4DR6C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 53
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr6C02
2YCBA 3IEUA 2E8EA 2UUAC 4NXMC 4NOZA 4DUZC 2VQEC 3T1HC 2E8FA 1I94C 4DR7C 1QWIA 4X64C 4JV5C 1HNZC 4DCTA 2E5LC 2CY1A 4BSZA 4JI8C 1USPB 1XNRC 4X62C 1VLAA 4DR2C 3R9XA 1K0RA 4DV6C 4AQYC 4LF6C 4DUYC 5FLXD 1ZB8A 3LUSA 1IBKC 2BJOA 3T1YC 1WF3A 4LF8C 3JAMD 4DV7C 1J5EC 4LFAC 1ZB9A 2F4VC 5IWAC 4JI7C 1XMOC 4B3RC 4YHHC 1N32C 1EGAA 4LF5C 4JI4C 1ML8A 1L2FA 1USPA 2E7GA 4OX9C 2EGTA 4DR6C 1JOSA 4JI1C 4DCUA 2HJGA 4GKKC 1IBLC 1MKYA 1WH9A 4JYAC 2UXCC 5BR8C 2KZFA 4DV4C 1FJGC 3AF5A 2ZM6C 4B3MC 4LFCC 4YY3C 4MH4A 4DV2C 4DR3C 2CXCA 5IT9D 2UUBC 4KHPC 1N33C 2PT7G 4LF7C 4DV1C 1UKKA 2D7VA 3EERA 1HH2P 1PA4A 2UU9C 4LFBC 2JMPA 4DV3C 2QL8A 4K0KC 4B3TC 4DV0C 2VQFC 4JI6C 1N36C 4JI5C 1XNQC 4XX2A 1XMQC 3CJEA 4LF4C 2PN2A 1HR0C 3OTOC 2ATWA 2OPLB 2XR1A 5LMNC 1HNXC 1HNWC 5LMUC 2UXBC 1N34C 3GKUA 4DCVA 2HHHC 2E8CA 2UXDC 4DR1C 2ONFA 4NXNC 3J80D 3J81D 3AF6A 4LF9C 2ASBA 5A2QD 4DR5C 3R9WA 4X65C 4DR4C 4DCSA 4DV5C 1N2FA 4JI2C 4X66C 2OPLA 3IEVA 4MTNA 1IBMC 3I07A 1NYEA 4JI3C 4B3SC 1LQLA 1KKGA 4GKJC 2DYJA 4JI0C 2UUCC 3J7AD
chains in the Genus database with same CATH superfamily
3VNSA 4NOZA 2QW0X 1I94C 3LNVA 1BA3A 1RY2A 2CY1A 3A26A 5AE3A 1XNRC 1NY8A 1VLAA 3R9XA 5FLXD 1RG9A 1XS3A 3JAMD 3I08A 1J5EC 2V7BA 3LNOA 1XMOC 4YHHC 3TUFA 4LF5C 5A19A 1L2FA 5CZVA 4NDNA 5BURA 4RM2A 2HJGA 4K0BA 5BR8C 3CQ3A 2ZM6C 3VNRA 4LFCC 5BUSA 2MM9A 2UUBC 4L2ZA 5T8SA 4LF7C 4DV1C 1UKKA 4RVOA 5DV9A 4D4GA 3ETOA 4LFBC 3A9VA 3RG2A 4DV0C 2VQFC 1N36C 2PG1E 1IB8A 4LF4C 3CJEA 4G1IA 3FCEA 1HR0C 2XR1A 5LMNC 4PHTA 1HNXC 2UXBC 1ULTA 4WS9A 5A1GA 5KEIA 1M6XA 2ONFA 3J81D 3AF6A 3A25A 2P2JA 4DV5C 3TR3A 4U5YD 2VSQA 5H9UA 2CU6A 3NPDA 1T5DX 1QM4A 1LQLA 4BC9A 4FTFA 2DYJA 2UUCC 4LF8C 2DPLA 2M5HA 2UUAC 5GTDA 3UX2A 2JNVA 2D27A 1YGTA 4JV5C 1MXAA 1HNZC 3UZ0A 2P2FA 1USPB 4GXQA 4DR2C 4AQYC 2OBVA 3LUSA 2BJOA 3T1YC 4GS5A 3TQIA 3N2QA 1PG3A 4DV7C 4JI7C 4B3RC 3B7WA 2Y4OA 2WD9A 5JRHA 2D1RA 4DCUA 3C5EA 1MKYA 2P02A 4JYAC 3DLPX 4TPSB 2KZFA 2QVYX 1FJGC 3SO4A 3AF5A 4YY3C 2NCLA 1PG4A 5BSRA 5CZXA 1FUGA 5KYVA 1XRAA 2D7VA 1HH2P 3VNQA 4RVNA 3IMLA 2ZZMA 4G36A 1MDBA 4DV3C 4K0KC 3FM7A 1XMQC 2OPLB 3LAXA 1GPMA 5BSMA 1N34C 2YX1A 1M6XC 2E8CA 4NXNC 3J80D 4G37A 5A2QD 1MXCA 3R9WA 4BBYA 3GR1A 4R1LA 4DG9A 5BSTA 4ZJZA 3H2TA 4MTNA 5KYTA 3I07A 2P20A 3L8CA 4B3SC 4GKJC 1XRBA 3J7AD 4WV3A 3CW8X 2YCBA 4EATA 3UEBA 4NXMC 4DUZC 3T1HC 3LGXA 1TH5A 4JM1A 1LCIA 4GXRA 4DR7C 2QVZX 4X64C 4DCTA 2E5LC 4BSZA 1MXBA 4D57A 1K0RA 5BSVA 4LF6C 2D1SA 3DHVA 3ETCA 3R44A 2F4VC 2P2MA 3PBKA 5IWAC 4R1MA 3PESA 2MCQA 1N32C 3S82A 1P7LA 3AY0A 4JI4C 1ML8A 3L95X 1USPA 3A4IA 2EGTA 3DAYA 4DR6C 4PUIA 1JOSA 4JI1C 2Z51A 1IBLC 1P4EA 1WH9A 4RMNA 3E7WA 3IPLA 3CQ2A 3E7XA 3FCCA 4B3MC 2KZ0A 2ZZNA 5IT9D 4DR3C 2CXCA 3CQ1A 4D56A 4BC7A 4RLFA 3RV2A 1PA4A 1MDFA 5K85A 3NI2A 4JI5C 4XX2A 2PN2A 3OTOC 2ATWA 5A1IA 3K6RA 1HNWC 1O93A 1V26A 5LMUC 2E0GA 5BUQA 2YWCA 2HHHC 2AYAA 4L4QA 1V25A 4KTVA 2YWBA 4DR1C 1XRCA 2WP0C 1MD9A 4DR5C 1FLOA 2Y27A 4DR4C 4DCSA 4I9FA 3NYRA 4JI2C 3EQ6A 2OPLA 4PUGA 3A9UA 3N54B 4JI3C 3GR0A 4D4IA 3KXWA 1YJ7A 4ZLPA 3IEUA 2E8EA 4I9GA 5BSUA 4LE5A 3UOWA 2VQEC 4KTTA 2E8FA 3GPCA 1QWIA 1O92A 4JI8C 4X62C 4IR7A 4DV6C 4DUYC 1ZB8A 1IBKC 1WF3A 2VZEA 5AE1A 4LFAC 1ZB9A 1O90A 2D1QA 1EGAA 4DG8A 5BSWA 2E7GA 4OX9C 5E7QA 1P4EC 4FUTA 4GKKC 3G7SA 3O2EA 2UXCC 1XDXA 5AE2A 4L7IA 4DV4C 3PROC 1T5HX 3UX3A 2QVXX 1AMUA 3TDEA 2BH1X 4MH4A 4DV2C 4KHPC 1N33C 2PT7G 5T8TA 3EERA 2P2BA 1UWDA 1V60A 1VEHA 4BCAA 2UU9C 2JMPA 5LCIA 2MMAB 1XHJA 2QL8A 4PROC 4B3TC 4JI6C 5K8FA 3NYQA 3CW9A 2D28C 1XNQC 4ODJA 1PU1A 4RM3A 1WCJA 2P2QA 3GKUA 4ISBA 4DCVA 4PUHA 2D1TA 2OO4A 4FUQA 2ZTBA 2UXDC 4OXIA 5IFIA 4LF9C 2ASBA 4PZPA 1O9TA 2KDNA 4X65C 4R0MA 1N2FA 2DHMA 4X66C 4IZ6A 2Y4NA 5ADZA 4OYCA 3IEVA 2PROA 1IBMC 1NYEA 2M5OA 4RLQA 1KKGA 4JI0C 4HPVA
chains in the Genus database with same CATH topology
3VNSA 4NOZA 2QW0X 1I94C 3LNVA 1BA3A 1RY2A 2CY1A 5AE3A 1XNRC 1VLAA 3R9XA 5FLXD 1RG9A 3JAMD 3I08A 1J5EC 2V7BA 1XMOC 4YHHC 3TUFA 4LF5C 5A19A 1L2FA 5CZVA 4NDNA 5BURA 4RM2A 2HJGA 4K0BA 5BR8C 2ZM6C 3VNRA 4LFCC 5BUSA 2UUBC 4L2ZA 5T8SA 4LF7C 4DV1C 1UKKA 4RVOA 5DV9A 4D4GA 3ETOA 4LFBC 3A9VA 3RG2A 4DV0C 2VQFC 1N36C 4LF4C 3CJEA 4G1IA 3FCEA 1HR0C 2XR1A 5LMNC 4PHTA 1HNXC 2UXBC 1ULTA 4WS9A 5A1GA 5KEIA 2ONFA 3J81D 3AF6A 2P2JA 4DV5C 4U5YD 2VSQA 5H9UA 3NPDA 1T5DX 1QM4A 1LQLA 4BC9A 4FTFA 2DYJA 2UUCC 4LF8C 2DPLA 2UUAC 5GTDA 2D27A 4JV5C 1MXAA 1HNZC 3UZ0A 2P2FA 1USPB 4GXQA 4DR2C 4AQYC 2OBVA 3LUSA 2BJOA 3T1YC 4GS5A 3TQIA 3N2QA 1PG3A 4DV7C 4JI7C 4B3RC 3B7WA 2Y4OA 2WD9A 5JRHA 2D1RA 4DCUA 3C5EA 1MKYA 2P02A 4JYAC 3DLPX 4TPSB 2KZFA 2QVYX 1FJGC 3SO4A 3AF5A 4YY3C 1PG4A 5BSRA 5CZXA 1FUGA 5KYVA 1XRAA 2D7VA 1HH2P 3VNQA 4RVNA 3IMLA 4G36A 1MDBA 4DV3C 4K0KC 1XMQC 2OPLB 3LAXA 1GPMA 5BSMA 1N34C 2E8CA 4NXNC 3J80D 4G37A 5A2QD 1MXCA 3R9WA 4BBYA 3GR1A 4R1LA 4DG9A 5BSTA 4ZJZA 3H2TA 4MTNA 5KYTA 3I07A 2P20A 3L8CA 4B3SC 4GKJC 1XRBA 3J7AD 4WV3A 3CW8X 2YCBA 4EATA 4NXMC 4DUZC 3T1HC 3LGXA 4JM1A 1LCIA 4GXRA 4DR7C 2QVZX 4X64C 4DCTA 2E5LC 4BSZA 1MXBA 4D57A 1K0RA 5BSVA 4LF6C 2D1SA 3DHVA 3ETCA 3R44A 2F4VC 2P2MA 3PBKA 5IWAC 4R1MA 3PESA 1N32C 3S82A 1P7LA 4JI4C 1ML8A 3L95X 1USPA 3A4IA 2EGTA 3DAYA 4DR6C 1JOSA 4JI1C 1IBLC 1WH9A 4RMNA 3E7WA 3IPLA 3E7XA 3FCCA 4B3MC 5IT9D 4DR3C 2CXCA 4D56A 4BC7A 4RLFA 3RV2A 1PA4A 1MDFA 5K85A 3NI2A 4JI5C 4XX2A 2PN2A 3OTOC 2ATWA 5A1IA 1HNWC 1O93A 1V26A 5LMUC 2E0GA 5BUQA 2YWCA 2HHHC 2AYAA 4L4QA 1V25A 4KTVA 2YWBA 4DR1C 1XRCA 2WP0C 1MD9A 4DR5C 2Y27A 4DR4C 4DCSA 4I9FA 3NYRA 4JI2C 3EQ6A 2OPLA 3A9UA 3N54B 4JI3C 3GR0A 4D4IA 3KXWA 1YJ7A 4ZLPA 3IEUA 2E8EA 4I9GA 5BSUA 4LE5A 3UOWA 2VQEC 4KTTA 2E8FA 3GPCA 1QWIA 1O92A 4JI8C 4X62C 4IR7A 4DV6C 4DUYC 1ZB8A 1IBKC 1WF3A 2VZEA 5AE1A 4LFAC 1ZB9A 1O90A 2D1QA 1EGAA 4DG8A 5BSWA 2E7GA 4OX9C 5E7QA 4FUTA 4GKKC 3G7SA 2UXCC 5AE2A 4L7IA 4DV4C 3PROC 1T5HX 2QVXX 1AMUA 3TDEA 2BH1X 4MH4A 4DV2C 4KHPC 1N33C 2PT7G 5T8TA 3EERA 2P2BA 4BCAA 2UU9C 2JMPA 2QL8A 4PROC 4B3TC 4JI6C 5K8FA 3NYQA 3CW9A 2D28C 1XNQC 4ODJA 4RM3A 2P2QA 3GKUA 4ISBA 4DCVA 2D1TA 2OO4A 4FUQA 2UXDC 4OXIA 5IFIA 4LF9C 2ASBA 4PZPA 1O9TA 4X65C 4R0MA 1N2FA 4X66C 4IZ6A 2Y4NA 5ADZA 4OYCA 3IEVA 2PROA 1IBMC 1NYEA 4RLQA 1KKGA 4JI0C 4HPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YCB A;  3IEU A;  2E8E A;  2UUA C;  4NXM C;  4NOZ A;  4DUZ C;  2VQE C;  3T1H C;  2E8F A;  1I94 C;  4DR7 C;  1QWI A;  4X64 C;  4JV5 C;  1HNZ C;  4DCT A;  2E5L C;  2CY1 A;  4BSZ A;  4JI8 C;  1USP B;  1XNR C;  4X62 C;  1VLA A;  4DR2 C;  3R9X A;  1K0R A;  4DV6 C;  4AQY C;  4LF6 C;  4DUY C;  5FLX D;  1ZB8 A;  3LUS A;  1IBK C;  2BJO A;  3T1Y C;  1WF3 A;  4LF8 C;  3JAM D;  4DV7 C;  1J5E C;  4LFA C;  1ZB9 A;  2F4V C;  5IWA C;  4JI7 C;  1XMO C;  4B3R C;  4YHH C;  1N32 C;  1EGA A;  4LF5 C;  4JI4 C;  1ML8 A;  1L2F A;  1USP A;  2E7G A;  4OX9 C;  2EGT A;  4DR6 C;  1JOS A;  4JI1 C;  4DCU A;  2HJG A;  4GKK C;  1IBL C;  1MKY A;  1WH9 A;  4JYA C;  2UXC C;  5BR8 C;  2KZF A;  4DV4 C;  1FJG C;  3AF5 A;  2ZM6 C;  4B3M C;  4LFC C;  4YY3 C;  4MH4 A;  4DV2 C;  4DR3 C;  2CXC A;  5IT9 D;  2UUB C;  4KHP C;  1N33 C;  2PT7 G;  4LF7 C;  4DV1 C;  1UKK A;  2D7V A;  3EER A;  1HH2 P;  1PA4 A;  2UU9 C;  4LFB C;  2JMP A;  4DV3 C;  2QL8 A;  4K0K C;  4B3T C;  4DV0 C;  2VQF C;  4JI6 C;  1N36 C;  4JI5 C;  1XNQ C;  4XX2 A;  1XMQ C;  3CJE A;  4LF4 C;  2PN2 A;  1HR0 C;  3OTO C;  2ATW A;  2OPL B;  2XR1 A;  5LMN C;  1HNX C;  1HNW C;  5LMU C;  2UXB C;  1N34 C;  3GKU A;  4DCV A;  2HHH C;  2E8C A;  2UXD C;  4DR1 C;  2ONF A;  4NXN C;  3J80 D;  3J81 D;  3AF6 A;  4LF9 C;  2ASB A;  5A2Q D;  4DR5 C;  3R9W A;  4X65 C;  4DR4 C;  4DCS A;  4DV5 C;  1N2F A;  4JI2 C;  4X66 C;  2OPL A;  3IEV A;  4MTN A;  1IBM C;  3I07 A;  1NYE A;  4JI3 C;  4B3S C;  1LQL A;  1KKG A;  4GKJ C;  2DYJ A;  4JI0 C;  2UUC C;  3J7A D; 
#chains in the Genus database with same CATH topology
 3VNS A;  4NOZ A;  2QW0 X;  1I94 C;  3LNV A;  1BA3 A;  1RY2 A;  2CY1 A;  3A26 A;  5AE3 A;  1XNR C;  1NY8 A;  1VLA A;  3R9X A;  5FLX D;  1RG9 A;  1XS3 A;  3JAM D;  3I08 A;  1J5E C;  2V7B A;  3LNO A;  1XMO C;  4YHH C;  3TUF A;  4LF5 C;  5A19 A;  1L2F A;  5CZV A;  4NDN A;  5BUR A;  4RM2 A;  2HJG A;  4K0B A;  5BR8 C;  3CQ3 A;  2ZM6 C;  3VNR A;  4LFC C;  5BUS A;  2MM9 A;  2UUB C;  4L2Z A;  5T8S A;  4LF7 C;  4DV1 C;  1UKK A;  4RVO A;  5DV9 A;  4D4G A;  3ETO A;  4LFB C;  3A9V A;  3RG2 A;  4DV0 C;  2VQF C;  1N36 C;  2PG1 E;  1IB8 A;  4LF4 C;  3CJE A;  4G1I A;  3FCE A;  1HR0 C;  2XR1 A;  5LMN C;  4PHT A;  1HNX C;  2UXB C;  1ULT A;  4WS9 A;  5A1G A;  5KEI A;  1M6X A;  2ONF A;  3J81 D;  3AF6 A;  3A25 A;  2P2J A;  4DV5 C;  3TR3 A;  4U5Y D;  2VSQ A;  5H9U A;  2CU6 A;  3NPD A;  1T5D X;  1QM4 A;  1LQL A;  4BC9 A;  4FTF A;  2DYJ A;  2UUC C;  4LF8 C;  2DPL A;  2M5H A;  2UUA C;  5GTD A;  3UX2 A;  2JNV A;  2D27 A;  1YGT A;  4JV5 C;  1MXA A;  1HNZ C;  3UZ0 A;  2P2F A;  1USP B;  4GXQ A;  4DR2 C;  4AQY C;  2OBV A;  3LUS A;  2BJO A;  3T1Y C;  4GS5 A;  3TQI A;  3N2Q A;  1PG3 A;  4DV7 C;  4JI7 C;  4B3R C;  3B7W A;  2Y4O A;  2WD9 A;  5JRH A;  2D1R A;  4DCU A;  3C5E A;  1MKY A;  2P02 A;  4JYA C;  3DLP X;  4TPS B;  2KZF A;  2QVY X;  1FJG C;  3SO4 A;  3AF5 A;  4YY3 C;  2NCL A;  1PG4 A;  5BSR A;  5CZX A;  1FUG A;  5KYV A;  1XRA A;  2D7V A;  1HH2 P;  3VNQ A;  4RVN A;  3IML A;  2ZZM A;  4G36 A;  1MDB A;  4DV3 C;  4K0K C;  3FM7 A;  1XMQ C;  2OPL B;  3LAX A;  1GPM A;  5BSM A;  1N34 C;  2YX1 A;  1M6X C;  2E8C A;  4NXN C;  3J80 D;  4G37 A;  5A2Q D;  1MXC A;  3R9W A;  4BBY A;  3GR1 A;  4R1L A;  4DG9 A;  5BST A;  4ZJZ A;  3H2T A;  4MTN A;  5KYT A;  3I07 A;  2P20 A;  3L8C A;  4B3S C;  4GKJ C;  1XRB A;  3J7A D;  4WV3 A;  3CW8 X;  2YCB A;  4EAT A;  3UEB A;  4NXM C;  4DUZ C;  3T1H C;  3LGX A;  1TH5 A;  4JM1 A;  1LCI A;  4GXR A;  4DR7 C;  2QVZ X;  4X64 C;  4DCT A;  2E5L C;  4BSZ A;  1MXB A;  4D57 A;  1K0R A;  5BSV A;  4LF6 C;  2D1S A;  3DHV A;  3ETC A;  3R44 A;  2F4V C;  2P2M A;  3PBK A;  5IWA C;  4R1M A;  3PES A;  2MCQ A;  1N32 C;  3S82 A;  1P7L A;  3AY0 A;  4JI4 C;  1ML8 A;  3L95 X;  1USP A;  3A4I A;  2EGT A;  3DAY A;  4DR6 C;  4PUI A;  1JOS A;  4JI1 C;  2Z51 A;  1IBL C;  1P4E A;  1WH9 A;  4RMN A;  3E7W A;  3IPL A;  3CQ2 A;  3E7X A;  3FCC A;  4B3M C;  2KZ0 A;  2ZZN A;  5IT9 D;  4DR3 C;  2CXC A;  3CQ1 A;  4D56 A;  4BC7 A;  4RLF A;  3RV2 A;  1PA4 A;  1MDF A;  5K85 A;  3NI2 A;  4JI5 C;  4XX2 A;  2PN2 A;  3OTO C;  2ATW A;  5A1I A;  3K6R A;  1HNW C;  1O93 A;  1V26 A;  5LMU C;  2E0G A;  5BUQ A;  2YWC A;  2HHH C;  2AYA A;  4L4Q A;  1V25 A;  4KTV A;  2YWB A;  4DR1 C;  1XRC A;  2WP0 C;  1MD9 A;  4DR5 C;  1FLO A;  2Y27 A;  4DR4 C;  4DCS A;  4I9F A;  3NYR A;  4JI2 C;  3EQ6 A;  2OPL A;  4PUG A;  3A9U A;  3N54 B;  4JI3 C;  3GR0 A;  4D4I A;  3KXW A;  1YJ7 A;  4ZLP A;  3IEU A;  2E8E A;  4I9G A;  5BSU A;  4LE5 A;  3UOW A;  2VQE C;  4KTT A;  2E8F A;  3GPC A;  1QWI A;  1O92 A;  4JI8 C;  4X62 C;  4IR7 A;  4DV6 C;  4DUY C;  1ZB8 A;  1IBK C;  1WF3 A;  2VZE A;  5AE1 A;  4LFA C;  1ZB9 A;  1O90 A;  2D1Q A;  1EGA A;  4DG8 A;  5BSW A;  2E7G A;  4OX9 C;  5E7Q A;  1P4E C;  4FUT A;  4GKK C;  3G7S A;  3O2E A;  2UXC C;  1XDX A;  5AE2 A;  4L7I A;  4DV4 C;  3PRO C;  1T5H X;  3UX3 A;  2QVX X;  1AMU A;  3TDE A;  2BH1 X;  4MH4 A;  4DV2 C;  4KHP C;  1N33 C;  2PT7 G;  5T8T A;  3EER A;  2P2B A;  1UWD A;  1V60 A;  1VEH A;  4BCA A;  2UU9 C;  2JMP A;  5LCI A;  2MMA B;  1XHJ A;  2QL8 A;  4PRO C;  4B3T C;  4JI6 C;  5K8F A;  3NYQ A;  3CW9 A;  2D28 C;  1XNQ C;  4ODJ A;  1PU1 A;  4RM3 A;  1WCJ A;  2P2Q A;  3GKU A;  4ISB A;  4DCV A;  4PUH A;  2D1T A;  2OO4 A;  4FUQ A;  2ZTB A;  2UXD C;  4OXI A;  5IFI A;  4LF9 C;  2ASB A;  4PZP A;  1O9T A;  2KDN A;  4X65 C;  4R0M A;  1N2F A;  2DHM A;  4X66 C;  4IZ6 A;  2Y4N A;  5ADZ A;  4OYC A;  3IEV A;  2PRO A;  1IBM C;  1NYE A;  2M5O A;  4RLQ A;  1KKG A;  4JI0 C;  4HPV A; 
#chains in the Genus database with same CATH homology
 3VNS A;  4NOZ A;  2QW0 X;  1I94 C;  3LNV A;  1BA3 A;  1RY2 A;  2CY1 A;  5AE3 A;  1XNR C;  1VLA A;  3R9X A;  5FLX D;  1RG9 A;  3JAM D;  3I08 A;  1J5E C;  2V7B A;  1XMO C;  4YHH C;  3TUF A;  4LF5 C;  5A19 A;  1L2F A;  5CZV A;  4NDN A;  5BUR A;  4RM2 A;  2HJG A;  4K0B A;  5BR8 C;  2ZM6 C;  3VNR A;  4LFC C;  5BUS A;  2UUB C;  4L2Z A;  5T8S A;  4LF7 C;  4DV1 C;  1UKK A;  4RVO A;  5DV9 A;  4D4G A;  3ETO A;  4LFB C;  3A9V A;  3RG2 A;  4DV0 C;  2VQF C;  1N36 C;  4LF4 C;  3CJE A;  4G1I A;  3FCE A;  1HR0 C;  2XR1 A;  5LMN C;  4PHT A;  1HNX C;  2UXB C;  1ULT A;  4WS9 A;  5A1G A;  5KEI A;  2ONF A;  3J81 D;  3AF6 A;  2P2J A;  4DV5 C;  4U5Y D;  2VSQ A;  5H9U A;  3NPD A;  1T5D X;  1QM4 A;  1LQL A;  4BC9 A;  4FTF A;  2DYJ A;  2UUC C;  4LF8 C;  2DPL A;  2UUA C;  5GTD A;  2D27 A;  4JV5 C;  1MXA A;  1HNZ C;  3UZ0 A;  2P2F A;  1USP B;  4GXQ A;  4DR2 C;  4AQY C;  2OBV A;  3LUS A;  2BJO A;  3T1Y C;  4GS5 A;  3TQI A;  3N2Q A;  1PG3 A;  4DV7 C;  4JI7 C;  4B3R C;  3B7W A;  2Y4O A;  2WD9 A;  5JRH A;  2D1R A;  4DCU A;  3C5E A;  1MKY A;  2P02 A;  4JYA C;  3DLP X;  4TPS B;  2KZF A;  2QVY X;  1FJG C;  3SO4 A;  3AF5 A;  4YY3 C;  1PG4 A;  5BSR A;  5CZX A;  1FUG A;  5KYV A;  1XRA A;  2D7V A;  1HH2 P;  3VNQ A;  4RVN A;  3IML A;  4G36 A;  1MDB A;  4DV3 C;  4K0K C;  1XMQ C;  2OPL B;  3LAX A;  1GPM A;  5BSM A;  1N34 C;  2E8C A;  4NXN C;  3J80 D;  4G37 A;  5A2Q D;  1MXC A;  3R9W A;  4BBY A;  3GR1 A;  4R1L A;  4DG9 A;  5BST A;  4ZJZ A;  3H2T A;  4MTN A;  5KYT A;  3I07 A;  2P20 A;  3L8C A;  4B3S C;  4GKJ C;  1XRB A;  3J7A D;  4WV3 A;  3CW8 X;  2YCB A;  4EAT A;  4NXM C;  4DUZ C;  3T1H C;  3LGX A;  4JM1 A;  1LCI A;  4GXR A;  4DR7 C;  2QVZ X;  4X64 C;  4DCT A;  2E5L C;  4BSZ A;  1MXB A;  4D57 A;  1K0R A;  5BSV A;  4LF6 C;  2D1S A;  3DHV A;  3ETC A;  3R44 A;  2F4V C;  2P2M A;  3PBK A;  5IWA C;  4R1M A;  3PES A;  1N32 C;  3S82 A;  1P7L A;  4JI4 C;  1ML8 A;  3L95 X;  1USP A;  3A4I A;  2EGT A;  3DAY A;  4DR6 C;  1JOS A;  4JI1 C;  1IBL C;  1WH9 A;  4RMN A;  3E7W A;  3IPL A;  3E7X A;  3FCC A;  4B3M C;  5IT9 D;  4DR3 C;  2CXC A;  4D56 A;  4BC7 A;  4RLF A;  3RV2 A;  1PA4 A;  1MDF A;  5K85 A;  3NI2 A;  4JI5 C;  4XX2 A;  2PN2 A;  3OTO C;  2ATW A;  5A1I A;  1HNW C;  1O93 A;  1V26 A;  5LMU C;  2E0G A;  5BUQ A;  2YWC A;  2HHH C;  2AYA A;  4L4Q A;  1V25 A;  4KTV A;  2YWB A;  4DR1 C;  1XRC A;  2WP0 C;  1MD9 A;  4DR5 C;  2Y27 A;  4DR4 C;  4DCS A;  4I9F A;  3NYR A;  4JI2 C;  3EQ6 A;  2OPL A;  3A9U A;  3N54 B;  4JI3 C;  3GR0 A;  4D4I A;  3KXW A;  1YJ7 A;  4ZLP A;  3IEU A;  2E8E A;  4I9G A;  5BSU A;  4LE5 A;  3UOW A;  2VQE C;  4KTT A;  2E8F A;  3GPC A;  1QWI A;  1O92 A;  4JI8 C;  4X62 C;  4IR7 A;  4DV6 C;  4DUY C;  1ZB8 A;  1IBK C;  1WF3 A;  2VZE A;  5AE1 A;  4LFA C;  1ZB9 A;  1O90 A;  2D1Q A;  1EGA A;  4DG8 A;  5BSW A;  2E7G A;  4OX9 C;  5E7Q A;  4FUT A;  4GKK C;  3G7S A;  2UXC C;  5AE2 A;  4L7I A;  4DV4 C;  3PRO C;  1T5H X;  2QVX X;  1AMU A;  3TDE A;  2BH1 X;  4MH4 A;  4DV2 C;  4KHP C;  1N33 C;  2PT7 G;  5T8T A;  3EER A;  2P2B A;  4BCA A;  2UU9 C;  2JMP A;  2QL8 A;  4PRO C;  4B3T C;  4JI6 C;  5K8F A;  3NYQ A;  3CW9 A;  2D28 C;  1XNQ C;  4ODJ A;  4RM3 A;  2P2Q A;  3GKU A;  4ISB A;  4DCV A;  2D1T A;  2OO4 A;  4FUQ A;  2UXD C;  4OXI A;  5IFI A;  4LF9 C;  2ASB A;  4PZP A;  1O9T A;  4X65 C;  4R0M A;  1N2F A;  4X66 C;  4IZ6 A;  2Y4N A;  5ADZ A;  4OYC A;  3IEV A;  2PRO A;  1IBM C;  1NYE A;  4RLQ A;  1KKG A;  4JI0 C;  4HPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...