4LFBC

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lfbC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lfbC02
2UUAC 5A2QD 2F4VC 4GKJC 1JOSA 4JI6C 1J5EC 3AF5A 1XNRC 2XR1A 3IEUA 4JI8C 1FJGC 3I07A 4DV6C 4LF7C 1MKYA 1N2FA 1IBLC 3T1YC 5IWAC 4K0KC 2BJOA 4DV2C 3LUSA 2JMPA 2E7GA 4X62C 1WF3A 4B3MC 4DV1C 1HH2P 2PN2A 3J80D 5FLXD 4DCTA 4B3RC 5IT9D 4LF5C 2HJGA 4DV7C 4DUYC 3T1HC 2UUBC 1N32C 2DYJA 4DCUA 3JAMD 3J81D 1HR0C 4DV5C 4DV3C 4BSZA 2E8CA 2QL8A 1HNXC 4LFAC 3IEVA 1K0RA 1XMQC 1HNWC 1N33C 1LQLA 4XX2A 1HNZC 1EGAA 3OTOC 1IBMC 4LF6C 1VLAA 2UXBC 5BR8C 1IBKC 4JI0C 4JI5C 1USPB 4NOZA 2E8FA 2CY1A 4DR3C 4X65C 4LFBC 4JV5C 4DR4C 3R9WA 5LMUC 2E5LC 2EGTA 4DR7C 1ZB9A 1XMOC 4JYAC 2YCBA 4MTNA 4JI4C 4OX9C 3J7AD 4MH4A 4LFCC 1ZB8A 2KZFA 4NXMC 4DV0C 4LF9C 4JI7C 4X66C 2OPLB 4JI1C 2CXCA 4YHHC 3EERA 4LF8C 2PT7G 2UXCC 4DR5C 2ZM6C 4LF4C 4AQYC 2D7VA 2HHHC 4JI2C 2ASBA 2ONFA 4GKKC 4KHPC 4DR1C 4YY3C 2ATWA 4X64C 2UU9C 1USPA 5LMNC 4DUZC 2VQEC 4B3TC 1N36C 3GKUA 2VQFC 3AF6A 1XNQC 2UUCC 4DR6C 4JI3C 2E8EA 1PA4A 1UKKA 1I94C 2UXDC 1L2FA 4DCSA 4DCVA 1KKGA 3CJEA 4DR2C 1QWIA 1N34C 4DV4C 2OPLA 1NYEA 4NXNC 1WH9A 4B3SC 3R9XA 1ML8A
chains in the Genus database with same CATH superfamily
2Y4OA 5A2QD 1WCJA 2F4VC 1JOSA 1BA3A 3A9UA 4JI6C 1XNRC 2XR1A 3IEUA 4K0BA 5E7QA 3LGXA 2P2JA 4R1LA 5JRHA 4GXRA 1MKYA 1RY2A 1IBLC 1MDFA 3GR0A 5IWAC 3CW9A 2JMPA 4X62C 5DV9A 5FLXD 4B3RC 4RMNA 1MDBA 4LF5C 2HJGA 3T1HC 4PZPA 3J81D 2D1QA 1HNXC 2NCLA 3VNQA 4FTFA 1N33C 2P2FA 4XX2A 2ZTBA 1EGAA 1NY8A 3OTOC 4LF6C 5GTDA 2E0GA 5BR8C 3CW8X 2DHMA 2VZEA 4X65C 4DR4C 4I9FA 3PESA 4WS9A 2P2MA 4JYAC 2AYAA 4MH4A 3IMLA 4NXMC 3VNRA 4JI7C 2OPLB 2KZ0A 3R44A 4RM3A 2D1RA 4LE5A 1GPMA 4JI2C 3E7WA 2JNVA 5K85A 4GKKC 1USPA 1PG4A 2VQFC 4DR6C 4GXQA 1O93A 4I9GA 4ISBA 1XHJA 1N34C 3PBKA 3A9VA 4TPSB 4NXNC 3FM7A 2P20A 2Z51A 3G7SA 4HPVA 3AF5A 5CZVA 1FJGC 3LNVA 4LF7C 3FCCA 2V7BA 1IB8A 4KTTA 3KXWA 1HH2P 3J80D 1O92A 5IT9D 4DV7C 2UUBC 2DYJA 1V26A 3JAMD 1HR0C 4DV5C 2QL8A 3IEVA 5CZXA 3UZ0A 3GPCA 3ETCA 1LQLA 3IPLA 4PROC 5BSWA 1VLAA 2UXBC 4ZJZA 1T5HX 4JI5C 3TDEA 1YJ7A 1USPB 2E8FA 2CY1A 2VSQA 1TH5A 1FLOA 1AMUA 2YWBA 4G36A 5LMUC 3CQ2A 2E5LC 2QW0X 3UEBA 5T8SA 3H2TA 1XS3A 3TQIA 2YCBA 3J7AD 4LFCC 4RVNA 2KZFA 4L7IA 4DV0C 5IFIA 2Y27A 4LF8C 3TUFA 4RLFA 4EATA 2UXCC 4DR5C 5AE2A 2ZM6C 2BH1X 2D1SA 2UU9C 4DUZC 2D27A 1N36C 4BC9A 1XNQC 1P4EA 3NYRA 1PA4A 2UXDC 4DCSA 4DCVA 4GS5A 4U5YD 4DR2C 1QM4A 2WD9A 3UX2A 3L8CA 1V25A 4D57A 3R9XA 2UUAC 2OO4A 4GKJC 2PROA 3N2QA 4PHTA 4PUGA 4L2ZA 2M5HA 1MXBA 4IZ6A 4JI8C 2ZZMA 2D28C 1MXAA 3E7XA 4L4QA 2P2BA 1N2FA 3EQ6A 2WP0C 2BJOA 4DV2C 3O2EA 3LUSA 2MMAB 4B3MC 1WF3A 1VEHA 2P02A 3TR3A 4DUYC 4DCUA 1XRAA 1XRCA 2QVYX 2YX1A 4IR7A 5KEIA 2OBVA 4DV3C 3UOWA 5ADZA 3NYQA 1P7LA 1PG3A 4LFAC 1HNWC 3FCEA 3L95X 4DG9A 1HNZC 1IBKC 4NOZA 1XDXA 4RLQA 4JV5C 3UX3A 3SO4A 2M5OA 4DR7C 1LCIA 1ZB9A 3B7WA 3DAYA 1PU1A 5A19A 4LF9C 1M6XA 1YGTA 2ZZNA 4YHHC 3EERA 4DG8A 3LAXA 3LNOA 4R0MA 4LF4C 2D7VA 2HHHC 2ONFA 4KHPC 1T5DX 4DR1C 4YY3C 2ATWA 3PROC 5LMNC 3N54B 1P4EC 4KTVA 4FUQA 4B3TC 3GKUA 2QVZX 2PG1E 3AF6A 4JI3C 2E8EA 3S82A 1UKKA 5BUQA 1I94C 2QVXX 4BC7A 3CJEA 1QWIA 4RM2A 2KDNA 5BSUA 1WH9A 4ODJA 2MM9A 4D56A 2YWCA 1ML8A 5AE3A 1FUGA 2MCQA 3A4IA 5BSMA 1J5EC 4PUHA 3I07A 4DV6C 3CQ3A 4G37A 3K6RA 4NDNA 3T1YC 5H9UA 4K0KC 5A1IA 3CQ1A 4RVOA 2E7GA 4WV3A 4DV1C 2PN2A 5K8FA 4DCTA 3RG2A 1O90A 3C5EA 1N32C 4PUIA 4BCAA 5BSRA 3DHVA 4D4GA 2Y4NA 1O9TA 4BSZA 1MXCA 2E8CA 3DLPX 1K0RA 1XMQC 4JM1A 4ZLPA 5BSVA 1IBMC 3I08A 3NPDA 4JI0C 5A1GA 5BURA 3GR1A 4DR3C 4OYCA 4LFBC 3VNSA 2P2QA 3R9WA 2EGTA 5KYVA 2CU6A 1XMOC 4MTNA 4JI4C 1M6XC 4OX9C 1ZB8A 3AY0A 1ULTA 4X66C 1RG9A 4JI1C 3A26A 5BSTA 2CXCA 5BUSA 2PT7G 4AQYC 2ASBA 4G1IA 5KYTA 4X64C 1XRBA 3ETOA 2VQEC 2D1TA 3NI2A 4OXIA 1UWDA 2DPLA 2UUCC 3RV2A 4D4IA 1L2FA 5LCIA 5T8TA 4R1MA 1KKGA 3A25A 4DV4C 2OPLA 1V60A 1NYEA 4FUTA 4B3SC 5AE1A 1MD9A 4BBYA
chains in the Genus database with same CATH topology
2Y4OA 5A2QD 2F4VC 1JOSA 1BA3A 3A9UA 4JI6C 1XNRC 2XR1A 3IEUA 4K0BA 5E7QA 3LGXA 2P2JA 4R1LA 5JRHA 4GXRA 1MKYA 1RY2A 1IBLC 1MDFA 3GR0A 5IWAC 3CW9A 2JMPA 4X62C 5DV9A 5FLXD 4B3RC 4RMNA 1MDBA 4LF5C 2HJGA 3T1HC 4PZPA 3J81D 2D1QA 1HNXC 3VNQA 4FTFA 1N33C 2P2FA 4XX2A 1EGAA 3OTOC 4LF6C 5GTDA 2E0GA 5BR8C 3CW8X 2VZEA 4X65C 4DR4C 4I9FA 3PESA 4WS9A 2P2MA 4JYAC 2AYAA 4MH4A 3IMLA 4NXMC 3VNRA 4JI7C 2OPLB 3R44A 4RM3A 2D1RA 4LE5A 1GPMA 4JI2C 3E7WA 5K85A 4GKKC 1USPA 1PG4A 2VQFC 4DR6C 4GXQA 1O93A 4I9GA 4ISBA 1N34C 3PBKA 3A9VA 4TPSB 4NXNC 2P20A 3G7SA 4HPVA 3AF5A 5CZVA 1FJGC 3LNVA 4LF7C 3FCCA 2V7BA 4KTTA 3KXWA 1HH2P 3J80D 1O92A 5IT9D 4DV7C 2UUBC 2DYJA 1V26A 3JAMD 1HR0C 4DV5C 2QL8A 3IEVA 5CZXA 3UZ0A 3GPCA 3ETCA 1LQLA 3IPLA 4PROC 5BSWA 1VLAA 2UXBC 4ZJZA 1T5HX 4JI5C 3TDEA 1YJ7A 1USPB 2E8FA 2CY1A 2VSQA 1AMUA 2YWBA 4G36A 5LMUC 2E5LC 2QW0X 5T8SA 3H2TA 3TQIA 2YCBA 3J7AD 4LFCC 4RVNA 2KZFA 4L7IA 4DV0C 5IFIA 2Y27A 4LF8C 3TUFA 4RLFA 4EATA 2UXCC 4DR5C 5AE2A 2ZM6C 2BH1X 2D1SA 2UU9C 4DUZC 2D27A 1N36C 4BC9A 1XNQC 3NYRA 1PA4A 2UXDC 4DCSA 4DCVA 4GS5A 4U5YD 4DR2C 1QM4A 2WD9A 3L8CA 1V25A 4D57A 3R9XA 2UUAC 2OO4A 4GKJC 2PROA 3N2QA 4PHTA 4L2ZA 1MXBA 4IZ6A 4JI8C 2D28C 1MXAA 3E7XA 4L4QA 2P2BA 1N2FA 3EQ6A 2WP0C 2BJOA 4DV2C 3LUSA 4B3MC 1WF3A 2P02A 4DUYC 4DCUA 1XRAA 1XRCA 2QVYX 4IR7A 5KEIA 2OBVA 4DV3C 3UOWA 5ADZA 3NYQA 1P7LA 1PG3A 4LFAC 1HNWC 3FCEA 3L95X 4DG9A 1HNZC 1IBKC 4NOZA 4RLQA 4JV5C 3SO4A 4DR7C 1LCIA 1ZB9A 3B7WA 3DAYA 5A19A 4LF9C 4YHHC 3EERA 4DG8A 3LAXA 4R0MA 4LF4C 2D7VA 2HHHC 2ONFA 4KHPC 1T5DX 4DR1C 4YY3C 2ATWA 3PROC 5LMNC 3N54B 4B3TC 4KTVA 4FUQA 3GKUA 2QVZX 3AF6A 4JI3C 2E8EA 3S82A 1UKKA 5BUQA 1I94C 2QVXX 4BC7A 3CJEA 1QWIA 4RM2A 5BSUA 1WH9A 4ODJA 4D56A 2YWCA 1ML8A 5AE3A 1FUGA 3A4IA 5BSMA 1J5EC 3I07A 4DV6C 4G37A 4NDNA 3T1YC 5H9UA 4K0KC 5A1IA 4RVOA 2E7GA 4WV3A 4DV1C 2PN2A 5K8FA 4DCTA 3RG2A 1O90A 3C5EA 1N32C 4BCAA 5BSRA 3DHVA 4D4GA 2Y4NA 1O9TA 4BSZA 1MXCA 2E8CA 3DLPX 1K0RA 1XMQC 4JM1A 4ZLPA 5BSVA 1IBMC 3I08A 3NPDA 4JI0C 5A1GA 5BURA 3GR1A 4DR3C 4OYCA 4LFBC 3VNSA 2P2QA 3R9WA 2EGTA 5KYVA 1XMOC 4MTNA 4JI4C 4OX9C 1ZB8A 1ULTA 4X66C 1RG9A 4JI1C 5BSTA 2CXCA 5BUSA 2PT7G 4AQYC 2ASBA 4G1IA 5KYTA 4X64C 1XRBA 3ETOA 2VQEC 2D1TA 3NI2A 4OXIA 2DPLA 2UUCC 3RV2A 4D4IA 1L2FA 5T8TA 4R1MA 1KKGA 4DV4C 2OPLA 1NYEA 4FUTA 4B3SC 5AE1A 1MD9A 4BBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA C;  5A2Q D;  2F4V C;  4GKJ C;  1JOS A;  4JI6 C;  1J5E C;  3AF5 A;  1XNR C;  2XR1 A;  3IEU A;  4JI8 C;  1FJG C;  3I07 A;  4DV6 C;  4LF7 C;  1MKY A;  1N2F A;  1IBL C;  3T1Y C;  5IWA C;  4K0K C;  2BJO A;  4DV2 C;  3LUS A;  2JMP A;  2E7G A;  4X62 C;  1WF3 A;  4B3M C;  4DV1 C;  1HH2 P;  2PN2 A;  3J80 D;  5FLX D;  4DCT A;  4B3R C;  5IT9 D;  4LF5 C;  2HJG A;  4DV7 C;  4DUY C;  3T1H C;  2UUB C;  1N32 C;  2DYJ A;  4DCU A;  3JAM D;  3J81 D;  1HR0 C;  4DV5 C;  4DV3 C;  4BSZ A;  2E8C A;  2QL8 A;  1HNX C;  4LFA C;  3IEV A;  1K0R A;  1XMQ C;  1HNW C;  1N33 C;  1LQL A;  4XX2 A;  1HNZ C;  1EGA A;  3OTO C;  1IBM C;  4LF6 C;  1VLA A;  2UXB C;  5BR8 C;  1IBK C;  4JI0 C;  4JI5 C;  1USP B;  4NOZ A;  2E8F A;  2CY1 A;  4DR3 C;  4X65 C;  4LFB C;  4JV5 C;  4DR4 C;  3R9W A;  5LMU C;  2E5L C;  2EGT A;  4DR7 C;  1ZB9 A;  1XMO C;  4JYA C;  2YCB A;  4MTN A;  4JI4 C;  4OX9 C;  3J7A D;  4MH4 A;  4LFC C;  1ZB8 A;  2KZF A;  4NXM C;  4DV0 C;  4LF9 C;  4JI7 C;  4X66 C;  2OPL B;  4JI1 C;  2CXC A;  4YHH C;  3EER A;  4LF8 C;  2PT7 G;  2UXC C;  4DR5 C;  2ZM6 C;  4LF4 C;  4AQY C;  2D7V A;  2HHH C;  4JI2 C;  2ASB A;  2ONF A;  4GKK C;  4KHP C;  4DR1 C;  4YY3 C;  2ATW A;  4X64 C;  2UU9 C;  1USP A;  5LMN C;  4DUZ C;  2VQE C;  4B3T C;  1N36 C;  3GKU A;  2VQF C;  3AF6 A;  1XNQ C;  2UUC C;  4DR6 C;  4JI3 C;  2E8E A;  1PA4 A;  1UKK A;  1I94 C;  2UXD C;  1L2F A;  4DCS A;  4DCV A;  1KKG A;  3CJE A;  4DR2 C;  1QWI A;  1N34 C;  4DV4 C;  2OPL A;  1NYE A;  4NXN C;  1WH9 A;  4B3S C;  3R9X A;  1ML8 A; 
#chains in the Genus database with same CATH topology
 2Y4O A;  5A2Q D;  1WCJ A;  2F4V C;  1JOS A;  1BA3 A;  3A9U A;  4JI6 C;  1XNR C;  2XR1 A;  3IEU A;  4K0B A;  5E7Q A;  3LGX A;  2P2J A;  4R1L A;  5JRH A;  4GXR A;  1MKY A;  1RY2 A;  1IBL C;  1MDF A;  3GR0 A;  5IWA C;  3CW9 A;  2JMP A;  4X62 C;  5DV9 A;  5FLX D;  4B3R C;  4RMN A;  1MDB A;  4LF5 C;  2HJG A;  3T1H C;  4PZP A;  3J81 D;  2D1Q A;  1HNX C;  2NCL A;  3VNQ A;  4FTF A;  1N33 C;  2P2F A;  4XX2 A;  2ZTB A;  1EGA A;  1NY8 A;  3OTO C;  4LF6 C;  5GTD A;  2E0G A;  5BR8 C;  3CW8 X;  2DHM A;  2VZE A;  4X65 C;  4DR4 C;  4I9F A;  3PES A;  4WS9 A;  2P2M A;  4JYA C;  2AYA A;  4MH4 A;  3IML A;  4NXM C;  3VNR A;  4JI7 C;  2OPL B;  2KZ0 A;  3R44 A;  4RM3 A;  2D1R A;  4LE5 A;  1GPM A;  4JI2 C;  3E7W A;  2JNV A;  5K85 A;  4GKK C;  1USP A;  1PG4 A;  2VQF C;  4DR6 C;  4GXQ A;  1O93 A;  4I9G A;  4ISB A;  1XHJ A;  1N34 C;  3PBK A;  3A9V A;  4TPS B;  4NXN C;  3FM7 A;  2P20 A;  2Z51 A;  3G7S A;  4HPV A;  3AF5 A;  5CZV A;  1FJG C;  3LNV A;  4LF7 C;  3FCC A;  2V7B A;  1IB8 A;  4KTT A;  3KXW A;  1HH2 P;  3J80 D;  1O92 A;  5IT9 D;  4DV7 C;  2UUB C;  2DYJ A;  1V26 A;  3JAM D;  1HR0 C;  4DV5 C;  2QL8 A;  3IEV A;  5CZX A;  3UZ0 A;  3GPC A;  3ETC A;  1LQL A;  3IPL A;  4PRO C;  5BSW A;  1VLA A;  2UXB C;  4ZJZ A;  1T5H X;  4JI5 C;  3TDE A;  1YJ7 A;  1USP B;  2E8F A;  2CY1 A;  2VSQ A;  1TH5 A;  1FLO A;  1AMU A;  2YWB A;  4G36 A;  5LMU C;  3CQ2 A;  2E5L C;  2QW0 X;  3UEB A;  5T8S A;  3H2T A;  1XS3 A;  3TQI A;  2YCB A;  3J7A D;  4LFC C;  4RVN A;  2KZF A;  4L7I A;  4DV0 C;  5IFI A;  2Y27 A;  4LF8 C;  3TUF A;  4RLF A;  4EAT A;  2UXC C;  4DR5 C;  5AE2 A;  2ZM6 C;  2BH1 X;  2D1S A;  2UU9 C;  4DUZ C;  2D27 A;  1N36 C;  4BC9 A;  1XNQ C;  1P4E A;  3NYR A;  1PA4 A;  2UXD C;  4DCS A;  4DCV A;  4GS5 A;  4U5Y D;  4DR2 C;  1QM4 A;  2WD9 A;  3UX2 A;  3L8C A;  1V25 A;  4D57 A;  3R9X A;  2UUA C;  2OO4 A;  4GKJ C;  2PRO A;  3N2Q A;  4PHT A;  4PUG A;  4L2Z A;  2M5H A;  1MXB A;  4IZ6 A;  4JI8 C;  2ZZM A;  2D28 C;  1MXA A;  3E7X A;  4L4Q A;  2P2B A;  1N2F A;  3EQ6 A;  2WP0 C;  2BJO A;  4DV2 C;  3O2E A;  3LUS A;  2MMA B;  4B3M C;  1WF3 A;  1VEH A;  2P02 A;  3TR3 A;  4DUY C;  4DCU A;  1XRA A;  1XRC A;  2QVY X;  2YX1 A;  4IR7 A;  5KEI A;  2OBV A;  4DV3 C;  3UOW A;  5ADZ A;  3NYQ A;  1P7L A;  1PG3 A;  4LFA C;  1HNW C;  3FCE A;  3L95 X;  4DG9 A;  1HNZ C;  1IBK C;  4NOZ A;  1XDX A;  4RLQ A;  4JV5 C;  3UX3 A;  3SO4 A;  2M5O A;  4DR7 C;  1LCI A;  1ZB9 A;  3B7W A;  3DAY A;  1PU1 A;  5A19 A;  4LF9 C;  1M6X A;  1YGT A;  2ZZN A;  4YHH C;  3EER A;  4DG8 A;  3LAX A;  3LNO A;  4R0M A;  4LF4 C;  2D7V A;  2HHH C;  2ONF A;  4KHP C;  1T5D X;  4DR1 C;  4YY3 C;  2ATW A;  3PRO C;  5LMN C;  3N54 B;  1P4E C;  4KTV A;  4FUQ A;  4B3T C;  3GKU A;  2QVZ X;  2PG1 E;  3AF6 A;  4JI3 C;  2E8E A;  3S82 A;  1UKK A;  5BUQ A;  1I94 C;  2QVX X;  4BC7 A;  3CJE A;  1QWI A;  4RM2 A;  2KDN A;  5BSU A;  1WH9 A;  4ODJ A;  2MM9 A;  4D56 A;  2YWC A;  1ML8 A;  5AE3 A;  1FUG A;  2MCQ A;  3A4I A;  5BSM A;  1J5E C;  4PUH A;  3I07 A;  4DV6 C;  3CQ3 A;  4G37 A;  3K6R A;  4NDN A;  3T1Y C;  5H9U A;  4K0K C;  5A1I A;  3CQ1 A;  4RVO A;  2E7G A;  4WV3 A;  4DV1 C;  2PN2 A;  5K8F A;  4DCT A;  3RG2 A;  1O90 A;  3C5E A;  1N32 C;  4PUI A;  4BCA A;  5BSR A;  3DHV A;  4D4G A;  2Y4N A;  1O9T A;  4BSZ A;  1MXC A;  2E8C A;  3DLP X;  1K0R A;  1XMQ C;  4JM1 A;  4ZLP A;  5BSV A;  1IBM C;  3I08 A;  3NPD A;  4JI0 C;  5A1G A;  5BUR A;  3GR1 A;  4DR3 C;  4OYC A;  4LFB C;  3VNS A;  2P2Q A;  3R9W A;  2EGT A;  5KYV A;  2CU6 A;  1XMO C;  4MTN A;  4JI4 C;  1M6X C;  4OX9 C;  1ZB8 A;  3AY0 A;  1ULT A;  4X66 C;  1RG9 A;  4JI1 C;  3A26 A;  5BST A;  2CXC A;  5BUS A;  2PT7 G;  4AQY C;  2ASB A;  4G1I A;  5KYT A;  4X64 C;  1XRB A;  3ETO A;  2VQE C;  2D1T A;  3NI2 A;  4OXI A;  1UWD A;  2DPL A;  2UUC C;  3RV2 A;  4D4I A;  1L2F A;  5LCI A;  5T8T A;  4R1M A;  1KKG A;  3A25 A;  4DV4 C;  2OPL A;  1V60 A;  1NYE A;  4FUT A;  4B3S C;  5AE1 A;  1MD9 A;  4BBY A; 
#chains in the Genus database with same CATH homology
 2Y4O A;  5A2Q D;  2F4V C;  1JOS A;  1BA3 A;  3A9U A;  4JI6 C;  1XNR C;  2XR1 A;  3IEU A;  4K0B A;  5E7Q A;  3LGX A;  2P2J A;  4R1L A;  5JRH A;  4GXR A;  1MKY A;  1RY2 A;  1IBL C;  1MDF A;  3GR0 A;  5IWA C;  3CW9 A;  2JMP A;  4X62 C;  5DV9 A;  5FLX D;  4B3R C;  4RMN A;  1MDB A;  4LF5 C;  2HJG A;  3T1H C;  4PZP A;  3J81 D;  2D1Q A;  1HNX C;  3VNQ A;  4FTF A;  1N33 C;  2P2F A;  4XX2 A;  1EGA A;  3OTO C;  4LF6 C;  5GTD A;  2E0G A;  5BR8 C;  3CW8 X;  2VZE A;  4X65 C;  4DR4 C;  4I9F A;  3PES A;  4WS9 A;  2P2M A;  4JYA C;  2AYA A;  4MH4 A;  3IML A;  4NXM C;  3VNR A;  4JI7 C;  2OPL B;  3R44 A;  4RM3 A;  2D1R A;  4LE5 A;  1GPM A;  4JI2 C;  3E7W A;  5K85 A;  4GKK C;  1USP A;  1PG4 A;  2VQF C;  4DR6 C;  4GXQ A;  1O93 A;  4I9G A;  4ISB A;  1N34 C;  3PBK A;  3A9V A;  4TPS B;  4NXN C;  2P20 A;  3G7S A;  4HPV A;  3AF5 A;  5CZV A;  1FJG C;  3LNV A;  4LF7 C;  3FCC A;  2V7B A;  4KTT A;  3KXW A;  1HH2 P;  3J80 D;  1O92 A;  5IT9 D;  4DV7 C;  2UUB C;  2DYJ A;  1V26 A;  3JAM D;  1HR0 C;  4DV5 C;  2QL8 A;  3IEV A;  5CZX A;  3UZ0 A;  3GPC A;  3ETC A;  1LQL A;  3IPL A;  4PRO C;  5BSW A;  1VLA A;  2UXB C;  4ZJZ A;  1T5H X;  4JI5 C;  3TDE A;  1YJ7 A;  1USP B;  2E8F A;  2CY1 A;  2VSQ A;  1AMU A;  2YWB A;  4G36 A;  5LMU C;  2E5L C;  2QW0 X;  5T8S A;  3H2T A;  3TQI A;  2YCB A;  3J7A D;  4LFC C;  4RVN A;  2KZF A;  4L7I A;  4DV0 C;  5IFI A;  2Y27 A;  4LF8 C;  3TUF A;  4RLF A;  4EAT A;  2UXC C;  4DR5 C;  5AE2 A;  2ZM6 C;  2BH1 X;  2D1S A;  2UU9 C;  4DUZ C;  2D27 A;  1N36 C;  4BC9 A;  1XNQ C;  3NYR A;  1PA4 A;  2UXD C;  4DCS A;  4DCV A;  4GS5 A;  4U5Y D;  4DR2 C;  1QM4 A;  2WD9 A;  3L8C A;  1V25 A;  4D57 A;  3R9X A;  2UUA C;  2OO4 A;  4GKJ C;  2PRO A;  3N2Q A;  4PHT A;  4L2Z A;  1MXB A;  4IZ6 A;  4JI8 C;  2D28 C;  1MXA A;  3E7X A;  4L4Q A;  2P2B A;  1N2F A;  3EQ6 A;  2WP0 C;  2BJO A;  4DV2 C;  3LUS A;  4B3M C;  1WF3 A;  2P02 A;  4DUY C;  4DCU A;  1XRA A;  1XRC A;  2QVY X;  4IR7 A;  5KEI A;  2OBV A;  4DV3 C;  3UOW A;  5ADZ A;  3NYQ A;  1P7L A;  1PG3 A;  4LFA C;  1HNW C;  3FCE A;  3L95 X;  4DG9 A;  1HNZ C;  1IBK C;  4NOZ A;  4RLQ A;  4JV5 C;  3SO4 A;  4DR7 C;  1LCI A;  1ZB9 A;  3B7W A;  3DAY A;  5A19 A;  4LF9 C;  4YHH C;  3EER A;  4DG8 A;  3LAX A;  4R0M A;  4LF4 C;  2D7V A;  2HHH C;  2ONF A;  4KHP C;  1T5D X;  4DR1 C;  4YY3 C;  2ATW A;  3PRO C;  5LMN C;  3N54 B;  4B3T C;  4KTV A;  4FUQ A;  3GKU A;  2QVZ X;  3AF6 A;  4JI3 C;  2E8E A;  3S82 A;  1UKK A;  5BUQ A;  1I94 C;  2QVX X;  4BC7 A;  3CJE A;  1QWI A;  4RM2 A;  5BSU A;  1WH9 A;  4ODJ A;  4D56 A;  2YWC A;  1ML8 A;  5AE3 A;  1FUG A;  3A4I A;  5BSM A;  1J5E C;  3I07 A;  4DV6 C;  4G37 A;  4NDN A;  3T1Y C;  5H9U A;  4K0K C;  5A1I A;  4RVO A;  2E7G A;  4WV3 A;  4DV1 C;  2PN2 A;  5K8F A;  4DCT A;  3RG2 A;  1O90 A;  3C5E A;  1N32 C;  4BCA A;  5BSR A;  3DHV A;  4D4G A;  2Y4N A;  1O9T A;  4BSZ A;  1MXC A;  2E8C A;  3DLP X;  1K0R A;  1XMQ C;  4JM1 A;  4ZLP A;  5BSV A;  1IBM C;  3I08 A;  3NPD A;  4JI0 C;  5A1G A;  5BUR A;  3GR1 A;  4DR3 C;  4OYC A;  4LFB C;  3VNS A;  2P2Q A;  3R9W A;  2EGT A;  5KYV A;  1XMO C;  4MTN A;  4JI4 C;  4OX9 C;  1ZB8 A;  1ULT A;  4X66 C;  1RG9 A;  4JI1 C;  5BST A;  2CXC A;  5BUS A;  2PT7 G;  4AQY C;  2ASB A;  4G1I A;  5KYT A;  4X64 C;  1XRB A;  3ETO A;  2VQE C;  2D1T A;  3NI2 A;  4OXI A;  2DPL A;  2UUC C;  3RV2 A;  4D4I A;  1L2F A;  5T8T A;  4R1M A;  1KKG A;  4DV4 C;  2OPL A;  1NYE A;  4FUT A;  4B3S C;  5AE1 A;  1MD9 A;  4BBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...