4LFBC

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lfbC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lfbC02
2HJGA 1ML8A 1IBLC 1PA4A 3I07A 4YHHC 1HNZC 4B3RC 1XMOC 4DV6C 4LF9C 5LMNC 3T1HC 4X64C 2E7GA 3IEUA 3J80D 2VQFC 1IBMC 3R9XA 2OPLB 2UXDC 4JI0C 1QWIA 4DV0C 4DR4C 5BR8C 1VLAA 2UXBC 2F4VC 2VQEC 5IWAC 2UXCC 3R9WA 2DYJA 2UUAC 4LFAC 4NOZA 3J81D 4DR6C 4DV1C 2E5LC 3LUSA 1L2FA 4DV2C 1N33C 4JI4C 1XNQC 1XNRC 3J7AD 4X62C 2CY1A 4X66C 4BSZA 1J5EC 4JI7C 4LF4C 3AF6A 4DV4C 1XMQC 1HR0C 1MKYA 4X65C 4JI2C 5IT9D 4LF6C 2EGTA 4DCUA 4LF5C 2E8EA 1N2FA 1NYEA 1K0RA 4JYAC 4LF8C 1UKKA 2KZFA 4DR2C 4K0KC 4KHPC 3EERA 4LFBC 1ZB9A 4B3MC 1KKGA 4XX2A 5A2QD 2D7VA 3IEVA 3JAMD 4DV5C 1ZB8A 1I94C 1USPA 5LMUC 4MH4A 1FJGC 2ONFA 4DR5C 1LQLA 4DR1C 2UUBC 2UUCC 4OX9C 3OTOC 2E8FA 2ATWA 4YY3C 4LF7C 2E8CA 1WH9A 1WF3A 3CJEA 5FLXD 4JI6C 2PT7G 1JOSA 1USPB 4JI3C 1EGAA 4B3TC 4DUZC 2PN2A 4LFCC 4GKKC 4DV7C 2BJOA 2UU9C 4JV5C 4DCVA 1N32C 4NXNC 3GKUA 4DCSA 4NXMC 2CXCA 2JMPA 4JI1C 2QL8A 4DCTA 4DR3C 4AQYC 2ASBA 1HNWC 4DV3C 4DUYC 3T1YC 4JI5C 2OPLA 4DR7C 1HH2P 1HNXC 3AF5A 4JI8C 4MTNA 1IBKC 2ZM6C 1N36C 4GKJC 1N34C 2YCBA 2XR1A 2HHHC 4B3SC
chains in the Genus database with same CATH superfamily
3CQ2A 4FUTA 3UX3A 1PA4A 4YHHC 4HPVA 4R1LA 1XHJA 5K85A 2Z51A 1FLOA 1BA3A 3A4IA 4DV0C 4DR4C 5BR8C 3C5EA 2P2BA 2F4VC 5CZXA 2VQEC 4G1IA 5BSVA 2UUAC 1M6XC 1L2FA 1XNRC 4JM1A 4X62C 2D1TA 3DAYA 4X66C 1YJ7A 3L95X 2P2FA 5JRHA 1XMQC 1HR0C 4U5YD 4BCAA 2D1QA 1V60A 4DR2C 2MCQA 2MMAB 3LAXA 4LFBC 4B3MC 5A1GA 5A2QD 2QVZX 4DV5C 3NYQA 4BBYA 1USPA 1VEHA 3S82A 5K8FA 4DR5C 2WP0C 5BURA 3CQ1A 3ETOA 1O9TA 4YY3C 4LF7C 1WH9A 3NYRA 4RM2A 4B3TC 5A1IA 4DUZC 3NI2A 3AY0A 4LFCC 4GKKC 4DV7C 2UU9C 1M6XA 2P02A 4NXNC 1XDXA 4NXMC 1XRCA 4DR3C 1TH5A 1V26A 4ISBA 4RLFA 2CU6A 4PHTA 1HH2P 4I9FA 3UX2A 3LNOA 4JI8C 1N36C 3DHVA 4GKJC 3TUFA 3UEBA 5KYVA 2XR1A 2HHHC 2E0GA 1MXCA 3A26A 2M5OA 4LE5A 1RY2A 1ML8A 1IBLC 2V7BA 1LCIA 2MM9A 1O92A 1XRAA 3KXWA 3UOWA 1XMOC 1HNZC 4DV6C 5LMNC 1MDFA 4X64C 2ZZNA 2E7GA 3A9VA 3J80D 1IBMC 2OPLB 3RV2A 1O93A 5IWAC 2UXCC 3PESA 2DYJA 4NOZA 4RLQA 3CQ3A 4DV2C 2NCLA 1XNQC 4ODJA 4BSZA 5KEIA 2DPLA 2OBVA 1MXBA 4JI7C 3NPDA 1MKYA 5AE1A 4X65C 4KTVA 3N2QA 1N2FA 1K0RA 5BSMA 5A19A 4PROC 4K0KC 4I9GA 5LCIA 4L4QA 3EERA 3GR1A 5CZVA 3DLPX 3K6RA 1MDBA 2WD9A 1ZB8A 2KDNA 4DG8A 4G36A 4G37A 4DG9A 1FJGC 2BH1X 4DR1C 3PBKA 5KYTA 4OX9C 4EATA 2D27A 1PG4A 3A9UA 2P2JA 4FUQA 3CW9A 1MXAA 3LGXA 1JOSA 1USPB 1P4EC 1EGAA 4IZ6A 2PN2A 4D4GA 5BSTA 1O90A 4RM3A 4PUIA 4AQYC 3GR0A 4DUYC 4JI5C 3B7WA 2ZZMA 5BUSA 2ZTBA 3LNVA 2HJGA 5T8TA 2M5HA 4L7IA 4IR7A 2D1RA 3I07A 3IMLA 3N54B 4B3RC 2OO4A 2PG1E 3T1HC 1NY8A 3IEUA 1WCJA 5BUQA 1XS3A 2UXDC 3RG2A 1QWIA 3SO4A 1IB8A 3GPCA 3TDEA 3I08A 3R9WA 1T5HX 4LFAC 4RMNA 2D1SA 3J81D 2E5LC 4DR6C 3LUSA 4JI4C 3IPLA 4NDNA 3J7AD 2CY1A 4R0MA 2KZ0A 3ETCA 1J5EC 2D28C 4LF4C 1T5DX 3AF6A 2JNVA 2P2QA 4LF6C 2E8EA 2YWCA 1NYEA 4JYAC 4LF8C 4KHPC 2P2MA 1QM4A 2AYAA 3G7SA 1ZB9A 1KKGA 3VNRA 3R44A 4XX2A 3TR3A 3JAMD 1I94C 4MH4A 4D4IA 2UUBC 1GPMA 1PU1A 3VNQA 2E8FA 5BSRA 5H9UA 4JI6C 2PT7G 1P7LA 2BJOA 4JV5C 4D57A 4DCVA 1N32C 2CXCA 3VNSA 3H2TA 2ASBA 1HNWC 4DV3C 1YGTA 4WV3A 4DR7C 3UZ0A 1HNXC 3AF5A 2ZM6C 2YWBA 2YCBA 1V25A 5ADZA 2VZEA 4B3SC 2QVXX 2YX1A 5BSUA 3A25A 1RG9A 5AE2A 4LF9C 2VSQA 4D56A 2VQFC 3R9XA 1PG3A 4JI0C 2Y4OA 2P20A 1VLAA 2DHMA 2UXBC 3CW8X 4TPSB 1FUGA 4DV1C 1N33C 2Y4NA 4GS5A 3E7XA 3E7WA 4ZLPA 4DV4C 1XRBA 4JI2C 5IT9D 4FTFA 1UWDA 2EGTA 4DCUA 4LF5C 1ULTA 1UKKA 2KZFA 4BC9A 3PROC 4KTTA 4L2ZA 4GXRA 3EQ6A 4OYCA 4OXIA 2D7VA 3IEVA 4PUHA 5LMUC 2PROA 1AMUA 4K0BA 4RVNA 2ONFA 1LQLA 2UUCC 4PZPA 4WS9A 5GTDA 4GXQA 3FM7A 3OTOC 2ATWA 2E8CA 1WF3A 2QW0X 3CJEA 3L8CA 5FLXD 5IFIA 4JI3C 3O2EA 4R1MA 3FCEA 4ZJZA 1P4EA 5DV9A 2Y27A 3GKUA 4DCSA 2JMPA 4JI1C 2QL8A 4BC7A 4DCTA 5E7QA 5T8SA 3T1YC 2OPLA 3TQIA 4PUGA 1MD9A 4MTNA 1IBKC 5AE3A 5BSWA 1N34C 4RVOA 2QVYX 3FCCA
chains in the Genus database with same CATH topology
4FUTA 1PA4A 4YHHC 4HPVA 4R1LA 5K85A 1BA3A 3A4IA 4DV0C 4DR4C 5BR8C 3C5EA 2P2BA 2F4VC 5CZXA 2VQEC 4G1IA 5BSVA 2UUAC 1L2FA 1XNRC 4JM1A 4X62C 2D1TA 3DAYA 4X66C 1YJ7A 3L95X 2P2FA 5JRHA 1XMQC 1HR0C 4U5YD 4BCAA 2D1QA 4DR2C 3LAXA 4LFBC 4B3MC 5A1GA 5A2QD 2QVZX 4DV5C 3NYQA 4BBYA 1USPA 3S82A 5K8FA 4DR5C 2WP0C 5BURA 3ETOA 1O9TA 4YY3C 4LF7C 1WH9A 3NYRA 4RM2A 4B3TC 5A1IA 4DUZC 3NI2A 4LFCC 4GKKC 4DV7C 2UU9C 2P02A 4NXNC 4NXMC 1XRCA 4DR3C 1V26A 4ISBA 4RLFA 4PHTA 1HH2P 4I9FA 4JI8C 1N36C 3DHVA 4GKJC 3TUFA 5KYVA 2XR1A 2HHHC 2E0GA 1MXCA 4LE5A 1RY2A 1ML8A 1IBLC 2V7BA 1LCIA 3UOWA 1O92A 1XRAA 3KXWA 1HNZC 1XMOC 4DV6C 5LMNC 1MDFA 4X64C 2E7GA 3A9VA 3J80D 1IBMC 2OPLB 3RV2A 1O93A 5IWAC 2UXCC 3PESA 2DYJA 4NOZA 4RLQA 4DV2C 1XNQC 4ODJA 4BSZA 5KEIA 2DPLA 2OBVA 1MXBA 4JI7C 3NPDA 1MKYA 5AE1A 4X65C 4KTVA 3N2QA 1N2FA 1K0RA 5BSMA 5A19A 4PROC 4K0KC 4I9GA 4L4QA 3EERA 3GR1A 5CZVA 3DLPX 1MDBA 2WD9A 1ZB8A 4DG8A 4G36A 4G37A 4DG9A 1FJGC 2BH1X 4DR1C 3PBKA 5KYTA 4OX9C 4EATA 2D27A 1PG4A 3A9UA 2P2JA 4FUQA 3CW9A 1MXAA 3LGXA 1JOSA 1USPB 1EGAA 4IZ6A 2PN2A 4D4GA 5BSTA 1O90A 4RM3A 4AQYC 3GR0A 4DUYC 4JI5C 3B7WA 5BUSA 3LNVA 2HJGA 5T8TA 4L7IA 4IR7A 2D1RA 3I07A 3IMLA 3N54B 4B3RC 2OO4A 3T1HC 3IEUA 5BUQA 2UXDC 3RG2A 1QWIA 3SO4A 3GPCA 3TDEA 3I08A 3R9WA 1T5HX 4LFAC 4RMNA 2D1SA 3J81D 2E5LC 4DR6C 3LUSA 4JI4C 3IPLA 4NDNA 3J7AD 2CY1A 4R0MA 3ETCA 1J5EC 2D28C 4LF4C 1T5DX 3AF6A 2P2QA 4LF6C 2E8EA 2YWCA 1NYEA 4JYAC 4LF8C 4KHPC 2P2MA 1QM4A 2AYAA 3G7SA 1ZB9A 1KKGA 3VNRA 3R44A 4XX2A 3JAMD 1I94C 4MH4A 4D4IA 2UUBC 1GPMA 3VNQA 2E8FA 5BSRA 5H9UA 4JI6C 2PT7G 1P7LA 2BJOA 4JV5C 4D57A 4DCVA 1N32C 2CXCA 3VNSA 3H2TA 2ASBA 1HNWC 4DV3C 4WV3A 4DR7C 3UZ0A 1HNXC 3AF5A 2ZM6C 2YWBA 2YCBA 1V25A 5ADZA 2VZEA 4B3SC 2QVXX 5BSUA 1RG9A 5AE2A 4LF9C 2VSQA 4D56A 2VQFC 3R9XA 1PG3A 4JI0C 2Y4OA 2P20A 1VLAA 2UXBC 3CW8X 4TPSB 1FUGA 4DV1C 1N33C 2Y4NA 4GS5A 3E7XA 3E7WA 4ZLPA 4DV4C 1XRBA 4JI2C 5IT9D 4FTFA 2EGTA 4DCUA 4LF5C 1ULTA 1UKKA 2KZFA 4BC9A 3PROC 4KTTA 4L2ZA 4GXRA 3EQ6A 4OYCA 4OXIA 2D7VA 3IEVA 5LMUC 2PROA 1AMUA 4K0BA 4RVNA 2ONFA 1LQLA 2UUCC 4PZPA 4WS9A 5GTDA 4GXQA 3OTOC 2ATWA 2E8CA 1WF3A 2QW0X 3CJEA 3L8CA 5FLXD 5IFIA 4JI3C 4R1MA 3FCEA 4ZJZA 5DV9A 2Y27A 3GKUA 4DCSA 2JMPA 4JI1C 2QL8A 4BC7A 4DCTA 5E7QA 5T8SA 3T1YC 2OPLA 3TQIA 1MD9A 4MTNA 1IBKC 5AE3A 5BSWA 1N34C 4RVOA 2QVYX 3FCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJG A;  1ML8 A;  1IBL C;  1PA4 A;  3I07 A;  4YHH C;  1HNZ C;  4B3R C;  1XMO C;  4DV6 C;  4LF9 C;  5LMN C;  3T1H C;  4X64 C;  2E7G A;  3IEU A;  3J80 D;  2VQF C;  1IBM C;  3R9X A;  2OPL B;  2UXD C;  4JI0 C;  1QWI A;  4DV0 C;  4DR4 C;  5BR8 C;  1VLA A;  2UXB C;  2F4V C;  2VQE C;  5IWA C;  2UXC C;  3R9W A;  2DYJ A;  2UUA C;  4LFA C;  4NOZ A;  3J81 D;  4DR6 C;  4DV1 C;  2E5L C;  3LUS A;  1L2F A;  4DV2 C;  1N33 C;  4JI4 C;  1XNQ C;  1XNR C;  3J7A D;  4X62 C;  2CY1 A;  4X66 C;  4BSZ A;  1J5E C;  4JI7 C;  4LF4 C;  3AF6 A;  4DV4 C;  1XMQ C;  1HR0 C;  1MKY A;  4X65 C;  4JI2 C;  5IT9 D;  4LF6 C;  2EGT A;  4DCU A;  4LF5 C;  2E8E A;  1N2F A;  1NYE A;  1K0R A;  4JYA C;  4LF8 C;  1UKK A;  2KZF A;  4DR2 C;  4K0K C;  4KHP C;  3EER A;  4LFB C;  1ZB9 A;  4B3M C;  1KKG A;  4XX2 A;  5A2Q D;  2D7V A;  3IEV A;  3JAM D;  4DV5 C;  1ZB8 A;  1I94 C;  1USP A;  5LMU C;  4MH4 A;  1FJG C;  2ONF A;  4DR5 C;  1LQL A;  4DR1 C;  2UUB C;  2UUC C;  4OX9 C;  3OTO C;  2E8F A;  2ATW A;  4YY3 C;  4LF7 C;  2E8C A;  1WH9 A;  1WF3 A;  3CJE A;  5FLX D;  4JI6 C;  2PT7 G;  1JOS A;  1USP B;  4JI3 C;  1EGA A;  4B3T C;  4DUZ C;  2PN2 A;  4LFC C;  4GKK C;  4DV7 C;  2BJO A;  2UU9 C;  4JV5 C;  4DCV A;  1N32 C;  4NXN C;  3GKU A;  4DCS A;  4NXM C;  2CXC A;  2JMP A;  4JI1 C;  2QL8 A;  4DCT A;  4DR3 C;  4AQY C;  2ASB A;  1HNW C;  4DV3 C;  4DUY C;  3T1Y C;  4JI5 C;  2OPL A;  4DR7 C;  1HH2 P;  1HNX C;  3AF5 A;  4JI8 C;  4MTN A;  1IBK C;  2ZM6 C;  1N36 C;  4GKJ C;  1N34 C;  2YCB A;  2XR1 A;  2HHH C;  4B3S C; 
#chains in the Genus database with same CATH topology
 3CQ2 A;  4FUT A;  3UX3 A;  1PA4 A;  4YHH C;  4HPV A;  4R1L A;  1XHJ A;  5K85 A;  2Z51 A;  1FLO A;  1BA3 A;  3A4I A;  4DV0 C;  4DR4 C;  5BR8 C;  3C5E A;  2P2B A;  2F4V C;  5CZX A;  2VQE C;  4G1I A;  5BSV A;  2UUA C;  1M6X C;  1L2F A;  1XNR C;  4JM1 A;  4X62 C;  2D1T A;  3DAY A;  4X66 C;  1YJ7 A;  3L95 X;  2P2F A;  5JRH A;  1XMQ C;  1HR0 C;  4U5Y D;  4BCA A;  2D1Q A;  1V60 A;  4DR2 C;  2MCQ A;  2MMA B;  3LAX A;  4LFB C;  4B3M C;  5A1G A;  5A2Q D;  2QVZ X;  4DV5 C;  3NYQ A;  4BBY A;  1USP A;  1VEH A;  3S82 A;  5K8F A;  4DR5 C;  2WP0 C;  5BUR A;  3CQ1 A;  3ETO A;  1O9T A;  4YY3 C;  4LF7 C;  1WH9 A;  3NYR A;  4RM2 A;  4B3T C;  5A1I A;  4DUZ C;  3NI2 A;  3AY0 A;  4LFC C;  4GKK C;  4DV7 C;  2UU9 C;  1M6X A;  2P02 A;  4NXN C;  1XDX A;  4NXM C;  1XRC A;  4DR3 C;  1TH5 A;  1V26 A;  4ISB A;  4RLF A;  2CU6 A;  4PHT A;  1HH2 P;  4I9F A;  3UX2 A;  3LNO A;  4JI8 C;  1N36 C;  3DHV A;  4GKJ C;  3TUF A;  3UEB A;  5KYV A;  2XR1 A;  2HHH C;  2E0G A;  1MXC A;  3A26 A;  2M5O A;  4LE5 A;  1RY2 A;  1ML8 A;  1IBL C;  2V7B A;  1LCI A;  2MM9 A;  1O92 A;  1XRA A;  3KXW A;  3UOW A;  1XMO C;  1HNZ C;  4DV6 C;  5LMN C;  1MDF A;  4X64 C;  2ZZN A;  2E7G A;  3A9V A;  3J80 D;  1IBM C;  2OPL B;  3RV2 A;  1O93 A;  5IWA C;  2UXC C;  3PES A;  2DYJ A;  4NOZ A;  4RLQ A;  3CQ3 A;  4DV2 C;  2NCL A;  1XNQ C;  4ODJ A;  4BSZ A;  5KEI A;  2DPL A;  2OBV A;  1MXB A;  4JI7 C;  3NPD A;  1MKY A;  5AE1 A;  4X65 C;  4KTV A;  3N2Q A;  1N2F A;  1K0R A;  5BSM A;  5A19 A;  4PRO C;  4K0K C;  4I9G A;  5LCI A;  4L4Q A;  3EER A;  3GR1 A;  5CZV A;  3DLP X;  3K6R A;  1MDB A;  2WD9 A;  1ZB8 A;  2KDN A;  4DG8 A;  4G36 A;  4G37 A;  4DG9 A;  1FJG C;  2BH1 X;  4DR1 C;  3PBK A;  5KYT A;  4OX9 C;  4EAT A;  2D27 A;  1PG4 A;  3A9U A;  2P2J A;  4FUQ A;  3CW9 A;  1MXA A;  3LGX A;  1JOS A;  1USP B;  1P4E C;  1EGA A;  4IZ6 A;  2PN2 A;  4D4G A;  5BST A;  1O90 A;  4RM3 A;  4PUI A;  4AQY C;  3GR0 A;  4DUY C;  4JI5 C;  3B7W A;  2ZZM A;  5BUS A;  2ZTB A;  3LNV A;  2HJG A;  5T8T A;  2M5H A;  4L7I A;  4IR7 A;  2D1R A;  3I07 A;  3IML A;  3N54 B;  4B3R C;  2OO4 A;  2PG1 E;  3T1H C;  1NY8 A;  3IEU A;  1WCJ A;  5BUQ A;  1XS3 A;  2UXD C;  3RG2 A;  1QWI A;  3SO4 A;  1IB8 A;  3GPC A;  3TDE A;  3I08 A;  3R9W A;  1T5H X;  4LFA C;  4RMN A;  2D1S A;  3J81 D;  2E5L C;  4DR6 C;  3LUS A;  4JI4 C;  3IPL A;  4NDN A;  3J7A D;  2CY1 A;  4R0M A;  2KZ0 A;  3ETC A;  1J5E C;  2D28 C;  4LF4 C;  1T5D X;  3AF6 A;  2JNV A;  2P2Q A;  4LF6 C;  2E8E A;  2YWC A;  1NYE A;  4JYA C;  4LF8 C;  4KHP C;  2P2M A;  1QM4 A;  2AYA A;  3G7S A;  1ZB9 A;  1KKG A;  3VNR A;  3R44 A;  4XX2 A;  3TR3 A;  3JAM D;  1I94 C;  4MH4 A;  4D4I A;  2UUB C;  1GPM A;  1PU1 A;  3VNQ A;  2E8F A;  5BSR A;  5H9U A;  4JI6 C;  2PT7 G;  1P7L A;  2BJO A;  4JV5 C;  4D57 A;  4DCV A;  1N32 C;  2CXC A;  3VNS A;  3H2T A;  2ASB A;  1HNW C;  4DV3 C;  1YGT A;  4WV3 A;  4DR7 C;  3UZ0 A;  1HNX C;  3AF5 A;  2ZM6 C;  2YWB A;  2YCB A;  1V25 A;  5ADZ A;  2VZE A;  4B3S C;  2QVX X;  2YX1 A;  5BSU A;  3A25 A;  1RG9 A;  5AE2 A;  4LF9 C;  2VSQ A;  4D56 A;  2VQF C;  3R9X A;  1PG3 A;  4JI0 C;  2Y4O A;  2P20 A;  1VLA A;  2DHM A;  2UXB C;  3CW8 X;  4TPS B;  1FUG A;  4DV1 C;  1N33 C;  2Y4N A;  4GS5 A;  3E7X A;  3E7W A;  4ZLP A;  4DV4 C;  1XRB A;  4JI2 C;  5IT9 D;  4FTF A;  1UWD A;  2EGT A;  4DCU A;  4LF5 C;  1ULT A;  1UKK A;  2KZF A;  4BC9 A;  3PRO C;  4KTT A;  4L2Z A;  4GXR A;  3EQ6 A;  4OYC A;  4OXI A;  2D7V A;  3IEV A;  4PUH A;  5LMU C;  2PRO A;  1AMU A;  4K0B A;  4RVN A;  2ONF A;  1LQL A;  2UUC C;  4PZP A;  4WS9 A;  5GTD A;  4GXQ A;  3FM7 A;  3OTO C;  2ATW A;  2E8C A;  1WF3 A;  2QW0 X;  3CJE A;  3L8C A;  5FLX D;  5IFI A;  4JI3 C;  3O2E A;  4R1M A;  3FCE A;  4ZJZ A;  1P4E A;  5DV9 A;  2Y27 A;  3GKU A;  4DCS A;  2JMP A;  4JI1 C;  2QL8 A;  4BC7 A;  4DCT A;  5E7Q A;  5T8S A;  3T1Y C;  2OPL A;  3TQI A;  4PUG A;  1MD9 A;  4MTN A;  1IBK C;  5AE3 A;  5BSW A;  1N34 C;  4RVO A;  2QVY X;  3FCC A; 
#chains in the Genus database with same CATH homology
 4FUT A;  1PA4 A;  4YHH C;  4HPV A;  4R1L A;  5K85 A;  1BA3 A;  3A4I A;  4DV0 C;  4DR4 C;  5BR8 C;  3C5E A;  2P2B A;  2F4V C;  5CZX A;  2VQE C;  4G1I A;  5BSV A;  2UUA C;  1L2F A;  1XNR C;  4JM1 A;  4X62 C;  2D1T A;  3DAY A;  4X66 C;  1YJ7 A;  3L95 X;  2P2F A;  5JRH A;  1XMQ C;  1HR0 C;  4U5Y D;  4BCA A;  2D1Q A;  4DR2 C;  3LAX A;  4LFB C;  4B3M C;  5A1G A;  5A2Q D;  2QVZ X;  4DV5 C;  3NYQ A;  4BBY A;  1USP A;  3S82 A;  5K8F A;  4DR5 C;  2WP0 C;  5BUR A;  3ETO A;  1O9T A;  4YY3 C;  4LF7 C;  1WH9 A;  3NYR A;  4RM2 A;  4B3T C;  5A1I A;  4DUZ C;  3NI2 A;  4LFC C;  4GKK C;  4DV7 C;  2UU9 C;  2P02 A;  4NXN C;  4NXM C;  1XRC A;  4DR3 C;  1V26 A;  4ISB A;  4RLF A;  4PHT A;  1HH2 P;  4I9F A;  4JI8 C;  1N36 C;  3DHV A;  4GKJ C;  3TUF A;  5KYV A;  2XR1 A;  2HHH C;  2E0G A;  1MXC A;  4LE5 A;  1RY2 A;  1ML8 A;  1IBL C;  2V7B A;  1LCI A;  3UOW A;  1O92 A;  1XRA A;  3KXW A;  1HNZ C;  1XMO C;  4DV6 C;  5LMN C;  1MDF A;  4X64 C;  2E7G A;  3A9V A;  3J80 D;  1IBM C;  2OPL B;  3RV2 A;  1O93 A;  5IWA C;  2UXC C;  3PES A;  2DYJ A;  4NOZ A;  4RLQ A;  4DV2 C;  1XNQ C;  4ODJ A;  4BSZ A;  5KEI A;  2DPL A;  2OBV A;  1MXB A;  4JI7 C;  3NPD A;  1MKY A;  5AE1 A;  4X65 C;  4KTV A;  3N2Q A;  1N2F A;  1K0R A;  5BSM A;  5A19 A;  4PRO C;  4K0K C;  4I9G A;  4L4Q A;  3EER A;  3GR1 A;  5CZV A;  3DLP X;  1MDB A;  2WD9 A;  1ZB8 A;  4DG8 A;  4G36 A;  4G37 A;  4DG9 A;  1FJG C;  2BH1 X;  4DR1 C;  3PBK A;  5KYT A;  4OX9 C;  4EAT A;  2D27 A;  1PG4 A;  3A9U A;  2P2J A;  4FUQ A;  3CW9 A;  1MXA A;  3LGX A;  1JOS A;  1USP B;  1EGA A;  4IZ6 A;  2PN2 A;  4D4G A;  5BST A;  1O90 A;  4RM3 A;  4AQY C;  3GR0 A;  4DUY C;  4JI5 C;  3B7W A;  5BUS A;  3LNV A;  2HJG A;  5T8T A;  4L7I A;  4IR7 A;  2D1R A;  3I07 A;  3IML A;  3N54 B;  4B3R C;  2OO4 A;  3T1H C;  3IEU A;  5BUQ A;  2UXD C;  3RG2 A;  1QWI A;  3SO4 A;  3GPC A;  3TDE A;  3I08 A;  3R9W A;  1T5H X;  4LFA C;  4RMN A;  2D1S A;  3J81 D;  2E5L C;  4DR6 C;  3LUS A;  4JI4 C;  3IPL A;  4NDN A;  3J7A D;  2CY1 A;  4R0M A;  3ETC A;  1J5E C;  2D28 C;  4LF4 C;  1T5D X;  3AF6 A;  2P2Q A;  4LF6 C;  2E8E A;  2YWC A;  1NYE A;  4JYA C;  4LF8 C;  4KHP C;  2P2M A;  1QM4 A;  2AYA A;  3G7S A;  1ZB9 A;  1KKG A;  3VNR A;  3R44 A;  4XX2 A;  3JAM D;  1I94 C;  4MH4 A;  4D4I A;  2UUB C;  1GPM A;  3VNQ A;  2E8F A;  5BSR A;  5H9U A;  4JI6 C;  2PT7 G;  1P7L A;  2BJO A;  4JV5 C;  4D57 A;  4DCV A;  1N32 C;  2CXC A;  3VNS A;  3H2T A;  2ASB A;  1HNW C;  4DV3 C;  4WV3 A;  4DR7 C;  3UZ0 A;  1HNX C;  3AF5 A;  2ZM6 C;  2YWB A;  2YCB A;  1V25 A;  5ADZ A;  2VZE A;  4B3S C;  2QVX X;  5BSU A;  1RG9 A;  5AE2 A;  4LF9 C;  2VSQ A;  4D56 A;  2VQF C;  3R9X A;  1PG3 A;  4JI0 C;  2Y4O A;  2P20 A;  1VLA A;  2UXB C;  3CW8 X;  4TPS B;  1FUG A;  4DV1 C;  1N33 C;  2Y4N A;  4GS5 A;  3E7X A;  3E7W A;  4ZLP A;  4DV4 C;  1XRB A;  4JI2 C;  5IT9 D;  4FTF A;  2EGT A;  4DCU A;  4LF5 C;  1ULT A;  1UKK A;  2KZF A;  4BC9 A;  3PRO C;  4KTT A;  4L2Z A;  4GXR A;  3EQ6 A;  4OYC A;  4OXI A;  2D7V A;  3IEV A;  5LMU C;  2PRO A;  1AMU A;  4K0B A;  4RVN A;  2ONF A;  1LQL A;  2UUC C;  4PZP A;  4WS9 A;  5GTD A;  4GXQ A;  3OTO C;  2ATW A;  2E8C A;  1WF3 A;  2QW0 X;  3CJE A;  3L8C A;  5FLX D;  5IFI A;  4JI3 C;  4R1M A;  3FCE A;  4ZJZ A;  5DV9 A;  2Y27 A;  3GKU A;  4DCS A;  2JMP A;  4JI1 C;  2QL8 A;  4BC7 A;  4DCT A;  5E7Q A;  5T8S A;  3T1Y C;  2OPL A;  3TQI A;  1MD9 A;  4MTN A;  1IBK C;  5AE3 A;  5BSW A;  1N34 C;  4RVO A;  2QVY X;  3FCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...