4LFBC

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lfbC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lfbC02
4JI1C 2ONFA 4YHHC 4LF6C 2HJGA 2UXDC 4DR2C 1XNRC 2D7VA 3IEUA 4DUZC 1XNQC 1JOSA 4DR3C 4XX2A 2E8EA 4JI0C 1IBLC 4LFCC 2UUCC 4LF5C 1HNXC 3IEVA 4DV3C 4DR4C 4JI2C 1KKGA 1NYEA 4DV1C 2HHHC 4JI8C 4MH4A 4JI4C 3T1HC 2YCBA 4DCUA 3R9WA 4DR6C 3J7AD 4KHPC 5IT9D 2BJOA 3AF5A 1K0RA 1USPB 1N32C 2E8FA 3J81D 4LF9C 4X64C 4DUYC 4LF7C 4JV5C 4NOZA 4DR5C 5IWAC 1HNWC 4GKJC 4LFBC 2UXBC 2CY1A 4DCTA 1N2FA 1N33C 1L2FA 1IBKC 2EGTA 4B3RC 1MKYA 4MTNA 4JI7C 1WF3A 4DV7C 4DV2C 2UXCC 3LUSA 4X62C 3EERA 4JI3C 2E8CA 4DR1C 4NXNC 1LQLA 4DCSA 1XMOC 1IBMC 1HNZC 2XR1A 1ZB9A 3CJEA 1J5EC 4DV6C 3J80D 2KZFA 4DV0C 2ZM6C 5A2QD 1HR0C 3R9XA 4LFAC 3AF6A 4X66C 3T1YC 4DR7C 5LMNC 2UUBC 4B3MC 4BSZA 4DV5C 1VLAA 5LMUC 4LF4C 4JI6C 4B3TC 1HH2P 2ASBA 1ML8A 1I94C 4DCVA 2UUAC 3GKUA 2JMPA 1N34C 4GKKC 4K0KC 4NXMC 3I07A 4DV4C 1QWIA 1PA4A 2VQFC 1N36C 4YY3C 4LF8C 1WH9A 2QL8A 2E5LC 2ATWA 2UU9C 1UKKA 2CXCA 2VQEC 2PN2A 4OX9C 5FLXD 4JI5C 4AQYC 2E7GA 2OPLA 2F4VC 2DYJA 1XMQC 3JAMD 4JYAC 2OPLB 4B3SC 1EGAA 3OTOC 4X65C 1ZB8A 2PT7G 1USPA 5BR8C 1FJGC
chains in the Genus database with same CATH superfamily
5K85A 2D1QA 4G37A 1JOSA 2YWCA 2KDNA 5T8SA 2OO4A 5AE2A 1NYEA 3PROC 4PROC 3UZ0A 4DR6C 2WD9A 3E7WA 3R44A 1AMUA 5BSWA 1USPB 4LF9C 4X64C 4DUYC 2D1RA 5A1GA 1ULTA 3NPDA 2CY1A 1N2FA 3GR1A 1P7LA 5BUQA 3K6RA 4DV7C 4IZ6A 4JI3C 1V26A 3IMLA 3FCEA 4D4IA 1HNZC 3C5EA 1ZB9A 2E0GA 3CJEA 2KZFA 5A2QD 1P4EA 3R9XA 3LAXA 4WS9A 5LMNC 1IB8A 4D4GA 4JI6C 4LF4C 1T5DX 1ML8A 1I94C 4DCVA 5BSMA 4RM3A 2YX1A 4ODJA 1QM4A 3UX2A 4BC9A 1MXAA 3TUFA 1PA4A 3H2TA 2VQFC 4LF8C 1VEHA 2UU9C 2PN2A 2E7GA 1PG4A 5AE1A 1XMQC 3VNQA 4PUIA 4K0BA 2VSQA 5BSTA 2OPLB 1FLOA 4B3SC 1EGAA 5AE3A 3OTOC 4ISBA 1USPA 3A9VA 4WV3A 3VNSA 3G7SA 5BR8C 1V60A 2ONFA 2HJGA 2YWBA 1MXBA 2WP0C 2D7VA 1YGTA 2QVZX 2P02A 4OXIA 4PZPA 4XX2A 3TDEA 3TR3A 1IBLC 4LFCC 4ZJZA 4RLQA 1UWDA 4R1LA 1PU1A 4JI8C 5CZXA 3CW9A 3T1HC 3CQ1A 1MD9A 5IT9D 2DHMA 4NDNA 2BJOA 4JM1A 2Z51A 3RG2A 1K0RA 3O2EA 2D1SA 2E8FA 3I08A 4FUTA 3B7WA 3N54B 3VNRA 4LF7C 4R1MA 2M5HA 1WCJA 3EQ6A 2AYAA 4FTFA 1O93A 2NCLA 5E7QA 2EGTA 2Y4OA 4B3RC 5LCIA 2BH1X 1NY8A 1O90A 3EERA 3LUSA 4X62C 2E8CA 3L95X 1IBMC 2XR1A 1J5EC 2CU6A 4I9GA 4DV6C 4HPVA 4D57A 2ZM6C 4DR7C 2UUBC 4B3MC 1MXCA 2P2FA 1LCIA 4RVNA 5LMUC 5BSVA 1O92A 5CZVA 2JMPA 1M6XC 5ADZA 1N34C 4K0KC 4DV4C 1QWIA 3FCCA 2MCQA 1WH9A 3S82A 2ATWA 2VQEC 1XRCA 3CW8X 5FLXD 3A4IA 4OYCA 5BSUA 5BUSA 3FM7A 1ZB8A 2YCBA 2P2BA 1RY2A 4JI1C 3IEUA 5A19A 1M6XA 2UUCC 2D28C 4LF5C 4FUQA 3IEVA 4DR4C 1KKGA 2OBVA 2Y4NA 3NI2A 1PG3A 3LNOA 3PBKA 3R9WA 4KHPC 4DG8A 5IFIA 2P2MA 3PESA 2D27A 1GPMA 3DHVA 3J81D 1O9TA 1V25A 4NOZA 5IWAC 1HNWC 4D56A 4GKJC 2UXBC 4DCTA 4L7IA 1L2FA 1N33C 4BBYA 1IBKC 2M5OA 3CQ2A 3A9UA 4MTNA 4JI7C 2UXCC 2MMAB 4KTTA 3E7XA 4DR1C 1LQLA 3NYRA 3UEBA 4TPSB 2D1TA 3A25A 3ETCA 3AF6A 5BURA 4GS5A 2QVXX 4BCAA 3UOWA 3NYQA 4PHTA 2ASBA 4U5YD 2UUAC 3L8CA 4GXQA 3KXWA 1XRAA 4YY3C 2QL8A 2E5LC 3DLPX 1UKKA 4AQYC 2OPLA 2F4VC 4I9FA 3JAMD 4RM2A 4JYAC 1XDXA 1P4EC 4X65C 3A26A 4EATA 4LF6C 5KYVA 3ETOA 4YHHC 2UXDC 4DR2C 1XNRC 3CQ3A 4DUZC 1XNQC 4DG9A 1BA3A 1MDBA 2PROA 2ZZNA 4DR3C 4G36A 2E8EA 4RLFA 4JI0C 2P2QA 4PUGA 1HNXC 4DV3C 4JI2C 2QW0X 4RVOA 2QVYX 2P20A 3DAYA 4DV1C 2HHHC 4L2ZA 4MH4A 4G1IA 4JI4C 1XS3A 2VZEA 3J7AD 4DCUA 5DV9A 3GR0A 4L4QA 3AF5A 3LNVA 1N32C 4JV5C 4DR5C 2MM9A 4BC7A 4LFBC 4ZLPA 5T8TA 1XHJA 1MKYA 1WF3A 4DV2C 3LGXA 4NXNC 3RV2A 2PG1E 4DCSA 1XMOC 5KEIA 2ZTBA 4RMNA 3J80D 4DV0C 4KTVA 1HR0C 4IR7A 2ZZMA 4LFAC 4X66C 3T1YC 3GPCA 4BSZA 5GTDA 1YJ7A 4DV5C 1VLAA 1XRBA 5BSRA 4R0MA 4B3TC 1HH2P 5JRHA 1MDFA 2KZ0A 4LE5A 1TH5A 3GKUA 2P2JA 4GKKC 4NXMC 3I07A 3UX3A 1FUGA 1N36C 1T5HX 5KYTA 2CXCA 3SO4A 4OX9C 4JI5C 1RG9A 2JNVA 2DYJA 4PUHA 2Y27A 3IPLA 3AY0A 2V7BA 3N2QA 4GXRA 2PT7G 3TQIA 5A1IA 2DPLA 5K8FA 1FJGC 5H9UA
chains in the Genus database with same CATH topology
5K85A 2D1QA 4G37A 1JOSA 2YWCA 5T8SA 2OO4A 5AE2A 1NYEA 3PROC 4PROC 3UZ0A 4DR6C 2WD9A 3E7WA 3R44A 1AMUA 5BSWA 1USPB 4LF9C 4X64C 4DUYC 2D1RA 5A1GA 1ULTA 3NPDA 2CY1A 1N2FA 3GR1A 1P7LA 5BUQA 4DV7C 4IZ6A 4JI3C 1V26A 3IMLA 3FCEA 4D4IA 1HNZC 3C5EA 1ZB9A 2E0GA 3CJEA 2KZFA 5A2QD 3R9XA 3LAXA 4WS9A 5LMNC 4D4GA 4JI6C 4LF4C 1T5DX 1ML8A 1I94C 4DCVA 5BSMA 4RM3A 4ODJA 1QM4A 4BC9A 1MXAA 3TUFA 1PA4A 3H2TA 2VQFC 4LF8C 2UU9C 2PN2A 2E7GA 1PG4A 5AE1A 1XMQC 3VNQA 4K0BA 2VSQA 5BSTA 2OPLB 4B3SC 1EGAA 5AE3A 3OTOC 4ISBA 1USPA 3A9VA 4WV3A 5BR8C 3G7SA 3VNSA 2ONFA 2HJGA 2YWBA 1MXBA 2WP0C 2D7VA 2QVZX 2P02A 4OXIA 4PZPA 4XX2A 3TDEA 1IBLC 4LFCC 4ZJZA 4RLQA 4R1LA 4JI8C 5CZXA 3CW9A 3T1HC 1MD9A 5IT9D 4NDNA 2BJOA 4JM1A 3RG2A 1K0RA 2D1SA 2E8FA 3I08A 4FUTA 3B7WA 3N54B 3VNRA 4LF7C 4R1MA 3EQ6A 2AYAA 4FTFA 1O93A 5E7QA 2EGTA 2Y4OA 4B3RC 2BH1X 1O90A 3LUSA 3EERA 4X62C 2E8CA 3L95X 1IBMC 2XR1A 1J5EC 4I9GA 4DV6C 4HPVA 4D57A 2ZM6C 4DR7C 2UUBC 4B3MC 1MXCA 2P2FA 1LCIA 4RVNA 5LMUC 5BSVA 1O92A 5CZVA 2JMPA 5ADZA 1N34C 4K0KC 4DV4C 1QWIA 3FCCA 1WH9A 3S82A 2ATWA 2VQEC 1XRCA 3CW8X 5FLXD 3A4IA 4OYCA 5BSUA 5BUSA 1ZB8A 2YCBA 2P2BA 1RY2A 4JI1C 3IEUA 5A19A 2UUCC 2D28C 4LF5C 4FUQA 3IEVA 4DR4C 1KKGA 2OBVA 2Y4NA 3NI2A 1PG3A 3PBKA 3R9WA 4KHPC 4DG8A 5IFIA 2P2MA 3PESA 2D27A 1GPMA 3DHVA 3J81D 1O9TA 1V25A 4NOZA 5IWAC 1HNWC 4D56A 4GKJC 2UXBC 4DCTA 4L7IA 1L2FA 1N33C 4BBYA 1IBKC 3A9UA 4MTNA 4JI7C 2UXCC 4KTTA 3E7XA 4DR1C 1LQLA 3NYRA 4TPSB 2D1TA 3ETCA 3AF6A 5BURA 4GS5A 2QVXX 4BCAA 3UOWA 3NYQA 4PHTA 2ASBA 4U5YD 2UUAC 3L8CA 4GXQA 3KXWA 1XRAA 4YY3C 2QL8A 2E5LC 3DLPX 1UKKA 4AQYC 2OPLA 2F4VC 4I9FA 3JAMD 4RM2A 4JYAC 4X65C 4EATA 4LF6C 5KYVA 3ETOA 4YHHC 2UXDC 4DR2C 1XNRC 4DUZC 1XNQC 4DG9A 1BA3A 1MDBA 2PROA 4DR3C 4G36A 2E8EA 4RLFA 4JI0C 2P2QA 1HNXC 4DV3C 4JI2C 2QW0X 4RVOA 2QVYX 2P20A 3DAYA 4DV1C 2HHHC 4L2ZA 4MH4A 4G1IA 4JI4C 2VZEA 3J7AD 4DCUA 5DV9A 3GR0A 4L4QA 3AF5A 3LNVA 1N32C 4JV5C 4DR5C 4BC7A 4LFBC 4ZLPA 5T8TA 1MKYA 1WF3A 4DV2C 3LGXA 4NXNC 3RV2A 4DCSA 1XMOC 5KEIA 4RMNA 3J80D 4DV0C 4KTVA 1HR0C 4IR7A 4LFAC 4X66C 3T1YC 3GPCA 4BSZA 5GTDA 1YJ7A 4DV5C 1VLAA 1XRBA 5BSRA 4R0MA 4B3TC 1HH2P 5JRHA 1MDFA 4LE5A 3GKUA 2P2JA 4GKKC 4NXMC 3I07A 1FUGA 1N36C 1T5HX 5KYTA 2CXCA 3SO4A 4OX9C 4JI5C 1RG9A 2DYJA 2Y27A 3IPLA 2V7BA 3N2QA 4GXRA 2PT7G 3TQIA 5A1IA 2DPLA 5K8FA 1FJGC 5H9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 C;  2ONF A;  4YHH C;  4LF6 C;  2HJG A;  2UXD C;  4DR2 C;  1XNR C;  2D7V A;  3IEU A;  4DUZ C;  1XNQ C;  1JOS A;  4DR3 C;  4XX2 A;  2E8E A;  4JI0 C;  1IBL C;  4LFC C;  2UUC C;  4LF5 C;  1HNX C;  3IEV A;  4DV3 C;  4DR4 C;  4JI2 C;  1KKG A;  1NYE A;  4DV1 C;  2HHH C;  4JI8 C;  4MH4 A;  4JI4 C;  3T1H C;  2YCB A;  4DCU A;  3R9W A;  4DR6 C;  3J7A D;  4KHP C;  5IT9 D;  2BJO A;  3AF5 A;  1K0R A;  1USP B;  1N32 C;  2E8F A;  3J81 D;  4LF9 C;  4X64 C;  4DUY C;  4LF7 C;  4JV5 C;  4NOZ A;  4DR5 C;  5IWA C;  1HNW C;  4GKJ C;  4LFB C;  2UXB C;  2CY1 A;  4DCT A;  1N2F A;  1N33 C;  1L2F A;  1IBK C;  2EGT A;  4B3R C;  1MKY A;  4MTN A;  4JI7 C;  1WF3 A;  4DV7 C;  4DV2 C;  2UXC C;  3LUS A;  4X62 C;  3EER A;  4JI3 C;  2E8C A;  4DR1 C;  4NXN C;  1LQL A;  4DCS A;  1XMO C;  1IBM C;  1HNZ C;  2XR1 A;  1ZB9 A;  3CJE A;  1J5E C;  4DV6 C;  3J80 D;  2KZF A;  4DV0 C;  2ZM6 C;  5A2Q D;  1HR0 C;  3R9X A;  4LFA C;  3AF6 A;  4X66 C;  3T1Y C;  4DR7 C;  5LMN C;  2UUB C;  4B3M C;  4BSZ A;  4DV5 C;  1VLA A;  5LMU C;  4LF4 C;  4JI6 C;  4B3T C;  1HH2 P;  2ASB A;  1ML8 A;  1I94 C;  4DCV A;  2UUA C;  3GKU A;  2JMP A;  1N34 C;  4GKK C;  4K0K C;  4NXM C;  3I07 A;  4DV4 C;  1QWI A;  1PA4 A;  2VQF C;  1N36 C;  4YY3 C;  4LF8 C;  1WH9 A;  2QL8 A;  2E5L C;  2ATW A;  2UU9 C;  1UKK A;  2CXC A;  2VQE C;  2PN2 A;  4OX9 C;  5FLX D;  4JI5 C;  4AQY C;  2E7G A;  2OPL A;  2F4V C;  2DYJ A;  1XMQ C;  3JAM D;  4JYA C;  2OPL B;  4B3S C;  1EGA A;  3OTO C;  4X65 C;  1ZB8 A;  2PT7 G;  1USP A;  5BR8 C;  1FJG C; 
#chains in the Genus database with same CATH topology
 5K85 A;  2D1Q A;  4G37 A;  1JOS A;  2YWC A;  2KDN A;  5T8S A;  2OO4 A;  5AE2 A;  1NYE A;  3PRO C;  4PRO C;  3UZ0 A;  4DR6 C;  2WD9 A;  3E7W A;  3R44 A;  1AMU A;  5BSW A;  1USP B;  4LF9 C;  4X64 C;  4DUY C;  2D1R A;  5A1G A;  1ULT A;  3NPD A;  2CY1 A;  1N2F A;  3GR1 A;  1P7L A;  5BUQ A;  3K6R A;  4DV7 C;  4IZ6 A;  4JI3 C;  1V26 A;  3IML A;  3FCE A;  4D4I A;  1HNZ C;  3C5E A;  1ZB9 A;  2E0G A;  3CJE A;  2KZF A;  5A2Q D;  1P4E A;  3R9X A;  3LAX A;  4WS9 A;  5LMN C;  1IB8 A;  4D4G A;  4JI6 C;  4LF4 C;  1T5D X;  1ML8 A;  1I94 C;  4DCV A;  5BSM A;  4RM3 A;  2YX1 A;  4ODJ A;  1QM4 A;  3UX2 A;  4BC9 A;  1MXA A;  3TUF A;  1PA4 A;  3H2T A;  2VQF C;  4LF8 C;  1VEH A;  2UU9 C;  2PN2 A;  2E7G A;  1PG4 A;  5AE1 A;  1XMQ C;  3VNQ A;  4PUI A;  4K0B A;  2VSQ A;  5BST A;  2OPL B;  1FLO A;  4B3S C;  1EGA A;  5AE3 A;  3OTO C;  4ISB A;  1USP A;  3A9V A;  4WV3 A;  3VNS A;  3G7S A;  5BR8 C;  1V60 A;  2ONF A;  2HJG A;  2YWB A;  1MXB A;  2WP0 C;  2D7V A;  1YGT A;  2QVZ X;  2P02 A;  4OXI A;  4PZP A;  4XX2 A;  3TDE A;  3TR3 A;  1IBL C;  4LFC C;  4ZJZ A;  4RLQ A;  1UWD A;  4R1L A;  1PU1 A;  4JI8 C;  5CZX A;  3CW9 A;  3T1H C;  3CQ1 A;  1MD9 A;  5IT9 D;  2DHM A;  4NDN A;  2BJO A;  4JM1 A;  2Z51 A;  3RG2 A;  1K0R A;  3O2E A;  2D1S A;  2E8F A;  3I08 A;  4FUT A;  3B7W A;  3N54 B;  3VNR A;  4LF7 C;  4R1M A;  2M5H A;  1WCJ A;  3EQ6 A;  2AYA A;  4FTF A;  1O93 A;  2NCL A;  5E7Q A;  2EGT A;  2Y4O A;  4B3R C;  5LCI A;  2BH1 X;  1NY8 A;  1O90 A;  3EER A;  3LUS A;  4X62 C;  2E8C A;  3L95 X;  1IBM C;  2XR1 A;  1J5E C;  2CU6 A;  4I9G A;  4DV6 C;  4HPV A;  4D57 A;  2ZM6 C;  4DR7 C;  2UUB C;  4B3M C;  1MXC A;  2P2F A;  1LCI A;  4RVN A;  5LMU C;  5BSV A;  1O92 A;  5CZV A;  2JMP A;  1M6X C;  5ADZ A;  1N34 C;  4K0K C;  4DV4 C;  1QWI A;  3FCC A;  2MCQ A;  1WH9 A;  3S82 A;  2ATW A;  2VQE C;  1XRC A;  3CW8 X;  5FLX D;  3A4I A;  4OYC A;  5BSU A;  5BUS A;  3FM7 A;  1ZB8 A;  2YCB A;  2P2B A;  1RY2 A;  4JI1 C;  3IEU A;  5A19 A;  1M6X A;  2UUC C;  2D28 C;  4LF5 C;  4FUQ A;  3IEV A;  4DR4 C;  1KKG A;  2OBV A;  2Y4N A;  3NI2 A;  1PG3 A;  3LNO A;  3PBK A;  3R9W A;  4KHP C;  4DG8 A;  5IFI A;  2P2M A;  3PES A;  2D27 A;  1GPM A;  3DHV A;  3J81 D;  1O9T A;  1V25 A;  4NOZ A;  5IWA C;  1HNW C;  4D56 A;  4GKJ C;  2UXB C;  4DCT A;  4L7I A;  1L2F A;  1N33 C;  4BBY A;  1IBK C;  2M5O A;  3CQ2 A;  3A9U A;  4MTN A;  4JI7 C;  2UXC C;  2MMA B;  4KTT A;  3E7X A;  4DR1 C;  1LQL A;  3NYR A;  3UEB A;  4TPS B;  2D1T A;  3A25 A;  3ETC A;  3AF6 A;  5BUR A;  4GS5 A;  2QVX X;  4BCA A;  3UOW A;  3NYQ A;  4PHT A;  2ASB A;  4U5Y D;  2UUA C;  3L8C A;  4GXQ A;  3KXW A;  1XRA A;  4YY3 C;  2QL8 A;  2E5L C;  3DLP X;  1UKK A;  4AQY C;  2OPL A;  2F4V C;  4I9F A;  3JAM D;  4RM2 A;  4JYA C;  1XDX A;  1P4E C;  4X65 C;  3A26 A;  4EAT A;  4LF6 C;  5KYV A;  3ETO A;  4YHH C;  2UXD C;  4DR2 C;  1XNR C;  3CQ3 A;  4DUZ C;  1XNQ C;  4DG9 A;  1BA3 A;  1MDB A;  2PRO A;  2ZZN A;  4DR3 C;  4G36 A;  2E8E A;  4RLF A;  4JI0 C;  2P2Q A;  4PUG A;  1HNX C;  4DV3 C;  4JI2 C;  2QW0 X;  4RVO A;  2QVY X;  2P20 A;  3DAY A;  4DV1 C;  2HHH C;  4L2Z A;  4MH4 A;  4G1I A;  4JI4 C;  1XS3 A;  2VZE A;  3J7A D;  4DCU A;  5DV9 A;  3GR0 A;  4L4Q A;  3AF5 A;  3LNV A;  1N32 C;  4JV5 C;  4DR5 C;  2MM9 A;  4BC7 A;  4LFB C;  4ZLP A;  5T8T A;  1XHJ A;  1MKY A;  1WF3 A;  4DV2 C;  3LGX A;  4NXN C;  3RV2 A;  2PG1 E;  4DCS A;  1XMO C;  5KEI A;  2ZTB A;  4RMN A;  3J80 D;  4DV0 C;  4KTV A;  1HR0 C;  4IR7 A;  2ZZM A;  4LFA C;  4X66 C;  3T1Y C;  3GPC A;  4BSZ A;  5GTD A;  1YJ7 A;  4DV5 C;  1VLA A;  1XRB A;  5BSR A;  4R0M A;  4B3T C;  1HH2 P;  5JRH A;  1MDF A;  2KZ0 A;  4LE5 A;  1TH5 A;  3GKU A;  2P2J A;  4GKK C;  4NXM C;  3I07 A;  3UX3 A;  1FUG A;  1N36 C;  1T5H X;  5KYT A;  2CXC A;  3SO4 A;  4OX9 C;  4JI5 C;  1RG9 A;  2JNV A;  2DYJ A;  4PUH A;  2Y27 A;  3IPL A;  3AY0 A;  2V7B A;  3N2Q A;  4GXR A;  2PT7 G;  3TQI A;  5A1I A;  2DPL A;  5K8F A;  1FJG C;  5H9U A; 
#chains in the Genus database with same CATH homology
 5K85 A;  2D1Q A;  4G37 A;  1JOS A;  2YWC A;  5T8S A;  2OO4 A;  5AE2 A;  1NYE A;  3PRO C;  4PRO C;  3UZ0 A;  4DR6 C;  2WD9 A;  3E7W A;  3R44 A;  1AMU A;  5BSW A;  1USP B;  4LF9 C;  4X64 C;  4DUY C;  2D1R A;  5A1G A;  1ULT A;  3NPD A;  2CY1 A;  1N2F A;  3GR1 A;  1P7L A;  5BUQ A;  4DV7 C;  4IZ6 A;  4JI3 C;  1V26 A;  3IML A;  3FCE A;  4D4I A;  1HNZ C;  3C5E A;  1ZB9 A;  2E0G A;  3CJE A;  2KZF A;  5A2Q D;  3R9X A;  3LAX A;  4WS9 A;  5LMN C;  4D4G A;  4JI6 C;  4LF4 C;  1T5D X;  1ML8 A;  1I94 C;  4DCV A;  5BSM A;  4RM3 A;  4ODJ A;  1QM4 A;  4BC9 A;  1MXA A;  3TUF A;  1PA4 A;  3H2T A;  2VQF C;  4LF8 C;  2UU9 C;  2PN2 A;  2E7G A;  1PG4 A;  5AE1 A;  1XMQ C;  3VNQ A;  4K0B A;  2VSQ A;  5BST A;  2OPL B;  4B3S C;  1EGA A;  5AE3 A;  3OTO C;  4ISB A;  1USP A;  3A9V A;  4WV3 A;  5BR8 C;  3G7S A;  3VNS A;  2ONF A;  2HJG A;  2YWB A;  1MXB A;  2WP0 C;  2D7V A;  2QVZ X;  2P02 A;  4OXI A;  4PZP A;  4XX2 A;  3TDE A;  1IBL C;  4LFC C;  4ZJZ A;  4RLQ A;  4R1L A;  4JI8 C;  5CZX A;  3CW9 A;  3T1H C;  1MD9 A;  5IT9 D;  4NDN A;  2BJO A;  4JM1 A;  3RG2 A;  1K0R A;  2D1S A;  2E8F A;  3I08 A;  4FUT A;  3B7W A;  3N54 B;  3VNR A;  4LF7 C;  4R1M A;  3EQ6 A;  2AYA A;  4FTF A;  1O93 A;  5E7Q A;  2EGT A;  2Y4O A;  4B3R C;  2BH1 X;  1O90 A;  3LUS A;  3EER A;  4X62 C;  2E8C A;  3L95 X;  1IBM C;  2XR1 A;  1J5E C;  4I9G A;  4DV6 C;  4HPV A;  4D57 A;  2ZM6 C;  4DR7 C;  2UUB C;  4B3M C;  1MXC A;  2P2F A;  1LCI A;  4RVN A;  5LMU C;  5BSV A;  1O92 A;  5CZV A;  2JMP A;  5ADZ A;  1N34 C;  4K0K C;  4DV4 C;  1QWI A;  3FCC A;  1WH9 A;  3S82 A;  2ATW A;  2VQE C;  1XRC A;  3CW8 X;  5FLX D;  3A4I A;  4OYC A;  5BSU A;  5BUS A;  1ZB8 A;  2YCB A;  2P2B A;  1RY2 A;  4JI1 C;  3IEU A;  5A19 A;  2UUC C;  2D28 C;  4LF5 C;  4FUQ A;  3IEV A;  4DR4 C;  1KKG A;  2OBV A;  2Y4N A;  3NI2 A;  1PG3 A;  3PBK A;  3R9W A;  4KHP C;  4DG8 A;  5IFI A;  2P2M A;  3PES A;  2D27 A;  1GPM A;  3DHV A;  3J81 D;  1O9T A;  1V25 A;  4NOZ A;  5IWA C;  1HNW C;  4D56 A;  4GKJ C;  2UXB C;  4DCT A;  4L7I A;  1L2F A;  1N33 C;  4BBY A;  1IBK C;  3A9U A;  4MTN A;  4JI7 C;  2UXC C;  4KTT A;  3E7X A;  4DR1 C;  1LQL A;  3NYR A;  4TPS B;  2D1T A;  3ETC A;  3AF6 A;  5BUR A;  4GS5 A;  2QVX X;  4BCA A;  3UOW A;  3NYQ A;  4PHT A;  2ASB A;  4U5Y D;  2UUA C;  3L8C A;  4GXQ A;  3KXW A;  1XRA A;  4YY3 C;  2QL8 A;  2E5L C;  3DLP X;  1UKK A;  4AQY C;  2OPL A;  2F4V C;  4I9F A;  3JAM D;  4RM2 A;  4JYA C;  4X65 C;  4EAT A;  4LF6 C;  5KYV A;  3ETO A;  4YHH C;  2UXD C;  4DR2 C;  1XNR C;  4DUZ C;  1XNQ C;  4DG9 A;  1BA3 A;  1MDB A;  2PRO A;  4DR3 C;  4G36 A;  2E8E A;  4RLF A;  4JI0 C;  2P2Q A;  1HNX C;  4DV3 C;  4JI2 C;  2QW0 X;  4RVO A;  2QVY X;  2P20 A;  3DAY A;  4DV1 C;  2HHH C;  4L2Z A;  4MH4 A;  4G1I A;  4JI4 C;  2VZE A;  3J7A D;  4DCU A;  5DV9 A;  3GR0 A;  4L4Q A;  3AF5 A;  3LNV A;  1N32 C;  4JV5 C;  4DR5 C;  4BC7 A;  4LFB C;  4ZLP A;  5T8T A;  1MKY A;  1WF3 A;  4DV2 C;  3LGX A;  4NXN C;  3RV2 A;  4DCS A;  1XMO C;  5KEI A;  4RMN A;  3J80 D;  4DV0 C;  4KTV A;  1HR0 C;  4IR7 A;  4LFA C;  4X66 C;  3T1Y C;  3GPC A;  4BSZ A;  5GTD A;  1YJ7 A;  4DV5 C;  1VLA A;  1XRB A;  5BSR A;  4R0M A;  4B3T C;  1HH2 P;  5JRH A;  1MDF A;  4LE5 A;  3GKU A;  2P2J A;  4GKK C;  4NXM C;  3I07 A;  1FUG A;  1N36 C;  1T5H X;  5KYT A;  2CXC A;  3SO4 A;  4OX9 C;  4JI5 C;  1RG9 A;  2DYJ A;  2Y27 A;  3IPL A;  2V7B A;  3N2Q A;  4GXR A;  2PT7 G;  3TQI A;  5A1I A;  2DPL A;  5K8F A;  1FJG C;  5H9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...