA A;  2VQE C;  4B3T C;  2UUC C;  2PT7 G;  1K0R A;  1HNZ C;  4DR1 C;  4LF5 C;  1MKY A;  4LFC C;  4NOZ A;  1VLA A;  2F4V C;  2BJO A;  4JI4 C;  1PA4 A;  3CJE A;  4JI7 C;  1UKK A;  3T1H C;  2KZF A;  2ONF A;  2OPL A;  4X64 C;  4LFA C;  3OTO C;  5LMU C;  1WF3 A;  4DR4 C;  4BSZ A;  1NYE A;  5IWA C;  2ZM6 C;  4X62 C;  1N33 C;  4JI2 C;  1N32 C;  3J80 D;  1XMO C;  5LMN C;  2E5L C;  4MTN A;  1USP B;  1ZB8 A;  4LF6 C;  2YCB A;  4DCS A;  1J5E C;  3IEU A;  4JI1 C;  4JI6 C;  4MH4 A;  2OPL B;  4DV7 C;  2ATW A;  4JYA C;  4OX9 C;  1HNW C;  1LQL A;  4DV0 C;  2D7V A;  1JOS A;  4X66 C;  3GKU A;  4DV4 C;  2E8E A;  4B3M C;  1I94 C;  5A2Q D;  1N36 C;  1USP A;  2QL8 A;  1L2F A;  3AF6 A;  4JI5 C;  4X65 C;  2VQF C;  3I07 A;  4DV5 C;  2PN2 A;  2XR1 A;  1XNR C; 
#chains in the Genus database with same CATH topology
 2YX1 A;  3R9X A;  1YGT A;  1NY8 A;  3UOW A;  3FM7 A;  4ISB A;  2UUA C;  2D27 A;  4DV1 C;  5CZV A;  2OBV A;  4LF8 C;  4YHH C;  2HJG A;  5BSR A;  4JI3 C;  2DHM A;  1FJG C;  4GKK C;  4YY3 C;  2QW0 X;  4RVN A;  4KTV A;  4G37 A;  5IT9 D;  4ZJZ A;  1IBL C;  4GKJ C;  1VEH A;  3LGX A;  1N34 C;  3SO4 A;  4JV5 C;  2CU6 A;  3AF5 A;  3IEV A;  2YWB A;  3UX2 A;  2DYJ A;  2JMP A;  4PZP A;  3I08 A;  4GXQ A;  2UUC C;  2PG1 E;  2QVX X;  4RLQ A;  3TR3 A;  1MKY A;  1VLA A;  3ETC A;  4JI4 C;  3CJE A;  1UKK A;  4LFA C;  5BUQ A;  5LMU C;  3AY0 A;  4BSZ A;  1MDB A;  3DHV A;  4HPV A;  1BA3 A;  2M5O A;  2E5L C;  4FUQ A;  5H9U A;  2YCB A;  3PBK A;  3H2T A;  1J5E C;  3GR0 A;  3A4I A;  3VNS A;  4JI6 C;  4MH4 A;  3RV2 A;  2D7V A;  1JOS A;  5KYT A;  1M6X C;  2E8E A;  3PRO C;  5A2Q D;  2QL8 A;  4JI5 C;  4BBY A;  4ODJ A;  5AE2 A;  2KZ0 A;  3I07 A;  4DV5 C;  1PG4 A;  4BC7 A;  1P4E C;  4I9G A;  3VNQ A;  4IR7 A;  2UXD C;  4NDN A;  2UU9 C;  1XRC A;  1XHJ A;  2P2J A;  3L95 X;  4JI0 C;  2E8C A;  4DV3 C;  4WV3 A;  1ML8 A;  3UX3 A;  5FLX D;  1V25 A;  4DCT A;  4G1I A;  3EER A;  3G7S A;  4PUI A;  3FCC A;  1IBM C;  4K0K C;  4D4G A;  3JAM D;  4PUH A;  4DR5 C;  4K0B A;  1MXC A;  2UXB C;  1PU1 A;  1ZB9 A;  4JM1 A;  5BUR A;  5CZX A;  4DCV A;  3L8C A;  4RVO A;  1QWI A;  3LNV A;  3T1Y C;  2QVY X;  4LF4 C;  4DCU A;  2Y4N A;  1WCJ A;  1WH9 A;  4LF9 C;  4DR2 C;  4GS5 A;  4R1L A;  1EGA A;  4B3T C;  2PT7 G;  1K0R A;  4L7I A;  4DR1 C;  4BCA A;  5A1I A;  4LFC C;  4NOZ A;  2D1R A;  1T5D X;  2KZF A;  4D56 A;  4WS9 A;  2OPL A;  5BSW A;  1QM4 A;  4R0M A;  3IML A;  4RM3 A;  4G36 A;  3CW8 X;  4DR4 C;  1NYE A;  5LCI A;  4FTF A;  5IWA C;  4OYC A;  4D57 A;  3S82 A;  1FLO A;  1XS3 A;  2D28 C;  2PRO A;  4MTN A;  1FUG A;  4DCS A;  3IEU A;  5T8S A;  1XDX A;  3TUF A;  2P20 A;  4JYA C;  4OX9 C;  1HNW C;  4DG9 A;  2QVZ X;  3NYQ A;  2MCQ A;  4X66 C;  4DV4 C;  4B3M C;  3CQ1 A;  1USP A;  2D1Q A;  3AF6 A;  2BH1 X;  4X65 C;  5BST A;  2VQF C;  3UZ0 A;  2PN2 A;  2CY1 A;  3CQ2 A;  4NXN C;  3K6R A;  4D4I A;  5BR8 C;  5BSV A;  4DR3 C;  1KKG A;  1XRA A;  1IB8 A;  1M6X A;  4DV6 C;  3UEB A;  3A26 A;  5GTD A;  4KTT A;  4L2Z A;  2EGT A;  3ETO A;  4DV2 C;  3J81 D;  4U5Y D;  2ZZM A;  2ZTB A;  3EQ6 A;  4B3S C;  4B3R C;  3KXW A;  4PHT A;  2KDN A;  3O2E A;  5JRH A;  3NI2 A;  3LUS A;  4KHP C;  3R9W A;  2AYA A;  2ASB A;  5AE3 A;  4DUZ C;  3N2Q A;  2E7G A;  4NXM C;  4DR6 C;  1N2F A;  5ADZ A;  1MXA A;  5K85 A;  4XX2 A;  5KEI A;  1HH2 P;  3VNR A;  3PES A;  1XNQ C;  3B7W A;  2E8F A;  5A19 A;  2P2M A;  2VQE C;  3R44 A;  3CW9 A;  3DLP X;  3NYR A;  1RG9 A;  1V26 A;  1PG3 A;  4TPS B;  3GPC A;  3LNO A;  4I9F A;  2JNV A;  1PA4 A;  4JI7 C;  3T1H C;  2ONF A;  2D1T A;  1TH5 A;  4RMN A;  2MMA B;  4X64 C;  2E0G A;  4IZ6 A;  3E7W A;  1WF3 A;  2Z51 A;  3GR1 A;  2VSQ A;  3RG2 A;  2ZM6 C;  4X62 C;  1N32 C;  4JI2 C;  3CQ3 A;  5LMN C;  4EAT A;  5A1G A;  1USP B;  1ZB8 A;  4LF6 C;  5BSU A;  2P02 A;  4RLF A;  4DV7 C;  1ULT A;  2WP0 C;  1UWD A;  4FUT A;  1L2F A;  2P2Q A;  2ZZN A;  1T5H X;  1V60 A;  2XR1 A;  1RY2 A;  1XNR C;  1MD9 A;  2UXC C;  4DG8 A;  1IBK C;  3J7A D;  1GPM A;  2D1S A;  5K8F A;  2OO4 A;  1O92 A;  4JI8 C;  2HHH C;  1O90 A;  4LFB C;  1XMQ C;  2Y27 A;  5E7Q A;  4ZLP A;  3E7X A;  2UUB C;  2CXC A;  1YJ7 A;  5AE1 A;  4AQY C;  4BC9 A;  2Y4O A;  4DUY C;  1HNX C;  2V7B A;  1HR0 C;  4DR7 C;  4LF7 C;  3FCE A;  2MM9 A;  2NCL A;  5BSM A;  5BUS A;  1P4E A;  4RM2 A;  4L4Q A;  1AMU A;  3LAX A;  3IPL A;  4OXI A;  3A25 A;  1HNZ C;  5IFI A;  4LF5 C;  3A9V A;  2F4V C;  2BJO A;  1MXB A;  1XRB A;  2WD9 A;  3NPD A;  5DV9 A;  3OTO C;  4LE5 A;  2P2F A;  1LCI A;  5T8T A;  1N33 C;  3J80 D;  1XMO C;  1O9T A;  2P2B A;  2DPL A;  3DAY A;  4R1M A;  3TDE A;  3C5E A;  4JI1 C;  4PRO C;  1O93 A;  2OPL B;  2ATW A;  3N54 B;  5KYV A;  1LQL A;  4DV0 C;  3TQI A;  2VZE A;  1MDF A;  3GKU A;  3A9U A;  4GXR A;  1I94 C;  1N36 C;  1P7L A;  2YWC A;  2M5H A;  4PUG A; 
#chains in the Genus database with same CATH homology
 3R9X A;  3UOW A;  4ISB A;  2UUA C;  2D27 A;  4DV1 C;  5CZV A;  2OBV A;  4LF8 C;  4YHH C;  2HJG A;  5BSR A;  4JI3 C;  1FJG C;  4GKK C;  4YY3 C;  2QW0 X;  4RVN A;  4KTV A;  4G37 A;  5IT9 D;  4ZJZ A;  1IBL C;  4GKJ C;  3LGX A;  1N34 C;  3SO4 A;  4JV5 C;  3AF5 A;  3IEV A;  2YWB A;  2DYJ A;  2JMP A;  4PZP A;  3I08 A;  4GXQ A;  2UUC C;  2QVX X;  4RLQ A;  1MKY A;  1VLA A;  3ETC A;  4JI4 C;  3CJE A;  1UKK A;  4LFA C;  5BUQ A;  5LMU C;  4BSZ A;  1MDB A;  3DHV A;  4HPV A;  1BA3 A;  2E5L C;  4FUQ A;  5H9U A;  2YCB A;  3PBK A;  3H2T A;  1J5E C;  3GR0 A;  3A4I A;  3VNS A;  4JI6 C;  4MH4 A;  3RV2 A;  2D7V A;  1JOS A;  5KYT A;  2E8E A;  3PRO C;  5A2Q D;  2QL8 A;  4JI5 C;  4BBY A;  4ODJ A;  5AE2 A;  3I07 A;  4DV5 C;  1PG4 A;  4BC7 A;  4I9G A;  3VNQ A;  4IR7 A;  2UXD C;  4NDN A;  2UU9 C;  1XRC A;  2P2J A;  3L95 X;  4JI0 C;  2E8C A;  4DV3 C;  4WV3 A;  1ML8 A;  5FLX D;  1V25 A;  4DCT A;  4G1I A;  3EER A;  3G7S A;  3FCC A;  1IBM C;  4K0K C;  4D4G A;  3JAM D;  4DR5 C;  4K0B A;  1MXC A;  2UXB C;  1ZB9 A;  4JM1 A;  5BUR A;  5CZX A;  4DCV A;  3L8C A;  4RVO A;  1QWI A;  3LNV A;  3T1Y C;  2QVY X;  4LF4 C;  4DCU A;  2Y4N A;  1WH9 A;  4LF9 C;  4DR2 C;  4GS5 A;  4R1L A;  1EGA A;  4B3T C;  2PT7 G;  1K0R A;  4L7I A;  4DR1 C;  4BCA A;  5A1I A;  4LFC C;  4NOZ A;  2D1R A;  1T5D X;  2KZF A;  4D56 A;  4WS9 A;  2OPL A;  5BSW A;  1QM4 A;  4R0M A;  3IML A;  4RM3 A;  4G36 A;  3CW8 X;  4DR4 C;  1NYE A;  4FTF A;  5IWA C;  4OYC A;  4D57 A;  3S82 A;  2D28 C;  2PRO A;  4MTN A;  1FUG A;  4DCS A;  3IEU A;  5T8S A;  3TUF A;  2P20 A;  4JYA C;  4OX9 C;  1HNW C;  4DG9 A;  2QVZ X;  3NYQ A;  4X66 C;  4DV4 C;  4B3M C;  1USP A;  2D1Q A;  3AF6 A;  2BH1 X;  4X65 C;  5BST A;  2VQF C;  3UZ0 A;  2PN2 A;  2CY1 A;  4NXN C;  4D4I A;  5BR8 C;  5BSV A;  4DR3 C;  1KKG A;  1XRA A;  4DV6 C;  5GTD A;  4KTT A;  4L2Z A;  2EGT A;  3ETO A;  4DV2 C;  3J81 D;  4U5Y D;  3EQ6 A;  4B3S C;  4B3R C;  3KXW A;  4PHT A;  5JRH A;  3NI2 A;  3LUS A;  4KHP C;  3R9W A;  2AYA A;  2ASB A;  5AE3 A;  4DUZ C;  3N2Q A;  2E7G A;  4NXM C;  4DR6 C;  1N2F A;  5ADZ A;  1MXA A;  5K85 A;  4XX2 A;  5KEI A;  1HH2 P;  3VNR A;  3PES A;  1XNQ C;  3B7W A;  2E8F A;  5A19 A;  2P2M A;  2VQE C;  3R44 A;  3CW9 A;  3DLP X;  3NYR A;  1RG9 A;  1V26 A;  1PG3 A;  4TPS B;  3GPC A;  4I9F A;  1PA4 A;  4JI7 C;  3T1H C;  2ONF A;  2D1T A;  4RMN A;  4X64 C;  2E0G A;  4IZ6 A;  3E7W A;  1WF3 A;  3GR1 A;  2VSQ A;  3RG2 A;  2ZM6 C;  4X62 C;  1N32 C;  4JI2 C;  5LMN C;  4EAT A;  5A1G A;  1USP B;  1ZB8 A;  4LF6 C;  5BSU A;  2P02 A;  4RLF A;  4DV7 C;  1ULT A;  2WP0 C;  4FUT A;  1L2F A;  2P2Q A;  1T5H X;  2XR1 A;  1RY2 A;  1XNR C;  1MD9 A;  2UXC C;  4DG8 A;  1IBK C;  3J7A D;  1GPM A;  2D1S A;  5K8F A;  2OO4 A;  1O92 A;  4JI8 C;  2HHH C;  1O90 A;  4LFB C;  1XMQ C;  2Y27 A;  5E7Q A;  4ZLP A;  3E7X A;  2UUB C;  2CXC A;  1YJ7 A;  5AE1 A;  4AQY C;  4BC9 A;  2Y4O A;  4DUY C;  1HNX C;  2V7B A;  1HR0 C;  4DR7 C;  4LF7 C;  3FCE A;  5BSM A;  5BUS A;  4RM2 A;  4L4Q A;  1AMU A;  3LAX A;  3IPL A;  4OXI A;  1HNZ C;  5IFI A;  4LF5 C;  3A9V A;  2F4V C;  2BJO A;  1MXB A;  1XRB A;  2WD9 A;  3NPD A;  5DV9 A;  3OTO C;  4LE5 A;  2P2F A;  1LCI A;  5T8T A;  1N33 C;  3J80 D;  1XMO C;  1O9T A;  2P2B A;  2DPL A;  3DAY A;  4R1M A;  3TDE A;  3C5E A;  4JI1 C;  4PRO C;  1O93 A;  2OPL B;  2ATW A;  3N54 B;  5KYV A;  1LQL A;  4DV0 C;  3TQI A;  2VZE A;  1MDF A;  3GKU A;  3A9U A;  4GXR A;  1I94 C;  1N36 C;  1P7L A;  2YWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...