4DR6C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 53
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr6C02
1PA4A 4JI8C 2F4VC 3AF6A 4DR3C 4DR6C 1MKYA 5IWAC 1ZB9A 3CJEA 3JAMD 4DV1C 4NOZA 4DR5C 4DV0C 1N32C 4LFBC 5IT9D 4X62C 2UUBC 4DV6C 1HNWC 4B3TC 2PN2A 2PT7G 2HJGA 1XNQC 3GKUA 4DCVA 2KZFA 3OTOC 4JV5C 4JI3C 1IBLC 1QWIA 4AQYC 1I94C 4JI7C 1VLAA 1HNZC 2CY1A 3T1HC 4OX9C 2ZM6C 2E5LC 4DUZC 4NXMC 4DR2C 1ML8A 2CXCA 4YY3C 4LFAC 4LF9C 4MTNA 4B3RC 2D7VA 2UXDC 5A2QD 1WF3A 2ONFA 1IBKC 4JI0C 1N36C 1IBMC 5BR8C 4DV2C 2E7GA 3EERA 1NYEA 3LUSA 2UXBC 4DUYC 4GKJC 4GKKC 1N2FA 1HR0C 5LMUC 2ASBA 4DV5C 4X64C 1FJGC 4DR1C 1EGAA 2ATWA 2UUCC 4JI5C 3IEUA 1K0RA 2JMPA 4X66C 1HH2P 4NXNC 1JOSA 3J7AD 2YCBA 3J80D 2BJOA 2VQEC 4JYAC 4LF8C 2UU9C 4DR4C 2OPLB 3T1YC 4BSZA 3IEVA 3R9XA 5LMNC 2EGTA 2VQFC 2E8CA 1XMOC 4DCUA 1ZB8A 1L2FA 2UUAC 2HHHC 1USPB 4LF7C 4JI2C 1J5EC 4JI1C 4DR7C 5FLXD 4LFCC 4LF4C 4KHPC 4X65C 3AF5A 1N33C 4DCTA 4JI4C 2E8EA 2XR1A 4B3MC 4LF5C 1XNRC 4JI6C 2DYJA 4K0KC 2UXCC 1WH9A 1N34C 3I07A 3R9WA 2OPLA 3J81D 1XMQC 4YHHC 4LF6C 1LQLA 4XX2A 4DV3C 2E8FA 4DV4C 4DCSA 1UKKA 2QL8A 4DV7C 4B3SC 4MH4A 1KKGA 1USPA 1HNXC
chains in the Genus database with same CATH superfamily
4JI8C 2VSQA 4DR6C 4ZLPA 3CJEA 3JAMD 4DV1C 4NOZA 3I08A 1N32C 1MXBA 3FCCA 1T5HX 4DV6C 2YWCA 2P20A 1XRCA 1XS3A 1FUGA 4DCVA 1QWIA 4AQYC 1I94C 4JI7C 1XHJA 4I9FA 2AYAA 5ADZA 1QM4A 3L8CA 3UOWA 4OX9C 1RG9A 2ZM6C 4NXMC 1P4EC 4YY3C 1VEHA 4LFAC 2QVZX 4B3RC 2UXDC 5A2QD 4RLFA 3TQIA 2E7GA 2MCQA 4BC9A 1NYEA 1PU1A 4DUYC 3A9UA 2WD9A 4IR7A 1UWDA 1FJGC 5BURA 1JOSA 3J7AD 2P2FA 4OXIA 2BJOA 3FCEA 4RLQA 2UU9C 3H2TA 2OPLB 3CQ2A 3R9XA 5LMNC 2P2JA 3PBKA 2YWBA 5K8FA 1V60A 1ZB8A 4JI1C 3E7XA 4LF4C 4R1MA 2UXCC 1MDFA 2Y27A 4YHHC 4ISBA 5CZVA 5K85A 2QL8A 1T5DX 4ODJA 4MH4A 2M5OA 1USPA 4L7IA 2V7BA 4NDNA 4DR5C 3N2QA 3PESA 5IT9D 2UUBC 3GR0A 1O9TA 2DPLA 3PROC 4B3TC 1XNQC 4I9GA 5CZXA 4IZ6A 1IBLC 4D4GA 1FLOA 4WS9A 1VLAA 3NYQA 2P2MA 1TH5A 3RV2A 1AMUA 4DUZC 4DR2C 2KDNA 4LF9C 4MTNA 1M6XC 3CQ3A 1P7LA 2D7VA 3UX2A 1MDBA 4R1LA 3O2EA 1WF3A 3E7WA 4DG9A 4HPVA 4DV2C 4PUGA 1NY8A 4KTTA 2UXBC 4GKJC 4GKKC 2M5HA 4PROC 1HR0C 4DR1C 2ATWA 2UUCC 2PG1E 5T8SA 4NXNC 3L95X 3B7WA 3DHVA 3J80D 2D1RA 2QVXX 4DR4C 4L4QA 3T1YC 4BSZA 1P4EA 3VNSA 5BSRA 1O93A 2EGTA 5KYVA 1MD9A 5H9UA 3N54B 2P02A 3SO4A 2PROA 2P2BA 4ZJZA 4U5YD 3EQ6A 1RY2A 5FLXD 1YGTA 3NYRA 4DG8A 1N33C 4L2ZA 5BSTA 2E8EA 4GS5A 5BSUA 5BSVA 4LF5C 2WP0C 2KZ0A 1WH9A 1N34C 3IMLA 3I07A 1XMQC 3UZ0A 4RM3A 4DV3C 4DV4C 5BSMA 4DV7C 4B3SC 1KKGA 3A4IA 5AE3A 2F4VC 3IPLA 3AF6A 4DR3C 1MKYA 3UEBA 5IWAC 1ZB9A 3VNRA 2CU6A 4D56A 4LFBC 1XRBA 3CW8X 1YJ7A 4GXRA 2PN2A 2PT7G 2KZFA 3OTOC 4JV5C 3TDEA 4FTFA 1HNZC 5A1GA 1LCIA 4GXQA 4G1IA 1PG3A 2E5LC 3C5EA 3CQ1A 1WCJA 4RM2A 4WV3A 1ULTA 3K6RA 2D1TA 3UX3A 2ONFA 1IBKC 2ZZMA 3LUSA 5BUQA 3CW9A 3LGXA 4K0BA 1EGAA 4JI5C 3LNOA 1K0RA 2JMPA 1HH2P 3DAYA 5LCIA 2OO4A 2YCBA 2VQEC 4JYAC 4LF8C 5A19A 4BC7A 2D1SA 3KXWA 4OYCA 3RG2A 5BUSA 3IEVA 2VQFC 1BA3A 2E8CA 2JNVA 3A9VA 5BSWA 1XMOC 4DCUA 5JRHA 2UUAC 1USPB 4BBYA 1J5EC 4DR7C 4X65C 1PG4A 2Y4NA 2XR1A 4B3MC 5E7QA 5KEIA 2DYJA 4D4IA 3R9WA 2OPLA 3NPDA 3J81D 4G37A 1LQLA 4XX2A 5AE1A 2E8FA 4JM1A 3A26A 4PHTA 4DCSA 3ETOA 4FUQA 1HNXC 4PUIA 1PA4A 4RMNA 4DV0C 2NCLA 3DLPX 3TUFA 4X62C 3FM7A 1MXCA 1HNWC 3LNVA 5KYTA 2YX1A 2HJGA 3GKUA 4KTVA 1XDXA 2MM9A 1XRAA 2D28C 4RVOA 4PUHA 4JI3C 2CY1A 2Z51A 3T1HC 3G7SA 4D57A 3TR3A 4TPSB 2ZZNA 1ML8A 2CXCA 1V25A 4G36A 3GPCA 5GTDA 4JI0C 1N36C 1IBMC 3VNQA 5BR8C 4BCAA 3EERA 2E0GA 4R0MA 2D27A 2Y4OA 1N2FA 5LMUC 3NI2A 2ASBA 4DV5C 4X64C 3LAXA 3IEUA 4FUTA 2QW0X 4X66C 2VZEA 3AY0A 3A25A 5IFIA 2D1QA 4EATA 2ZTBA 1V26A 2DHMA 3ETCA 1O90A 4PZPA 5AE2A 1L2FA 1GPMA 2HHHC 4LF7C 2QVYX 4JI2C 1M6XA 4LFCC 1IB8A 2MMAB 3AF5A 4KHPC 4DCTA 4JI4C 5DV9A 1O92A 3GR1A 1XNRC 5T8TA 4JI6C 2P2QA 4K0KC 2OBVA 3S82A 4RVNA 4LF6C 1UKKA 3R44A 4LE5A 5A1IA 2BH1X 1MXAA
chains in the Genus database with same CATH topology
4JI8C 2VSQA 4DR6C 4ZLPA 3CJEA 3JAMD 4DV1C 4NOZA 3I08A 1N32C 1MXBA 3FCCA 1T5HX 4DV6C 2YWCA 2P20A 1XRCA 1FUGA 4DCVA 1QWIA 4AQYC 1I94C 4JI7C 4I9FA 2AYAA 5ADZA 1QM4A 3L8CA 3UOWA 4OX9C 1RG9A 2ZM6C 4NXMC 4YY3C 4LFAC 2QVZX 4B3RC 2UXDC 5A2QD 4RLFA 3TQIA 2E7GA 4BC9A 1NYEA 4DUYC 3A9UA 2WD9A 4IR7A 1FJGC 5BURA 1JOSA 3J7AD 2P2FA 4OXIA 2BJOA 3FCEA 4RLQA 2UU9C 3H2TA 2OPLB 3R9XA 5LMNC 2P2JA 3PBKA 2YWBA 5K8FA 1ZB8A 4JI1C 3E7XA 4LF4C 4R1MA 2UXCC 1MDFA 2Y27A 4YHHC 4ISBA 5CZVA 5K85A 2QL8A 1T5DX 4ODJA 4MH4A 1USPA 4L7IA 2V7BA 4NDNA 4DR5C 3N2QA 3PESA 5IT9D 2UUBC 3GR0A 1O9TA 2DPLA 3PROC 4B3TC 1XNQC 4I9GA 5CZXA 4IZ6A 1IBLC 4D4GA 4WS9A 1VLAA 3NYQA 2P2MA 3RV2A 1AMUA 4DUZC 4DR2C 4LF9C 4MTNA 1P7LA 2D7VA 1MDBA 4R1LA 1WF3A 3E7WA 4DG9A 4HPVA 4DV2C 4KTTA 2UXBC 4GKJC 4GKKC 4PROC 1HR0C 4DR1C 2ATWA 2UUCC 5T8SA 4NXNC 3L95X 3B7WA 3DHVA 3J80D 2D1RA 2QVXX 4DR4C 4L4QA 3T1YC 4BSZA 3VNSA 5BSRA 1O93A 2EGTA 5KYVA 1MD9A 5H9UA 3N54B 2P02A 3SO4A 2PROA 2P2BA 4ZJZA 4U5YD 3EQ6A 1RY2A 5FLXD 3NYRA 4DG8A 1N33C 4L2ZA 5BSTA 2E8EA 4GS5A 5BSUA 5BSVA 4LF5C 2WP0C 1WH9A 1N34C 3IMLA 3I07A 1XMQC 3UZ0A 4RM3A 4DV3C 4DV4C 5BSMA 4DV7C 4B3SC 1KKGA 3A4IA 5AE3A 2F4VC 3IPLA 3AF6A 4DR3C 1MKYA 5IWAC 1ZB9A 3VNRA 4D56A 4LFBC 1XRBA 3CW8X 1YJ7A 4GXRA 2PN2A 2PT7G 2KZFA 3OTOC 4JV5C 3TDEA 4FTFA 1HNZC 5A1GA 1LCIA 4GXQA 4G1IA 1PG3A 2E5LC 3C5EA 4RM2A 4WV3A 1ULTA 2D1TA 2ONFA 1IBKC 3LUSA 5BUQA 3CW9A 3LGXA 4K0BA 1EGAA 4JI5C 1K0RA 2JMPA 1HH2P 3DAYA 2OO4A 2YCBA 2VQEC 4JYAC 4LF8C 5A19A 4BC7A 2D1SA 3KXWA 4OYCA 3RG2A 5BUSA 3IEVA 2VQFC 1BA3A 2E8CA 3A9VA 5BSWA 1XMOC 4DCUA 5JRHA 2UUAC 1USPB 4BBYA 1J5EC 4DR7C 4X65C 1PG4A 2Y4NA 2XR1A 4B3MC 5E7QA 5KEIA 2DYJA 4D4IA 3R9WA 2OPLA 3NPDA 3J81D 4G37A 1LQLA 4XX2A 5AE1A 2E8FA 4JM1A 4PHTA 4DCSA 3ETOA 4FUQA 1HNXC 1PA4A 4RMNA 4DV0C 3DLPX 3TUFA 4X62C 1MXCA 1HNWC 3LNVA 5KYTA 2HJGA 3GKUA 4KTVA 1XRAA 2D28C 4RVOA 4JI3C 2CY1A 3T1HC 3G7SA 4D57A 4TPSB 1ML8A 2CXCA 1V25A 4G36A 3GPCA 5GTDA 4JI0C 1N36C 1IBMC 3VNQA 5BR8C 4BCAA 3EERA 2E0GA 4R0MA 2D27A 2Y4OA 1N2FA 5LMUC 3NI2A 2ASBA 4DV5C 4X64C 3LAXA 3IEUA 4FUTA 2QW0X 2VZEA 4X66C 5IFIA 2D1QA 4EATA 1V26A 3ETCA 1O90A 4PZPA 5AE2A 1L2FA 1GPMA 2HHHC 4LF7C 2QVYX 4JI2C 4LFCC 4KHPC 3AF5A 4DCTA 4JI4C 5DV9A 1O92A 3GR1A 1XNRC 5T8TA 4JI6C 2P2QA 4K0KC 2OBVA 3S82A 4RVNA 4LF6C 1UKKA 3R44A 4LE5A 5A1IA 2BH1X 1MXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PA4 A;  4JI8 C;  2F4V C;  3AF6 A;  4DR3 C;  4DR6 C;  1MKY A;  5IWA C;  1ZB9 A;  3CJE A;  3JAM D;  4DV1 C;  4NOZ A;  4DR5 C;  4DV0 C;  1N32 C;  4LFB C;  5IT9 D;  4X62 C;  2UUB C;  4DV6 C;  1HNW C;  4B3T C;  2PN2 A;  2PT7 G;  2HJG A;  1XNQ C;  3GKU A;  4DCV A;  2KZF A;  3OTO C;  4JV5 C;  4JI3 C;  1IBL C;  1QWI A;  4AQY C;  1I94 C;  4JI7 C;  1VLA A;  1HNZ C;  2CY1 A;  3T1H C;  4OX9 C;  2ZM6 C;  2E5L C;  4DUZ C;  4NXM C;  4DR2 C;  1ML8 A;  2CXC A;  4YY3 C;  4LFA C;  4LF9 C;  4MTN A;  4B3R C;  2D7V A;  2UXD C;  5A2Q D;  1WF3 A;  2ONF A;  1IBK C;  4JI0 C;  1N36 C;  1IBM C;  5BR8 C;  4DV2 C;  2E7G A;  3EER A;  1NYE A;  3LUS A;  2UXB C;  4DUY C;  4GKJ C;  4GKK C;  1N2F A;  1HR0 C;  5LMU C;  2ASB A;  4DV5 C;  4X64 C;  1FJG C;  4DR1 C;  1EGA A;  2ATW A;  2UUC C;  4JI5 C;  3IEU A;  1K0R A;  2JMP A;  4X66 C;  1HH2 P;  4NXN C;  1JOS A;  3J7A D;  2YCB A;  3J80 D;  2BJO A;  2VQE C;  4JYA C;  4LF8 C;  2UU9 C;  4DR4 C;  2OPL B;  3T1Y C;  4BSZ A;  3IEV A;  3R9X A;  5LMN C;  2EGT A;  2VQF C;  2E8C A;  1XMO C;  4DCU A;  1ZB8 A;  1L2F A;  2UUA C;  2HHH C;  1USP B;  4LF7 C;  4JI2 C;  1J5E C;  4JI1 C;  4DR7 C;  5FLX D;  4LFC C;  4LF4 C;  4KHP C;  4X65 C;  3AF5 A;  1N33 C;  4DCT A;  4JI4 C;  2E8E A;  2XR1 A;  4B3M C;  4LF5 C;  1XNR C;  4JI6 C;  2DYJ A;  4K0K C;  2UXC C;  1WH9 A;  1N34 C;  3I07 A;  3R9W A;  2OPL A;  3J81 D;  1XMQ C;  4YHH C;  4LF6 C;  1LQL A;  4XX2 A;  4DV3 C;  2E8F A;  4DV4 C;  4DCS A;  1UKK A;  2QL8 A;  4DV7 C;  4B3S C;  4MH4 A;  1KKG A;  1USP A;  1HNX C; 
#chains in the Genus database with same CATH topology
 4JI8 C;  2VSQ A;  4DR6 C;  4ZLP A;  3CJE A;  3JAM D;  4DV1 C;  4NOZ A;  3I08 A;  1N32 C;  1MXB A;  3FCC A;  1T5H X;  4DV6 C;  2YWC A;  2P20 A;  1XRC A;  1XS3 A;  1FUG A;  4DCV A;  1QWI A;  4AQY C;  1I94 C;  4JI7 C;  1XHJ A;  4I9F A;  2AYA A;  5ADZ A;  1QM4 A;  3L8C A;  3UOW A;  4OX9 C;  1RG9 A;  2ZM6 C;  4NXM C;  1P4E C;  4YY3 C;  1VEH A;  4LFA C;  2QVZ X;  4B3R C;  2UXD C;  5A2Q D;  4RLF A;  3TQI A;  2E7G A;  2MCQ A;  4BC9 A;  1NYE A;  1PU1 A;  4DUY C;  3A9U A;  2WD9 A;  4IR7 A;  1UWD A;  1FJG C;  5BUR A;  1JOS A;  3J7A D;  2P2F A;  4OXI A;  2BJO A;  3FCE A;  4RLQ A;  2UU9 C;  3H2T A;  2OPL B;  3CQ2 A;  3R9X A;  5LMN C;  2P2J A;  3PBK A;  2YWB A;  5K8F A;  1V60 A;  1ZB8 A;  4JI1 C;  3E7X A;  4LF4 C;  4R1M A;  2UXC C;  1MDF A;  2Y27 A;  4YHH C;  4ISB A;  5CZV A;  5K85 A;  2QL8 A;  1T5D X;  4ODJ A;  4MH4 A;  2M5O A;  1USP A;  4L7I A;  2V7B A;  4NDN A;  4DR5 C;  3N2Q A;  3PES A;  5IT9 D;  2UUB C;  3GR0 A;  1O9T A;  2DPL A;  3PRO C;  4B3T C;  1XNQ C;  4I9G A;  5CZX A;  4IZ6 A;  1IBL C;  4D4G A;  1FLO A;  4WS9 A;  1VLA A;  3NYQ A;  2P2M A;  1TH5 A;  3RV2 A;  1AMU A;  4DUZ C;  4DR2 C;  2KDN A;  4LF9 C;  4MTN A;  1M6X C;  3CQ3 A;  1P7L A;  2D7V A;  3UX2 A;  1MDB A;  4R1L A;  3O2E A;  1WF3 A;  3E7W A;  4DG9 A;  4HPV A;  4DV2 C;  4PUG A;  1NY8 A;  4KTT A;  2UXB C;  4GKJ C;  4GKK C;  2M5H A;  4PRO C;  1HR0 C;  4DR1 C;  2ATW A;  2UUC C;  2PG1 E;  5T8S A;  4NXN C;  3L95 X;  3B7W A;  3DHV A;  3J80 D;  2D1R A;  2QVX X;  4DR4 C;  4L4Q A;  3T1Y C;  4BSZ A;  1P4E A;  3VNS A;  5BSR A;  1O93 A;  2EGT A;  5KYV A;  1MD9 A;  5H9U A;  3N54 B;  2P02 A;  3SO4 A;  2PRO A;  2P2B A;  4ZJZ A;  4U5Y D;  3EQ6 A;  1RY2 A;  5FLX D;  1YGT A;  3NYR A;  4DG8 A;  1N33 C;  4L2Z A;  5BST A;  2E8E A;  4GS5 A;  5BSU A;  5BSV A;  4LF5 C;  2WP0 C;  2KZ0 A;  1WH9 A;  1N34 C;  3IML A;  3I07 A;  1XMQ C;  3UZ0 A;  4RM3 A;  4DV3 C;  4DV4 C;  5BSM A;  4DV7 C;  4B3S C;  1KKG A;  3A4I A;  5AE3 A;  2F4V C;  3IPL A;  3AF6 A;  4DR3 C;  1MKY A;  3UEB A;  5IWA C;  1ZB9 A;  3VNR A;  2CU6 A;  4D56 A;  4LFB C;  1XRB A;  3CW8 X;  1YJ7 A;  4GXR A;  2PN2 A;  2PT7 G;  2KZF A;  3OTO C;  4JV5 C;  3TDE A;  4FTF A;  1HNZ C;  5A1G A;  1LCI A;  4GXQ A;  4G1I A;  1PG3 A;  2E5L C;  3C5E A;  3CQ1 A;  1WCJ A;  4RM2 A;  4WV3 A;  1ULT A;  3K6R A;  2D1T A;  3UX3 A;  2ONF A;  1IBK C;  2ZZM A;  3LUS A;  5BUQ A;  3CW9 A;  3LGX A;  4K0B A;  1EGA A;  4JI5 C;  3LNO A;  1K0R A;  2JMP A;  1HH2 P;  3DAY A;  5LCI A;  2OO4 A;  2YCB A;  2VQE C;  4JYA C;  4LF8 C;  5A19 A;  4BC7 A;  2D1S A;  3KXW A;  4OYC A;  3RG2 A;  5BUS A;  3IEV A;  2VQF C;  1BA3 A;  2E8C A;  2JNV A;  3A9V A;  5BSW A;  1XMO C;  4DCU A;  5JRH A;  2UUA C;  1USP B;  4BBY A;  1J5E C;  4DR7 C;  4X65 C;  1PG4 A;  2Y4N A;  2XR1 A;  4B3M C;  5E7Q A;  5KEI A;  2DYJ A;  4D4I A;  3R9W A;  2OPL A;  3NPD A;  3J81 D;  4G37 A;  1LQL A;  4XX2 A;  5AE1 A;  2E8F A;  4JM1 A;  3A26 A;  4PHT A;  4DCS A;  3ETO A;  4FUQ A;  1HNX C;  4PUI A;  1PA4 A;  4RMN A;  4DV0 C;  2NCL A;  3DLP X;  3TUF A;  4X62 C;  3FM7 A;  1MXC A;  1HNW C;  3LNV A;  5KYT A;  2YX1 A;  2HJG A;  3GKU A;  4KTV A;  1XDX A;  2MM9 A;  1XRA A;  2D28 C;  4RVO A;  4PUH A;  4JI3 C;  2CY1 A;  2Z51 A;  3T1H C;  3G7S A;  4D57 A;  3TR3 A;  4TPS B;  2ZZN A;  1ML8 A;  2CXC A;  1V25 A;  4G36 A;  3GPC A;  5GTD A;  4JI0 C;  1N36 C;  1IBM C;  3VNQ A;  5BR8 C;  4BCA A;  3EER A;  2E0G A;  4R0M A;  2D27 A;  2Y4O A;  1N2F A;  5LMU C;  3NI2 A;  2ASB A;  4DV5 C;  4X64 C;  3LAX A;  3IEU A;  4FUT A;  2QW0 X;  4X66 C;  2VZE A;  3AY0 A;  3A25 A;  5IFI A;  2D1Q A;  4EAT A;  2ZTB A;  1V26 A;  2DHM A;  3ETC A;  1O90 A;  4PZP A;  5AE2 A;  1L2F A;  1GPM A;  2HHH C;  4LF7 C;  2QVY X;  4JI2 C;  1M6X A;  4LFC C;  1IB8 A;  2MMA B;  3AF5 A;  4KHP C;  4DCT A;  4JI4 C;  5DV9 A;  1O92 A;  3GR1 A;  1XNR C;  5T8T A;  4JI6 C;  2P2Q A;  4K0K C;  2OBV A;  3S82 A;  4RVN A;  4LF6 C;  1UKK A;  3R44 A;  4LE5 A;  5A1I A;  2BH1 X;  1MXA A; 
#chains in the Genus database with same CATH homology
 4JI8 C;  2VSQ A;  4DR6 C;  4ZLP A;  3CJE A;  3JAM D;  4DV1 C;  4NOZ A;  3I08 A;  1N32 C;  1MXB A;  3FCC A;  1T5H X;  4DV6 C;  2YWC A;  2P20 A;  1XRC A;  1FUG A;  4DCV A;  1QWI A;  4AQY C;  1I94 C;  4JI7 C;  4I9F A;  2AYA A;  5ADZ A;  1QM4 A;  3L8C A;  3UOW A;  4OX9 C;  1RG9 A;  2ZM6 C;  4NXM C;  4YY3 C;  4LFA C;  2QVZ X;  4B3R C;  2UXD C;  5A2Q D;  4RLF A;  3TQI A;  2E7G A;  4BC9 A;  1NYE A;  4DUY C;  3A9U A;  2WD9 A;  4IR7 A;  1FJG C;  5BUR A;  1JOS A;  3J7A D;  2P2F A;  4OXI A;  2BJO A;  3FCE A;  4RLQ A;  2UU9 C;  3H2T A;  2OPL B;  3R9X A;  5LMN C;  2P2J A;  3PBK A;  2YWB A;  5K8F A;  1ZB8 A;  4JI1 C;  3E7X A;  4LF4 C;  4R1M A;  2UXC C;  1MDF A;  2Y27 A;  4YHH C;  4ISB A;  5CZV A;  5K85 A;  2QL8 A;  1T5D X;  4ODJ A;  4MH4 A;  1USP A;  4L7I A;  2V7B A;  4NDN A;  4DR5 C;  3N2Q A;  3PES A;  5IT9 D;  2UUB C;  3GR0 A;  1O9T A;  2DPL A;  3PRO C;  4B3T C;  1XNQ C;  4I9G A;  5CZX A;  4IZ6 A;  1IBL C;  4D4G A;  4WS9 A;  1VLA A;  3NYQ A;  2P2M A;  3RV2 A;  1AMU A;  4DUZ C;  4DR2 C;  4LF9 C;  4MTN A;  1P7L A;  2D7V A;  1MDB A;  4R1L A;  1WF3 A;  3E7W A;  4DG9 A;  4HPV A;  4DV2 C;  4KTT A;  2UXB C;  4GKJ C;  4GKK C;  4PRO C;  1HR0 C;  4DR1 C;  2ATW A;  2UUC C;  5T8S A;  4NXN C;  3L95 X;  3B7W A;  3DHV A;  3J80 D;  2D1R A;  2QVX X;  4DR4 C;  4L4Q A;  3T1Y C;  4BSZ A;  3VNS A;  5BSR A;  1O93 A;  2EGT A;  5KYV A;  1MD9 A;  5H9U A;  3N54 B;  2P02 A;  3SO4 A;  2PRO A;  2P2B A;  4ZJZ A;  4U5Y D;  3EQ6 A;  1RY2 A;  5FLX D;  3NYR A;  4DG8 A;  1N33 C;  4L2Z A;  5BST A;  2E8E A;  4GS5 A;  5BSU A;  5BSV A;  4LF5 C;  2WP0 C;  1WH9 A;  1N34 C;  3IML A;  3I07 A;  1XMQ C;  3UZ0 A;  4RM3 A;  4DV3 C;  4DV4 C;  5BSM A;  4DV7 C;  4B3S C;  1KKG A;  3A4I A;  5AE3 A;  2F4V C;  3IPL A;  3AF6 A;  4DR3 C;  1MKY A;  5IWA C;  1ZB9 A;  3VNR A;  4D56 A;  4LFB C;  1XRB A;  3CW8 X;  1YJ7 A;  4GXR A;  2PN2 A;  2PT7 G;  2KZF A;  3OTO C;  4JV5 C;  3TDE A;  4FTF A;  1HNZ C;  5A1G A;  1LCI A;  4GXQ A;  4G1I A;  1PG3 A;  2E5L C;  3C5E A;  4RM2 A;  4WV3 A;  1ULT A;  2D1T A;  2ONF A;  1IBK C;  3LUS A;  5BUQ A;  3CW9 A;  3LGX A;  4K0B A;  1EGA A;  4JI5 C;  1K0R A;  2JMP A;  1HH2 P;  3DAY A;  2OO4 A;  2YCB A;  2VQE C;  4JYA C;  4LF8 C;  5A19 A;  4BC7 A;  2D1S A;  3KXW A;  4OYC A;  3RG2 A;  5BUS A;  3IEV A;  2VQF C;  1BA3 A;  2E8C A;  3A9V A;  5BSW A;  1XMO C;  4DCU A;  5JRH A;  2UUA C;  1USP B;  4BBY A;  1J5E C;  4DR7 C;  4X65 C;  1PG4 A;  2Y4N A;  2XR1 A;  4B3M C;  5E7Q A;  5KEI A;  2DYJ A;  4D4I A;  3R9W A;  2OPL A;  3NPD A;  3J81 D;  4G37 A;  1LQL A;  4XX2 A;  5AE1 A;  2E8F A;  4JM1 A;  4PHT A;  4DCS A;  3ETO A;  4FUQ A;  1HNX C;  1PA4 A;  4RMN A;  4DV0 C;  3DLP X;  3TUF A;  4X62 C;  1MXC A;  1HNW C;  3LNV A;  5KYT A;  2HJG A;  3GKU A;  4KTV A;  1XRA A;  2D28 C;  4RVO A;  4JI3 C;  2CY1 A;  3T1H C;  3G7S A;  4D57 A;  4TPS B;  1ML8 A;  2CXC A;  1V25 A;  4G36 A;  3GPC A;  5GTD A;  4JI0 C;  1N36 C;  1IBM C;  3VNQ A;  5BR8 C;  4BCA A;  3EER A;  2E0G A;  4R0M A;  2D27 A;  2Y4O A;  1N2F A;  5LMU C;  3NI2 A;  2ASB A;  4DV5 C;  4X64 C;  3LAX A;  3IEU A;  4FUT A;  2QW0 X;  2VZE A;  4X66 C;  5IFI A;  2D1Q A;  4EAT A;  1V26 A;  3ETC A;  1O90 A;  4PZP A;  5AE2 A;  1L2F A;  1GPM A;  2HHH C;  4LF7 C;  2QVY X;  4JI2 C;  4LFC C;  4KHP C;  3AF5 A;  4DCT A;  4JI4 C;  5DV9 A;  1O92 A;  3GR1 A;  1XNR C;  5T8T A;  4JI6 C;  2P2Q A;  4K0K C;  2OBV A;  3S82 A;  4RVN A;  4LF6 C;  1UKK A;  3R44 A;  4LE5 A;  5A1I A;  2BH1 X;  1MXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...