4LFBC

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lfbC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lfbC02
2HHHC 2E5LC 3GKUA 1ZB9A 4LF4C 3R9XA 4DV7C 4XX2A 1N33C 2JMPA 4DR4C 1IBKC 3J80D 4DCTA 2UXBC 4DR7C 4JI1C 4DCVA 4X62C 4JI7C 1HH2P 4LF9C 2ATWA 1JOSA 4LFCC 2F4VC 4DV1C 1NYEA 4JI3C 3JAMD 4LF7C 1LQLA 1WF3A 1HNWC 2ONFA 1XNQC 1N32C 4DR6C 4DV5C 4DR5C 3T1HC 2UUCC 2UXCC 4MTNA 4DCUA 3J81D 1N34C 1FJGC 1XNRC 4JI5C 4B3MC 1HNZC 4OX9C 4YY3C 5BR8C 1PA4A 3R9WA 2CY1A 1USPA 3I07A 4DR3C 3AF5A 2XR1A 1WH9A 2UUAC 4X66C 4JI4C 1QWIA 4BSZA 3AF6A 4DV0C 1N2FA 2ZM6C 4JI2C 4YHHC 1ML8A 1EGAA 2UXDC 4DV3C 4X64C 3IEVA 4DV6C 1HNXC 2VQFC 3EERA 2HJGA 1HR0C 5FLXD 1K0RA 3OTOC 4B3RC 2ASBA 1XMQC 1J5EC 2OPLA 2UU9C 4GKKC 4LF8C 4LFAC 2VQEC 4KHPC 4DV4C 4JV5C 4NOZA 4DCSA 3LUSA 4K0KC 2OPLB 2E8EA 4DUYC 1IBLC 3J7AD 1IBMC 4LFBC 4DUZC 1L2FA 1UKKA 4X65C 4JI0C 2UUBC 4NXNC 2E7GA 1USPB 1ZB8A 5IT9D 4AQYC 3T1YC 4JI8C 1XMOC 1I94C 4B3TC 5IWAC 4LF6C 3CJEA 2KZFA 1VLAA 2E8FA 2EGTA 2BJOA 2QL8A 4LF5C 5LMNC 2PT7G 2YCBA 5A2QD 4DR2C 2D7VA 1N36C 1KKGA 5LMUC 2E8CA 4DR1C 3IEUA 4NXMC 2PN2A 4MH4A 2DYJA 4JI6C 4GKJC 1MKYA 4B3SC 4DV2C 2CXCA 4JYAC
chains in the Genus database with same CATH superfamily
3UEBA 5T8TA 5BSMA 2D1RA 3R9XA 3RG2A 3A9UA 3LNOA 4DR4C 3DHVA 1GPMA 4DG8A 5BSUA 4DCVA 4X62C 4OXIA 3LNVA 4JI7C 4LF9C 5K8FA 4FTFA 1JOSA 2P2QA 4JI3C 1MXBA 1WF3A 2BH1X 1HNWC 1XNQC 4DR6C 2UXCC 1IB8A 3TR3A 4ODJA 1N34C 4JI5C 5A1IA 4B3MC 4OX9C 1PA4A 4GS5A 3G7SA 2P2MA 3NPDA 2KZ0A 2V7BA 1MD9A 4JI4C 3N2QA 1P4EC 3E7WA 3AF6A 4DV0C 2VZEA 3RV2A 4OYCA 5A1GA 2UXDC 5BSTA 2NCLA 1HNXC 3I08A 4RM3A 4IZ6A 3FCEA 3SO4A 1J5EC 4KTTA 2OBVA 4D57A 2P02A 4JV5C 3FM7A 2D1SA 3CQ1A 4K0KC 4K0BA 4DUYC 1IBLC 1IBMC 1FUGA 4L4QA 1PU1A 2UUBC 2ZZNA 4PZPA 1T5HX 1USPB 2E7GA 3UZ0A 1O92A 3CJEA 5BUQA 5H9UA 2E8FA 5ADZA 2EGTA 1BA3A 1P7LA 4LF5C 4DR2C 2D7VA 2E8CA 1O9TA 3PBKA 2PN2A 1QM4A 2DYJA 4MH4A 4RLFA 4GKJC 4R1LA 4B3SC 3TUFA 1ULTA 4RLQA 3GKUA 2P2FA 4DV7C 4L2ZA 2QW0X 3O2EA 4BC7A 2P2JA 2UXBC 4DR7C 3CQ3A 2Y27A 2ATWA 4DV1C 1PG3A 4LF7C 3IPLA 4JM1A 4GXQA 2ONFA 2OO4A 2Y4NA 1N32C 4DR5C 3T1HC 1XS3A 1MXAA 4MTNA 3J81D 1V25A 4PUHA 4YY3C 3AY0A 3R44A 5AE1A 5A19A 4LE5A 1QWIA 3VNRA 4ZLPA 3A25A 4PUGA 1N2FA 1ML8A 2YWCA 4DV3C 5CZVA 4RM2A 4X64C 5BSWA 4ZJZA 3S82A 3EERA 3TDEA 4DG9A 5AE3A 4FUQA 2UU9C 3PESA 3NYQA 4LFAC 2D1TA 3DLPX 3TQIA 3VNSA 4KHPC 4DV4C 5GTDA 1XRAA 1YJ7A 4LFBC 1UKKA 4D4IA 4NXNC 2M5HA 3T1YC 4JI8C 5K85A 4LF6C 4B3TC 3ETOA 1O90A 1VLAA 3K6RA 1LCIA 2BJOA 1P4EA 3A9VA 1MXCA 1N36C 5LMUC 3CQ2A 3IEUA 2QVZX 1RG9A 4JYAC 3NI2A 3FCCA 1ZB9A 4LF4C 2ZZMA 4ISBA 2JNVA 4XX2A 3E7XA 1TH5A 1VEHA 2JMPA 1IBKC 4BC9A 3GPCA 4PUIA 3L8CA 3J80D 4NDNA 2P20A 1HH2P 2KDNA 2D27A 2CU6A 2F4VC 5AE2A 3GR0A 5BSRA 2MM9A 2UUCC 1M6XC 1FLOA 5T8SA 1FJGC 1XNRC 5E7QA 4G1IA 3R9WA 2CY1A 1USPA 4DR3C 3AF5A 4X66C 2DHMA 4I9GA 4L7IA 4D56A 5LCIA 3B7WA 3EQ6A 2ZM6C 2YX1A 1PG4A 4YHHC 1MDFA 1EGAA 4EATA 5KYTA 3IEVA 4BCAA 2VQFC 5CZXA 2HJGA 4HPVA 3OTOC 1V26A 1K0RA 4B3RC 4R1MA 2DPLA 2ASBA 1V60A 1XMQC 4BBYA 4LF8C 2D1QA 2YWBA 2M5OA 3CW9A 3UOWA 3NYRA 3LUSA 3PROC 2OPLB 3N54B 2E8EA 4G37A 4G36A 4DUZC 1L2FA 4AQYC 5BSVA 2PROA 1O93A 1NY8A 1XRBA 3DAYA 4KTVA 3A26A 5DV9A 4JI6C 2CXCA 2HHHC 2E5LC 3H2TA 3L95X 4GXRA 5BURA 1YGTA 3A4IA 2MCQA 2QVXX 4WV3A 1N33C 2PG1E 4TPSB 2WD9A 2MMAB 1AMUA 4DCTA 1T5DX 3UX3A 4JI1C 3LGXA 4U5YD 3KXWA 4RMNA 4LFCC 1NYEA 5IFIA 3JAMD 2WP0C 1LQLA 4RVOA 4DV5C 5JRHA 4PHTA 4DCUA 1M6XA 2ZTBA 3C5EA 2Y4OA 1HNZC 3ETCA 5BR8C 1MDBA 4WS9A 1XHJA 3I07A 1XDXA 2XR1A 1WH9A 2UUAC 4BSZA 4PROC 4JI2C 2E0GA 2QVYX 2AYAA 4DV6C 3GR1A 1HR0C 2Z51A 5FLXD 2OPLA 3IMLA 4GKKC 2VQEC 4NOZA 4DCSA 3J7AD 4R0MA 3CW8X 4I9FA 5KYVA 4X65C 3LAXA 4JI0C 1UWDA 1ZB8A 1XRCA 2P2BA 5IT9D 1WCJA 4RVNA 5BUSA 1XMOC 1I94C 5IWAC 4FUTA 5KEIA 2KZFA 3VNQA 3UX2A 2QL8A 5LMNC 2PT7G 2YCBA 5A2QD 1KKGA 1RY2A 4IR7A 4DR1C 4D4GA 4NXMC 2VSQA 1MKYA 2D28C 4DV2C
chains in the Genus database with same CATH topology
5T8TA 5BSMA 2D1RA 3R9XA 3RG2A 3A9UA 4DR4C 3DHVA 1GPMA 4DG8A 5BSUA 4DCVA 4X62C 4OXIA 3LNVA 4JI7C 4LF9C 5K8FA 4FTFA 1JOSA 2P2QA 4JI3C 1MXBA 1WF3A 2BH1X 1HNWC 1XNQC 4DR6C 2UXCC 4ODJA 1N34C 4JI5C 5A1IA 4B3MC 4OX9C 1PA4A 4GS5A 3G7SA 2P2MA 3NPDA 2V7BA 1MD9A 4JI4C 3N2QA 3E7WA 3AF6A 4DV0C 2VZEA 3RV2A 4OYCA 5A1GA 2UXDC 5BSTA 1HNXC 3I08A 4RM3A 4IZ6A 3FCEA 3SO4A 1J5EC 4KTTA 2OBVA 4D57A 2P02A 4JV5C 2D1SA 4K0KC 1IBLC 4K0BA 4DUYC 1IBMC 1FUGA 4L4QA 2UUBC 4PZPA 1T5HX 1USPB 2E7GA 3UZ0A 1O92A 3CJEA 5BUQA 5H9UA 2E8FA 5ADZA 2EGTA 1BA3A 1P7LA 4LF5C 4DR2C 2D7VA 2E8CA 1O9TA 3PBKA 2PN2A 1QM4A 2DYJA 4MH4A 4RLFA 4GKJC 4R1LA 4B3SC 3TUFA 1ULTA 4RLQA 3GKUA 2P2FA 4DV7C 4L2ZA 2QW0X 4BC7A 2P2JA 2UXBC 4DR7C 2Y27A 2ATWA 4DV1C 1PG3A 4LF7C 3IPLA 4JM1A 4GXQA 2ONFA 2OO4A 2Y4NA 1N32C 4DR5C 3T1HC 1MXAA 4MTNA 3J81D 1V25A 4YY3C 3R44A 5AE1A 5A19A 4LE5A 1QWIA 3VNRA 4ZLPA 1N2FA 1ML8A 2YWCA 4DV3C 5CZVA 4RM2A 4X64C 5BSWA 4ZJZA 3S82A 3EERA 3TDEA 4DG9A 5AE3A 4FUQA 2UU9C 3PESA 3NYQA 4LFAC 2D1TA 3DLPX 3TQIA 3VNSA 4KHPC 4DV4C 5GTDA 1XRAA 1YJ7A 4LFBC 1UKKA 4D4IA 4NXNC 3T1YC 4JI8C 5K85A 4LF6C 4B3TC 3ETOA 1O90A 1VLAA 1LCIA 2BJOA 3A9VA 1MXCA 1N36C 5LMUC 3IEUA 2QVZX 1RG9A 4JYAC 3NI2A 3FCCA 1ZB9A 4LF4C 4ISBA 4XX2A 3E7XA 2JMPA 1IBKC 4BC9A 3GPCA 3L8CA 3J80D 4NDNA 2P20A 1HH2P 2D27A 2F4VC 5AE2A 3GR0A 5BSRA 2UUCC 5T8SA 1FJGC 1XNRC 5E7QA 4G1IA 3R9WA 2CY1A 1USPA 4DR3C 3AF5A 4X66C 4I9GA 4L7IA 4D56A 3B7WA 3EQ6A 2ZM6C 1PG4A 4YHHC 1MDFA 1EGAA 4EATA 5KYTA 3IEVA 4BCAA 2VQFC 5CZXA 2HJGA 4HPVA 1V26A 1K0RA 3OTOC 4B3RC 4R1MA 2DPLA 2ASBA 1XMQC 4BBYA 4LF8C 2D1QA 2YWBA 3CW9A 3UOWA 3NYRA 3LUSA 3PROC 2OPLB 3N54B 2E8EA 4G37A 4G36A 4DUZC 1L2FA 4AQYC 5BSVA 2PROA 1O93A 1XRBA 3DAYA 4KTVA 5DV9A 4JI6C 2CXCA 2HHHC 2E5LC 3H2TA 3L95X 4GXRA 5BURA 3A4IA 2QVXX 4WV3A 1N33C 4TPSB 2WD9A 1AMUA 4DCTA 1T5DX 4JI1C 3LGXA 4U5YD 3KXWA 4RMNA 4LFCC 1NYEA 5IFIA 3JAMD 2WP0C 1LQLA 4RVOA 4DV5C 5JRHA 4PHTA 4DCUA 3C5EA 2Y4OA 1HNZC 3ETCA 5BR8C 1MDBA 4WS9A 3I07A 2XR1A 1WH9A 2UUAC 4BSZA 4PROC 4JI2C 2E0GA 2QVYX 2AYAA 4DV6C 3GR1A 1HR0C 5FLXD 2OPLA 3IMLA 4GKKC 2VQEC 4NOZA 4DCSA 3J7AD 4R0MA 3CW8X 4I9FA 5KYVA 4X65C 3LAXA 4JI0C 2P2BA 1ZB8A 1XRCA 5IT9D 4RVNA 5BUSA 1XMOC 1I94C 5IWAC 4FUTA 5KEIA 2KZFA 3VNQA 2QL8A 5LMNC 2PT7G 2YCBA 5A2QD 1KKGA 1RY2A 4IR7A 4DR1C 4D4GA 4NXMC 2VSQA 1MKYA 2D28C 4DV2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH C;  2E5L C;  3GKU A;  1ZB9 A;  4LF4 C;  3R9X A;  4DV7 C;  4XX2 A;  1N33 C;  2JMP A;  4DR4 C;  1IBK C;  3J80 D;  4DCT A;  2UXB C;  4DR7 C;  4JI1 C;  4DCV A;  4X62 C;  4JI7 C;  1HH2 P;  4LF9 C;  2ATW A;  1JOS A;  4LFC C;  2F4V C;  4DV1 C;  1NYE A;  4JI3 C;  3JAM D;  4LF7 C;  1LQL A;  1WF3 A;  1HNW C;  2ONF A;  1XNQ C;  1N32 C;  4DR6 C;  4DV5 C;  4DR5 C;  3T1H C;  2UUC C;  2UXC C;  4MTN A;  4DCU A;  3J81 D;  1N34 C;  1FJG C;  1XNR C;  4JI5 C;  4B3M C;  1HNZ C;  4OX9 C;  4YY3 C;  5BR8 C;  1PA4 A;  3R9W A;  2CY1 A;  1USP A;  3I07 A;  4DR3 C;  3AF5 A;  2XR1 A;  1WH9 A;  2UUA C;  4X66 C;  4JI4 C;  1QWI A;  4BSZ A;  3AF6 A;  4DV0 C;  1N2F A;  2ZM6 C;  4JI2 C;  4YHH C;  1ML8 A;  1EGA A;  2UXD C;  4DV3 C;  4X64 C;  3IEV A;  4DV6 C;  1HNX C;  2VQF C;  3EER A;  2HJG A;  1HR0 C;  5FLX D;  1K0R A;  3OTO C;  4B3R C;  2ASB A;  1XMQ C;  1J5E C;  2OPL A;  2UU9 C;  4GKK C;  4LF8 C;  4LFA C;  2VQE C;  4KHP C;  4DV4 C;  4JV5 C;  4NOZ A;  4DCS A;  3LUS A;  4K0K C;  2OPL B;  2E8E A;  4DUY C;  1IBL C;  3J7A D;  1IBM C;  4LFB C;  4DUZ C;  1L2F A;  1UKK A;  4X65 C;  4JI0 C;  2UUB C;  4NXN C;  2E7G A;  1USP B;  1ZB8 A;  5IT9 D;  4AQY C;  3T1Y C;  4JI8 C;  1XMO C;  1I94 C;  4B3T C;  5IWA C;  4LF6 C;  3CJE A;  2KZF A;  1VLA A;  2E8F A;  2EGT A;  2BJO A;  2QL8 A;  4LF5 C;  5LMN C;  2PT7 G;  2YCB A;  5A2Q D;  4DR2 C;  2D7V A;  1N36 C;  1KKG A;  5LMU C;  2E8C A;  4DR1 C;  3IEU A;  4NXM C;  2PN2 A;  4MH4 A;  2DYJ A;  4JI6 C;  4GKJ C;  1MKY A;  4B3S C;  4DV2 C;  2CXC A;  4JYA C; 
#chains in the Genus database with same CATH topology
 3UEB A;  5T8T A;  5BSM A;  2D1R A;  3R9X A;  3RG2 A;  3A9U A;  3LNO A;  4DR4 C;  3DHV A;  1GPM A;  4DG8 A;  5BSU A;  4DCV A;  4X62 C;  4OXI A;  3LNV A;  4JI7 C;  4LF9 C;  5K8F A;  4FTF A;  1JOS A;  2P2Q A;  4JI3 C;  1MXB A;  1WF3 A;  2BH1 X;  1HNW C;  1XNQ C;  4DR6 C;  2UXC C;  1IB8 A;  3TR3 A;  4ODJ A;  1N34 C;  4JI5 C;  5A1I A;  4B3M C;  4OX9 C;  1PA4 A;  4GS5 A;  3G7S A;  2P2M A;  3NPD A;  2KZ0 A;  2V7B A;  1MD9 A;  4JI4 C;  3N2Q A;  1P4E C;  3E7W A;  3AF6 A;  4DV0 C;  2VZE A;  3RV2 A;  4OYC A;  5A1G A;  2UXD C;  5BST A;  2NCL A;  1HNX C;  3I08 A;  4RM3 A;  4IZ6 A;  3FCE A;  3SO4 A;  1J5E C;  4KTT A;  2OBV A;  4D57 A;  2P02 A;  4JV5 C;  3FM7 A;  2D1S A;  3CQ1 A;  4K0K C;  4K0B A;  4DUY C;  1IBL C;  1IBM C;  1FUG A;  4L4Q A;  1PU1 A;  2UUB C;  2ZZN A;  4PZP A;  1T5H X;  1USP B;  2E7G A;  3UZ0 A;  1O92 A;  3CJE A;  5BUQ A;  5H9U A;  2E8F A;  5ADZ A;  2EGT A;  1BA3 A;  1P7L A;  4LF5 C;  4DR2 C;  2D7V A;  2E8C A;  1O9T A;  3PBK A;  2PN2 A;  1QM4 A;  2DYJ A;  4MH4 A;  4RLF A;  4GKJ C;  4R1L A;  4B3S C;  3TUF A;  1ULT A;  4RLQ A;  3GKU A;  2P2F A;  4DV7 C;  4L2Z A;  2QW0 X;  3O2E A;  4BC7 A;  2P2J A;  2UXB C;  4DR7 C;  3CQ3 A;  2Y27 A;  2ATW A;  4DV1 C;  1PG3 A;  4LF7 C;  3IPL A;  4JM1 A;  4GXQ A;  2ONF A;  2OO4 A;  2Y4N A;  1N32 C;  4DR5 C;  3T1H C;  1XS3 A;  1MXA A;  4MTN A;  3J81 D;  1V25 A;  4PUH A;  4YY3 C;  3AY0 A;  3R44 A;  5AE1 A;  5A19 A;  4LE5 A;  1QWI A;  3VNR A;  4ZLP A;  3A25 A;  4PUG A;  1N2F A;  1ML8 A;  2YWC A;  4DV3 C;  5CZV A;  4RM2 A;  4X64 C;  5BSW A;  4ZJZ A;  3S82 A;  3EER A;  3TDE A;  4DG9 A;  5AE3 A;  4FUQ A;  2UU9 C;  3PES A;  3NYQ A;  4LFA C;  2D1T A;  3DLP X;  3TQI A;  3VNS A;  4KHP C;  4DV4 C;  5GTD A;  1XRA A;  1YJ7 A;  4LFB C;  1UKK A;  4D4I A;  4NXN C;  2M5H A;  3T1Y C;  4JI8 C;  5K85 A;  4LF6 C;  4B3T C;  3ETO A;  1O90 A;  1VLA A;  3K6R A;  1LCI A;  2BJO A;  1P4E A;  3A9V A;  1MXC A;  1N36 C;  5LMU C;  3CQ2 A;  3IEU A;  2QVZ X;  1RG9 A;  4JYA C;  3NI2 A;  3FCC A;  1ZB9 A;  4LF4 C;  2ZZM A;  4ISB A;  2JNV A;  4XX2 A;  3E7X A;  1TH5 A;  1VEH A;  2JMP A;  1IBK C;  4BC9 A;  3GPC A;  4PUI A;  3L8C A;  3J80 D;  4NDN A;  2P20 A;  1HH2 P;  2KDN A;  2D27 A;  2CU6 A;  2F4V C;  5AE2 A;  3GR0 A;  5BSR A;  2MM9 A;  2UUC C;  1M6X C;  1FLO A;  5T8S A;  1FJG C;  1XNR C;  5E7Q A;  4G1I A;  3R9W A;  2CY1 A;  1USP A;  4DR3 C;  3AF5 A;  4X66 C;  2DHM A;  4I9G A;  4L7I A;  4D56 A;  5LCI A;  3B7W A;  3EQ6 A;  2ZM6 C;  2YX1 A;  1PG4 A;  4YHH C;  1MDF A;  1EGA A;  4EAT A;  5KYT A;  3IEV A;  4BCA A;  2VQF C;  5CZX A;  2HJG A;  4HPV A;  3OTO C;  1V26 A;  1K0R A;  4B3R C;  4R1M A;  2DPL A;  2ASB A;  1V60 A;  1XMQ C;  4BBY A;  4LF8 C;  2D1Q A;  2YWB A;  2M5O A;  3CW9 A;  3UOW A;  3NYR A;  3LUS A;  3PRO C;  2OPL B;  3N54 B;  2E8E A;  4G37 A;  4G36 A;  4DUZ C;  1L2F A;  4AQY C;  5BSV A;  2PRO A;  1O93 A;  1NY8 A;  1XRB A;  3DAY A;  4KTV A;  3A26 A;  5DV9 A;  4JI6 C;  2CXC A;  2HHH C;  2E5L C;  3H2T A;  3L95 X;  4GXR A;  5BUR A;  1YGT A;  3A4I A;  2MCQ A;  2QVX X;  4WV3 A;  1N33 C;  2PG1 E;  4TPS B;  2WD9 A;  2MMA B;  1AMU A;  4DCT A;  1T5D X;  3UX3 A;  4JI1 C;  3LGX A;  4U5Y D;  3KXW A;  4RMN A;  4LFC C;  1NYE A;  5IFI A;  3JAM D;  2WP0 C;  1LQL A;  4RVO A;  4DV5 C;  5JRH A;  4PHT A;  4DCU A;  1M6X A;  2ZTB A;  3C5E A;  2Y4O A;  1HNZ C;  3ETC A;  5BR8 C;  1MDB A;  4WS9 A;  1XHJ A;  3I07 A;  1XDX A;  2XR1 A;  1WH9 A;  2UUA C;  4BSZ A;  4PRO C;  4JI2 C;  2E0G A;  2QVY X;  2AYA A;  4DV6 C;  3GR1 A;  1HR0 C;  2Z51 A;  5FLX D;  2OPL A;  3IML A;  4GKK C;  2VQE C;  4NOZ A;  4DCS A;  3J7A D;  4R0M A;  3CW8 X;  4I9F A;  5KYV A;  4X65 C;  3LAX A;  4JI0 C;  1UWD A;  1ZB8 A;  1XRC A;  2P2B A;  5IT9 D;  1WCJ A;  4RVN A;  5BUS A;  1XMO C;  1I94 C;  5IWA C;  4FUT A;  5KEI A;  2KZF A;  3VNQ A;  3UX2 A;  2QL8 A;  5LMN C;  2PT7 G;  2YCB A;  5A2Q D;  1KKG A;  1RY2 A;  4IR7 A;  4DR1 C;  4D4G A;  4NXM C;  2VSQ A;  1MKY A;  2D28 C;  4DV2 C; 
#chains in the Genus database with same CATH homology
 5T8T A;  5BSM A;  2D1R A;  3R9X A;  3RG2 A;  3A9U A;  4DR4 C;  3DHV A;  1GPM A;  4DG8 A;  5BSU A;  4DCV A;  4X62 C;  4OXI A;  3LNV A;  4JI7 C;  4LF9 C;  5K8F A;  4FTF A;  1JOS A;  2P2Q A;  4JI3 C;  1MXB A;  1WF3 A;  2BH1 X;  1HNW C;  1XNQ C;  4DR6 C;  2UXC C;  4ODJ A;  1N34 C;  4JI5 C;  5A1I A;  4B3M C;  4OX9 C;  1PA4 A;  4GS5 A;  3G7S A;  2P2M A;  3NPD A;  2V7B A;  1MD9 A;  4JI4 C;  3N2Q A;  3E7W A;  3AF6 A;  4DV0 C;  2VZE A;  3RV2 A;  4OYC A;  5A1G A;  2UXD C;  5BST A;  1HNX C;  3I08 A;  4RM3 A;  4IZ6 A;  3FCE A;  3SO4 A;  1J5E C;  4KTT A;  2OBV A;  4D57 A;  2P02 A;  4JV5 C;  2D1S A;  4K0K C;  1IBL C;  4K0B A;  4DUY C;  1IBM C;  1FUG A;  4L4Q A;  2UUB C;  4PZP A;  1T5H X;  1USP B;  2E7G A;  3UZ0 A;  1O92 A;  3CJE A;  5BUQ A;  5H9U A;  2E8F A;  5ADZ A;  2EGT A;  1BA3 A;  1P7L A;  4LF5 C;  4DR2 C;  2D7V A;  2E8C A;  1O9T A;  3PBK A;  2PN2 A;  1QM4 A;  2DYJ A;  4MH4 A;  4RLF A;  4GKJ C;  4R1L A;  4B3S C;  3TUF A;  1ULT A;  4RLQ A;  3GKU A;  2P2F A;  4DV7 C;  4L2Z A;  2QW0 X;  4BC7 A;  2P2J A;  2UXB C;  4DR7 C;  2Y27 A;  2ATW A;  4DV1 C;  1PG3 A;  4LF7 C;  3IPL A;  4JM1 A;  4GXQ A;  2ONF A;  2OO4 A;  2Y4N A;  1N32 C;  4DR5 C;  3T1H C;  1MXA A;  4MTN A;  3J81 D;  1V25 A;  4YY3 C;  3R44 A;  5AE1 A;  5A19 A;  4LE5 A;  1QWI A;  3VNR A;  4ZLP A;  1N2F A;  1ML8 A;  2YWC A;  4DV3 C;  5CZV A;  4RM2 A;  4X64 C;  5BSW A;  4ZJZ A;  3S82 A;  3EER A;  3TDE A;  4DG9 A;  5AE3 A;  4FUQ A;  2UU9 C;  3PES A;  3NYQ A;  4LFA C;  2D1T A;  3DLP X;  3TQI A;  3VNS A;  4KHP C;  4DV4 C;  5GTD A;  1XRA A;  1YJ7 A;  4LFB C;  1UKK A;  4D4I A;  4NXN C;  3T1Y C;  4JI8 C;  5K85 A;  4LF6 C;  4B3T C;  3ETO A;  1O90 A;  1VLA A;  1LCI A;  2BJO A;  3A9V A;  1MXC A;  1N36 C;  5LMU C;  3IEU A;  2QVZ X;  1RG9 A;  4JYA C;  3NI2 A;  3FCC A;  1ZB9 A;  4LF4 C;  4ISB A;  4XX2 A;  3E7X A;  2JMP A;  1IBK C;  4BC9 A;  3GPC A;  3L8C A;  3J80 D;  4NDN A;  2P20 A;  1HH2 P;  2D27 A;  2F4V C;  5AE2 A;  3GR0 A;  5BSR A;  2UUC C;  5T8S A;  1FJG C;  1XNR C;  5E7Q A;  4G1I A;  3R9W A;  2CY1 A;  1USP A;  4DR3 C;  3AF5 A;  4X66 C;  4I9G A;  4L7I A;  4D56 A;  3B7W A;  3EQ6 A;  2ZM6 C;  1PG4 A;  4YHH C;  1MDF A;  1EGA A;  4EAT A;  5KYT A;  3IEV A;  4BCA A;  2VQF C;  5CZX A;  2HJG A;  4HPV A;  1V26 A;  1K0R A;  3OTO C;  4B3R C;  4R1M A;  2DPL A;  2ASB A;  1XMQ C;  4BBY A;  4LF8 C;  2D1Q A;  2YWB A;  3CW9 A;  3UOW A;  3NYR A;  3LUS A;  3PRO C;  2OPL B;  3N54 B;  2E8E A;  4G37 A;  4G36 A;  4DUZ C;  1L2F A;  4AQY C;  5BSV A;  2PRO A;  1O93 A;  1XRB A;  3DAY A;  4KTV A;  5DV9 A;  4JI6 C;  2CXC A;  2HHH C;  2E5L C;  3H2T A;  3L95 X;  4GXR A;  5BUR A;  3A4I A;  2QVX X;  4WV3 A;  1N33 C;  4TPS B;  2WD9 A;  1AMU A;  4DCT A;  1T5D X;  4JI1 C;  3LGX A;  4U5Y D;  3KXW A;  4RMN A;  4LFC C;  1NYE A;  5IFI A;  3JAM D;  2WP0 C;  1LQL A;  4RVO A;  4DV5 C;  5JRH A;  4PHT A;  4DCU A;  3C5E A;  2Y4O A;  1HNZ C;  3ETC A;  5BR8 C;  1MDB A;  4WS9 A;  3I07 A;  2XR1 A;  1WH9 A;  2UUA C;  4BSZ A;  4PRO C;  4JI2 C;  2E0G A;  2QVY X;  2AYA A;  4DV6 C;  3GR1 A;  1HR0 C;  5FLX D;  2OPL A;  3IML A;  4GKK C;  2VQE C;  4NOZ A;  4DCS A;  3J7A D;  4R0M A;  3CW8 X;  4I9F A;  5KYV A;  4X65 C;  3LAX A;  4JI0 C;  2P2B A;  1ZB8 A;  1XRC A;  5IT9 D;  4RVN A;  5BUS A;  1XMO C;  1I94 C;  5IWA C;  4FUT A;  5KEI A;  2KZF A;  3VNQ A;  2QL8 A;  5LMN C;  2PT7 G;  2YCB A;  5A2Q D;  1KKG A;  1RY2 A;  4IR7 A;  4DR1 C;  4D4G A;  4NXM C;  2VSQ A;  1MKY A;  2D28 C;  4DV2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...