4B3MC

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4b3mC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4b3mC02
4LF4C 2ONFA 4XX2A 4B3SC 4JV5C 5A2QD 4JI0C 1XNRC 3OTOC 1FJGC 1XMQC 2E8CA 4MTNA 2UUAC 3JAMD 4NXNC 5LMNC 4X65C 2KZFA 1N34C 4DR2C 4NXMC 4DV0C 4DCSA 2E5LC 2UUCC 4LF6C 1WF3A 4YY3C 2UXBC 1MKYA 2UUBC 2VQEC 3AF6A 2UXCC 1IBKC 4DUYC 1NYEA 4DCTA 1N32C 1N2FA 5LMUC 4JI6C 3I07A 1USPB 1IBMC 2CY1A 1VLAA 1ZB9A 4OX9C 4DV3C 1N33C 4NOZA 4LFBC 4DR1C 2PT7G 1N36C 4JI7C 1J5EC 4X62C 4DR4C 2D7VA 4JI2C 1XMOC 4DV1C 2E7GA 1PA4A 1HNZC 3J80D 2ASBA 3R9XA 3T1HC 4DR6C 4B3RC 4DV5C 4DCUA 5BR8C 3GKUA 4LFAC 3EERA 4YHHC 1WH9A 2ATWA 1USPA 1LQLA 3LUSA 3CJEA 2CXCA 4JI5C 4JI8C 1L2FA 1ML8A 2ZM6C 1UKKA 4JI3C 2QL8A 4X64C 2OPLB 3IEUA 2BJOA 2DYJA 4GKKC 5FLXD 1HH2P 4DV6C 2UU9C 4GKJC 1KKGA 5IT9D 4X66C 4KHPC 1HNXC 3J81D 4BSZA 2UXDC 4B3MC 1HR0C 4DR3C 1XNQC 2E8EA 1IBLC 2XR1A 2JMPA 4DV2C 2OPLA 2HHHC 4LF7C 3IEVA 1QWIA 4JYAC 5IWAC 2E8FA 4JI1C 2YCBA 4DCVA 4DR7C 1ZB8A 4MH4A 4DV4C 1I94C 4DUZC 4DV7C 4DR5C 2HJGA 2PN2A 4JI4C 3AF5A 3J7AD 1JOSA 1K0RA 4LF9C 3R9WA 4LF8C 2F4VC 1EGAA 4LF5C 2EGTA 4LFCC 4K0KC 4B3TC 3T1YC 1HNWC 4AQYC 2VQFC
chains in the Genus database with same CATH superfamily
4LF4C 2QVYX 3E7WA 4XX2A 4D56A 2WD9A 4U5YD 2V7BA 5LMNC 5E7QA 4DR2C 2P20A 2UUCC 1O9TA 4YY3C 1XRBA 2UUBC 4R1MA 2Y27A 2P2MA 4BC7A 4DCTA 5LMUC 3K6RA 3NI2A 1IBMC 1ZB9A 4DV3C 4LFBC 3DLPX 4RVNA 1P7LA 3DHVA 4JI2C 1XMOC 2E7GA 1PA4A 3T1HC 3GKUA 2ATWA 1LQLA 1USPA 1XDXA 2MCQA 4GXRA 5CZXA 1MDBA 1L2FA 3IMLA 3ETOA 2QVZX 4RVOA 3FCEA 1P4EA 1KKGA 4X66C 3NYQA 1YJ7A 3J81D 4FUQA 2Y4NA 4WV3A 1IBLC 4DV2C 1FLOA 2WP0C 2OPLA 4L7IA 3A4IA 4DCVA 4DR7C 3LNVA 1O90A 2P2BA 3GPCA 2PN2A 3G7SA 3J7AD 2DHMA 1K0RA 2MM9A 4LF9C 2Z51A 2F4VC 3UEBA 1EGAA 4LF5C 4K0KC 3VNQA 3RG2A 1HNWC 3A9UA 3GR1A 3TQIA 4RLQA 2P2QA 4JV5C 2KDNA 4JI0C 1XNRC 2OO4A 1V60A 1XMQC 2E8CA 1NY8A 4MTNA 1FUGA 2QW0X 4NXNC 3CW9A 4X65C 2KZFA 4G1IA 4NXMC 5BUSA 4DV0C 5BSUA 3LAXA 5T8SA 1IBKC 4DUYC 1MD9A 1N32C 4FUTA 1USPB 5A1GA 1VLAA 4OX9C 4PHTA 4DR1C 2KZ0A 3NYRA 3IPLA 4JI7C 1J5EC 4DV1C 2VZEA 1HNZC 4D4IA 5BUQA 3J80D 2ASBA 4DR6C 4B3RC 4DV5C 4PUGA 4K0BA 3UZ0A 2D1QA 3LUSA 2CXCA 5IFIA 1MDFA 1PG4A 5GTDA 2QL8A 2OPLB 5A1IA 2BJOA 2AYAA 4GKKC 1VEHA 5ADZA 4HPVA 2P2FA 4D57A 2XR1A 3L8CA 5K8FA 2ZZNA 5KYVA 2HHHC 2P2JA 1O92A 4G36A 4PZPA 2PROA 5LCIA 5AE3A 2YX1A 1PU1A 3VNRA 4DV7C 2Y4OA 3ETCA 4G37A 4RM3A 4LF8C 3H2TA 4OXIA 3RV2A 2D28C 3CQ3A 4NDNA 1WCJA 1T5DX 3T1YC 1MXAA 4D4GA 3TUFA 2VQFC 3VNSA 4GXQA 1RG9A 4B3SC 4R0MA 5A2QD 3N54B 1FJGC 4ZLPA 2MMAB 2ZZMA 1QM4A 1M6XA 3A9VA 3UOWA 2D1RA 1O93A 1WF3A 1MKYA 3N2QA 3AF6A 2VQEC 3NPDA 5KYTA 3DAYA 3I08A 4RLFA 4FTFA 1ULTA 4JI6C 3I07A 2VSQA 2ZTBA 2CY1A 1N36C 2D1TA 4X62C 4DR4C 1PG3A 2D7VA 1YGTA 3R9XA 3PESA 4DCUA 5BR8C 3TR3A 3EERA 1XRAA 1AMUA 4YHHC 1WH9A 3R44A 3FM7A 4JI5C 3AY0A 1P4EC 1IB8A 1T5HX 2PG1E 5DV9A 1TH5A 4RMNA 5BSWA 1UKKA 4JI3C 4X64C 4OYCA 3IEUA 3SO4A 2M5OA 4PUIA 2YWCA 1HH2P 4BBYA 4DV6C 2UU9C 2NCLA 3A25A 3LNOA 4KTTA 4IZ6A 2P02A 4BSZA 2UXDC 2YWBA 4ZJZA 4B3MC 4DR3C 2E8EA 3S82A 4PUHA 2JMPA 2OBVA 1QWIA 5H9UA 4JI1C 5BSVA 1GPMA 1ZB8A 3CQ2A 1I94C 4DUZC 4TPSB 4DR5C 2HJGA 4JI4C 3AF5A 3L95X 1JOSA 4RM2A 1MXCA 3O2EA 3EQ6A 4LFCC 3TDEA 4AQYC 4BC9A 4IR7A 2ONFA 5AE2A 4I9GA 3OTOC 3UX3A 4R1LA 4EATA 2UUAC 3JAMD 5KEIA 1N34C 1V26A 5AE1A 1V25A 1XRCA 4DCSA 2E5LC 4L4QA 5JRHA 2BH1X 4LF6C 2UXBC 2D1SA 1BA3A 2UXCC 1RY2A 2JNVA 1NYEA 3PBKA 1N2FA 4LE5A 2QVXX 5BSMA 1N33C 4NOZA 5K85A 2PT7G 4ISBA 5CZVA 4GS5A 3A26A 3CW8X 4LFAC 1LCIA 3KXWA 5BSRA 3FCCA 3CJEA 3CQ1A 5BURA 4JI8C 3C5EA 1ML8A 4JM1A 2ZM6C 4KTVA 4BCAA 2DPLA 2DYJA 1MXBA 5FLXD 4GKJC 5A19A 5IT9D 4KHPC 1HNXC 4ODJA 1HR0C 1XNQC 4PROC 4I9FA 3GR0A 1XHJA 3PROC 4L2ZA 2CU6A 3B7WA 4LF7C 2D27A 3IEVA 3LGXA 4JYAC 5IWAC 2E8FA 2YCBA 5BSTA 2M5HA 4MH4A 4DV4C 2E0GA 1UWDA 5T8TA 4DG9A 3R9WA 3UX2A 2EGTA 4WS9A 4B3TC 1XS3A 3E7XA 1M6XC 4DG8A
chains in the Genus database with same CATH topology
4LF4C 2QVYX 3E7WA 4XX2A 4D56A 2WD9A 4U5YD 2V7BA 5LMNC 5E7QA 4DR2C 2P20A 2UUCC 1O9TA 4YY3C 1XRBA 2UUBC 4R1MA 2Y27A 2P2MA 4BC7A 4DCTA 5LMUC 3NI2A 1IBMC 1ZB9A 4DV3C 4LFBC 3DLPX 4RVNA 1P7LA 3DHVA 4JI2C 1XMOC 2E7GA 1PA4A 3T1HC 3GKUA 2ATWA 1LQLA 1USPA 4GXRA 5CZXA 1MDBA 1L2FA 3IMLA 3ETOA 2QVZX 4RVOA 3FCEA 1KKGA 4X66C 3NYQA 1YJ7A 3J81D 4FUQA 2Y4NA 4WV3A 1IBLC 4DV2C 2WP0C 2OPLA 4L7IA 3A4IA 4DCVA 4DR7C 3LNVA 1O90A 2P2BA 3GPCA 2PN2A 3G7SA 3J7AD 1K0RA 4LF9C 2F4VC 1EGAA 4LF5C 4K0KC 3VNQA 3RG2A 1HNWC 3A9UA 3GR1A 3TQIA 4RLQA 2P2QA 4JV5C 4JI0C 1XNRC 2OO4A 1XMQC 2E8CA 4MTNA 1FUGA 2QW0X 4NXNC 3CW9A 4X65C 2KZFA 4G1IA 4NXMC 5BUSA 4DV0C 5BSUA 3LAXA 5T8SA 1IBKC 4DUYC 1MD9A 1N32C 4FUTA 1USPB 5A1GA 1VLAA 4OX9C 4PHTA 4DR1C 3NYRA 3IPLA 4JI7C 1J5EC 4DV1C 2VZEA 1HNZC 4D4IA 5BUQA 3J80D 2ASBA 4DR6C 4B3RC 4DV5C 4K0BA 3UZ0A 2D1QA 3LUSA 2CXCA 5IFIA 1MDFA 1PG4A 5GTDA 2QL8A 2OPLB 5A1IA 2BJOA 2AYAA 4GKKC 5ADZA 4HPVA 2P2FA 4D57A 2XR1A 3L8CA 5K8FA 5KYVA 2HHHC 2P2JA 1O92A 4G36A 4PZPA 2PROA 5AE3A 3VNRA 4DV7C 2Y4OA 3ETCA 4G37A 4RM3A 4LF8C 3H2TA 4OXIA 3RV2A 2D28C 4NDNA 1T5DX 3T1YC 1MXAA 4D4GA 3TUFA 2VQFC 3VNSA 4GXQA 1RG9A 4B3SC 4R0MA 5A2QD 3N54B 1FJGC 4ZLPA 1QM4A 3A9VA 3UOWA 2D1RA 1O93A 1WF3A 1MKYA 3N2QA 3AF6A 2VQEC 3NPDA 5KYTA 3DAYA 3I08A 4RLFA 4FTFA 1ULTA 4JI6C 3I07A 2VSQA 2CY1A 1N36C 2D1TA 4X62C 4DR4C 1PG3A 2D7VA 3R9XA 3PESA 4DCUA 5BR8C 3EERA 1XRAA 1AMUA 4YHHC 1WH9A 3R44A 4JI5C 1T5HX 5DV9A 4RMNA 5BSWA 1UKKA 4JI3C 4X64C 4OYCA 3IEUA 3SO4A 2YWCA 1HH2P 4BBYA 4DV6C 2UU9C 4KTTA 4IZ6A 2P02A 4BSZA 2UXDC 2YWBA 4ZJZA 4B3MC 4DR3C 2E8EA 3S82A 2JMPA 2OBVA 1QWIA 5H9UA 4JI1C 5BSVA 1GPMA 1ZB8A 1I94C 4DUZC 4TPSB 4DR5C 2HJGA 4JI4C 3AF5A 3L95X 1JOSA 4RM2A 1MXCA 3EQ6A 4LFCC 3TDEA 4AQYC 4BC9A 4IR7A 2ONFA 5AE2A 4I9GA 3OTOC 4R1LA 4EATA 2UUAC 3JAMD 5KEIA 1N34C 1V26A 5AE1A 1V25A 1XRCA 4DCSA 2E5LC 4L4QA 5JRHA 2BH1X 4LF6C 2UXBC 2D1SA 1BA3A 2UXCC 1RY2A 1NYEA 3PBKA 1N2FA 4LE5A 2QVXX 5BSMA 1N33C 4NOZA 5K85A 2PT7G 4ISBA 5CZVA 4GS5A 3CW8X 4LFAC 1LCIA 3KXWA 5BSRA 3FCCA 3CJEA 5BURA 4JI8C 3C5EA 1ML8A 4JM1A 2ZM6C 4KTVA 4BCAA 2DPLA 2DYJA 1MXBA 5FLXD 4GKJC 5A19A 5IT9D 4KHPC 1HNXC 4ODJA 1HR0C 1XNQC 4PROC 4I9FA 3GR0A 3PROC 4L2ZA 3B7WA 4LF7C 2D27A 3IEVA 3LGXA 4JYAC 5IWAC 2E8FA 2YCBA 5BSTA 4MH4A 4DV4C 2E0GA 5T8TA 4DG9A 3R9WA 2EGTA 4WS9A 4B3TC 3E7XA 4DG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 C;  2ONF A;  4XX2 A;  4B3S C;  4JV5 C;  5A2Q D;  4JI0 C;  1XNR C;  3OTO C;  1FJG C;  1XMQ C;  2E8C A;  4MTN A;  2UUA C;  3JAM D;  4NXN C;  5LMN C;  4X65 C;  2KZF A;  1N34 C;  4DR2 C;  4NXM C;  4DV0 C;  4DCS A;  2E5L C;  2UUC C;  4LF6 C;  1WF3 A;  4YY3 C;  2UXB C;  1MKY A;  2UUB C;  2VQE C;  3AF6 A;  2UXC C;  1IBK C;  4DUY C;  1NYE A;  4DCT A;  1N32 C;  1N2F A;  5LMU C;  4JI6 C;  3I07 A;  1USP B;  1IBM C;  2CY1 A;  1VLA A;  1ZB9 A;  4OX9 C;  4DV3 C;  1N33 C;  4NOZ A;  4LFB C;  4DR1 C;  2PT7 G;  1N36 C;  4JI7 C;  1J5E C;  4X62 C;  4DR4 C;  2D7V A;  4JI2 C;  1XMO C;  4DV1 C;  2E7G A;  1PA4 A;  1HNZ C;  3J80 D;  2ASB A;  3R9X A;  3T1H C;  4DR6 C;  4B3R C;  4DV5 C;  4DCU A;  5BR8 C;  3GKU A;  4LFA C;  3EER A;  4YHH C;  1WH9 A;  2ATW A;  1USP A;  1LQL A;  3LUS A;  3CJE A;  2CXC A;  4JI5 C;  4JI8 C;  1L2F A;  1ML8 A;  2ZM6 C;  1UKK A;  4JI3 C;  2QL8 A;  4X64 C;  2OPL B;  3IEU A;  2BJO A;  2DYJ A;  4GKK C;  5FLX D;  1HH2 P;  4DV6 C;  2UU9 C;  4GKJ C;  1KKG A;  5IT9 D;  4X66 C;  4KHP C;  1HNX C;  3J81 D;  4BSZ A;  2UXD C;  4B3M C;  1HR0 C;  4DR3 C;  1XNQ C;  2E8E A;  1IBL C;  2XR1 A;  2JMP A;  4DV2 C;  2OPL A;  2HHH C;  4LF7 C;  3IEV A;  1QWI A;  4JYA C;  5IWA C;  2E8F A;  4JI1 C;  2YCB A;  4DCV A;  4DR7 C;  1ZB8 A;  4MH4 A;  4DV4 C;  1I94 C;  4DUZ C;  4DV7 C;  4DR5 C;  2HJG A;  2PN2 A;  4JI4 C;  3AF5 A;  3J7A D;  1JOS A;  1K0R A;  4LF9 C;  3R9W A;  4LF8 C;  2F4V C;  1EGA A;  4LF5 C;  2EGT A;  4LFC C;  4K0K C;  4B3T C;  3T1Y C;  1HNW C;  4AQY C;  2VQF C; 
#chains in the Genus database with same CATH topology
 4LF4 C;  2QVY X;  3E7W A;  4XX2 A;  4D56 A;  2WD9 A;  4U5Y D;  2V7B A;  5LMN C;  5E7Q A;  4DR2 C;  2P20 A;  2UUC C;  1O9T A;  4YY3 C;  1XRB A;  2UUB C;  4R1M A;  2Y27 A;  2P2M A;  4BC7 A;  4DCT A;  5LMU C;  3K6R A;  3NI2 A;  1IBM C;  1ZB9 A;  4DV3 C;  4LFB C;  3DLP X;  4RVN A;  1P7L A;  3DHV A;  4JI2 C;  1XMO C;  2E7G A;  1PA4 A;  3T1H C;  3GKU A;  2ATW A;  1LQL A;  1USP A;  1XDX A;  2MCQ A;  4GXR A;  5CZX A;  1MDB A;  1L2F A;  3IML A;  3ETO A;  2QVZ X;  4RVO A;  3FCE A;  1P4E A;  1KKG A;  4X66 C;  3NYQ A;  1YJ7 A;  3J81 D;  4FUQ A;  2Y4N A;  4WV3 A;  1IBL C;  4DV2 C;  1FLO A;  2WP0 C;  2OPL A;  4L7I A;  3A4I A;  4DCV A;  4DR7 C;  3LNV A;  1O90 A;  2P2B A;  3GPC A;  2PN2 A;  3G7S A;  3J7A D;  2DHM A;  1K0R A;  2MM9 A;  4LF9 C;  2Z51 A;  2F4V C;  3UEB A;  1EGA A;  4LF5 C;  4K0K C;  3VNQ A;  3RG2 A;  1HNW C;  3A9U A;  3GR1 A;  3TQI A;  4RLQ A;  2P2Q A;  4JV5 C;  2KDN A;  4JI0 C;  1XNR C;  2OO4 A;  1V60 A;  1XMQ C;  2E8C A;  1NY8 A;  4MTN A;  1FUG A;  2QW0 X;  4NXN C;  3CW9 A;  4X65 C;  2KZF A;  4G1I A;  4NXM C;  5BUS A;  4DV0 C;  5BSU A;  3LAX A;  5T8S A;  1IBK C;  4DUY C;  1MD9 A;  1N32 C;  4FUT A;  1USP B;  5A1G A;  1VLA A;  4OX9 C;  4PHT A;  4DR1 C;  2KZ0 A;  3NYR A;  3IPL A;  4JI7 C;  1J5E C;  4DV1 C;  2VZE A;  1HNZ C;  4D4I A;  5BUQ A;  3J80 D;  2ASB A;  4DR6 C;  4B3R C;  4DV5 C;  4PUG A;  4K0B A;  3UZ0 A;  2D1Q A;  3LUS A;  2CXC A;  5IFI A;  1MDF A;  1PG4 A;  5GTD A;  2QL8 A;  2OPL B;  5A1I A;  2BJO A;  2AYA A;  4GKK C;  1VEH A;  5ADZ A;  4HPV A;  2P2F A;  4D57 A;  2XR1 A;  3L8C A;  5K8F A;  2ZZN A;  5KYV A;  2HHH C;  2P2J A;  1O92 A;  4G36 A;  4PZP A;  2PRO A;  5LCI A;  5AE3 A;  2YX1 A;  1PU1 A;  3VNR A;  4DV7 C;  2Y4O A;  3ETC A;  4G37 A;  4RM3 A;  4LF8 C;  3H2T A;  4OXI A;  3RV2 A;  2D28 C;  3CQ3 A;  4NDN A;  1WCJ A;  1T5D X;  3T1Y C;  1MXA A;  4D4G A;  3TUF A;  2VQF C;  3VNS A;  4GXQ A;  1RG9 A;  4B3S C;  4R0M A;  5A2Q D;  3N54 B;  1FJG C;  4ZLP A;  2MMA B;  2ZZM A;  1QM4 A;  1M6X A;  3A9V A;  3UOW A;  2D1R A;  1O93 A;  1WF3 A;  1MKY A;  3N2Q A;  3AF6 A;  2VQE C;  3NPD A;  5KYT A;  3DAY A;  3I08 A;  4RLF A;  4FTF A;  1ULT A;  4JI6 C;  3I07 A;  2VSQ A;  2ZTB A;  2CY1 A;  1N36 C;  2D1T A;  4X62 C;  4DR4 C;  1PG3 A;  2D7V A;  1YGT A;  3R9X A;  3PES A;  4DCU A;  5BR8 C;  3TR3 A;  3EER A;  1XRA A;  1AMU A;  4YHH C;  1WH9 A;  3R44 A;  3FM7 A;  4JI5 C;  3AY0 A;  1P4E C;  1IB8 A;  1T5H X;  2PG1 E;  5DV9 A;  1TH5 A;  4RMN A;  5BSW A;  1UKK A;  4JI3 C;  4X64 C;  4OYC A;  3IEU A;  3SO4 A;  2M5O A;  4PUI A;  2YWC A;  1HH2 P;  4BBY A;  4DV6 C;  2UU9 C;  2NCL A;  3A25 A;  3LNO A;  4KTT A;  4IZ6 A;  2P02 A;  4BSZ A;  2UXD C;  2YWB A;  4ZJZ A;  4B3M C;  4DR3 C;  2E8E A;  3S82 A;  4PUH A;  2JMP A;  2OBV A;  1QWI A;  5H9U A;  4JI1 C;  5BSV A;  1GPM A;  1ZB8 A;  3CQ2 A;  1I94 C;  4DUZ C;  4TPS B;  4DR5 C;  2HJG A;  4JI4 C;  3AF5 A;  3L95 X;  1JOS A;  4RM2 A;  1MXC A;  3O2E A;  3EQ6 A;  4LFC C;  3TDE A;  4AQY C;  4BC9 A;  4IR7 A;  2ONF A;  5AE2 A;  4I9G A;  3OTO C;  3UX3 A;  4R1L A;  4EAT A;  2UUA C;  3JAM D;  5KEI A;  1N34 C;  1V26 A;  5AE1 A;  1V25 A;  1XRC A;  4DCS A;  2E5L C;  4L4Q A;  5JRH A;  2BH1 X;  4LF6 C;  2UXB C;  2D1S A;  1BA3 A;  2UXC C;  1RY2 A;  2JNV A;  1NYE A;  3PBK A;  1N2F A;  4LE5 A;  2QVX X;  5BSM A;  1N33 C;  4NOZ A;  5K85 A;  2PT7 G;  4ISB A;  5CZV A;  4GS5 A;  3A26 A;  3CW8 X;  4LFA C;  1LCI A;  3KXW A;  5BSR A;  3FCC A;  3CJE A;  3CQ1 A;  5BUR A;  4JI8 C;  3C5E A;  1ML8 A;  4JM1 A;  2ZM6 C;  4KTV A;  4BCA A;  2DPL A;  2DYJ A;  1MXB A;  5FLX D;  4GKJ C;  5A19 A;  5IT9 D;  4KHP C;  1HNX C;  4ODJ A;  1HR0 C;  1XNQ C;  4PRO C;  4I9F A;  3GR0 A;  1XHJ A;  3PRO C;  4L2Z A;  2CU6 A;  3B7W A;  4LF7 C;  2D27 A;  3IEV A;  3LGX A;  4JYA C;  5IWA C;  2E8F A;  2YCB A;  5BST A;  2M5H A;  4MH4 A;  4DV4 C;  2E0G A;  1UWD A;  5T8T A;  4DG9 A;  3R9W A;  3UX2 A;  2EGT A;  4WS9 A;  4B3T C;  1XS3 A;  3E7X A;  1M6X C;  4DG8 A; 
#chains in the Genus database with same CATH homology
 4LF4 C;  2QVY X;  3E7W A;  4XX2 A;  4D56 A;  2WD9 A;  4U5Y D;  2V7B A;  5LMN C;  5E7Q A;  4DR2 C;  2P20 A;  2UUC C;  1O9T A;  4YY3 C;  1XRB A;  2UUB C;  4R1M A;  2Y27 A;  2P2M A;  4BC7 A;  4DCT A;  5LMU C;  3NI2 A;  1IBM C;  1ZB9 A;  4DV3 C;  4LFB C;  3DLP X;  4RVN A;  1P7L A;  3DHV A;  4JI2 C;  1XMO C;  2E7G A;  1PA4 A;  3T1H C;  3GKU A;  2ATW A;  1LQL A;  1USP A;  4GXR A;  5CZX A;  1MDB A;  1L2F A;  3IML A;  3ETO A;  2QVZ X;  4RVO A;  3FCE A;  1KKG A;  4X66 C;  3NYQ A;  1YJ7 A;  3J81 D;  4FUQ A;  2Y4N A;  4WV3 A;  1IBL C;  4DV2 C;  2WP0 C;  2OPL A;  4L7I A;  3A4I A;  4DCV A;  4DR7 C;  3LNV A;  1O90 A;  2P2B A;  3GPC A;  2PN2 A;  3G7S A;  3J7A D;  1K0R A;  4LF9 C;  2F4V C;  1EGA A;  4LF5 C;  4K0K C;  3VNQ A;  3RG2 A;  1HNW C;  3A9U A;  3GR1 A;  3TQI A;  4RLQ A;  2P2Q A;  4JV5 C;  4JI0 C;  1XNR C;  2OO4 A;  1XMQ C;  2E8C A;  4MTN A;  1FUG A;  2QW0 X;  4NXN C;  3CW9 A;  4X65 C;  2KZF A;  4G1I A;  4NXM C;  5BUS A;  4DV0 C;  5BSU A;  3LAX A;  5T8S A;  1IBK C;  4DUY C;  1MD9 A;  1N32 C;  4FUT A;  1USP B;  5A1G A;  1VLA A;  4OX9 C;  4PHT A;  4DR1 C;  3NYR A;  3IPL A;  4JI7 C;  1J5E C;  4DV1 C;  2VZE A;  1HNZ C;  4D4I A;  5BUQ A;  3J80 D;  2ASB A;  4DR6 C;  4B3R C;  4DV5 C;  4K0B A;  3UZ0 A;  2D1Q A;  3LUS A;  2CXC A;  5IFI A;  1MDF A;  1PG4 A;  5GTD A;  2QL8 A;  2OPL B;  5A1I A;  2BJO A;  2AYA A;  4GKK C;  5ADZ A;  4HPV A;  2P2F A;  4D57 A;  2XR1 A;  3L8C A;  5K8F A;  5KYV A;  2HHH C;  2P2J A;  1O92 A;  4G36 A;  4PZP A;  2PRO A;  5AE3 A;  3VNR A;  4DV7 C;  2Y4O A;  3ETC A;  4G37 A;  4RM3 A;  4LF8 C;  3H2T A;  4OXI A;  3RV2 A;  2D28 C;  4NDN A;  1T5D X;  3T1Y C;  1MXA A;  4D4G A;  3TUF A;  2VQF C;  3VNS A;  4GXQ A;  1RG9 A;  4B3S C;  4R0M A;  5A2Q D;  3N54 B;  1FJG C;  4ZLP A;  1QM4 A;  3A9V A;  3UOW A;  2D1R A;  1O93 A;  1WF3 A;  1MKY A;  3N2Q A;  3AF6 A;  2VQE C;  3NPD A;  5KYT A;  3DAY A;  3I08 A;  4RLF A;  4FTF A;  1ULT A;  4JI6 C;  3I07 A;  2VSQ A;  2CY1 A;  1N36 C;  2D1T A;  4X62 C;  4DR4 C;  1PG3 A;  2D7V A;  3R9X A;  3PES A;  4DCU A;  5BR8 C;  3EER A;  1XRA A;  1AMU A;  4YHH C;  1WH9 A;  3R44 A;  4JI5 C;  1T5H X;  5DV9 A;  4RMN A;  5BSW A;  1UKK A;  4JI3 C;  4X64 C;  4OYC A;  3IEU A;  3SO4 A;  2YWC A;  1HH2 P;  4BBY A;  4DV6 C;  2UU9 C;  4KTT A;  4IZ6 A;  2P02 A;  4BSZ A;  2UXD C;  2YWB A;  4ZJZ A;  4B3M C;  4DR3 C;  2E8E A;  3S82 A;  2JMP A;  2OBV A;  1QWI A;  5H9U A;  4JI1 C;  5BSV A;  1GPM A;  1ZB8 A;  1I94 C;  4DUZ C;  4TPS B;  4DR5 C;  2HJG A;  4JI4 C;  3AF5 A;  3L95 X;  1JOS A;  4RM2 A;  1MXC A;  3EQ6 A;  4LFC C;  3TDE A;  4AQY C;  4BC9 A;  4IR7 A;  2ONF A;  5AE2 A;  4I9G A;  3OTO C;  4R1L A;  4EAT A;  2UUA C;  3JAM D;  5KEI A;  1N34 C;  1V26 A;  5AE1 A;  1V25 A;  1XRC A;  4DCS A;  2E5L C;  4L4Q A;  5JRH A;  2BH1 X;  4LF6 C;  2UXB C;  2D1S A;  1BA3 A;  2UXC C;  1RY2 A;  1NYE A;  3PBK A;  1N2F A;  4LE5 A;  2QVX X;  5BSM A;  1N33 C;  4NOZ A;  5K85 A;  2PT7 G;  4ISB A;  5CZV A;  4GS5 A;  3CW8 X;  4LFA C;  1LCI A;  3KXW A;  5BSR A;  3FCC A;  3CJE A;  5BUR A;  4JI8 C;  3C5E A;  1ML8 A;  4JM1 A;  2ZM6 C;  4KTV A;  4BCA A;  2DPL A;  2DYJ A;  1MXB A;  5FLX D;  4GKJ C;  5A19 A;  5IT9 D;  4KHP C;  1HNX C;  4ODJ A;  1HR0 C;  1XNQ C;  4PRO C;  4I9F A;  3GR0 A;  3PRO C;  4L2Z A;  3B7W A;  4LF7 C;  2D27 A;  3IEV A;  3LGX A;  4JYA C;  5IWA C;  2E8F A;  2YCB A;  5BST A;  4MH4 A;  4DV4 C;  2E0G A;  5T8T A;  4DG9 A;  3R9W A;  2EGT A;  4WS9 A;  4B3T C;  3E7X A;  4DG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...