4DR6C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 53
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr6C02
2BJOA 3R9XA 4DR4C 4KHPC 5LMNC 4LF7C 4LFAC 1N33C 1HNXC 3J7AD 4B3SC 1KKGA 1N2FA 2ZM6C 1ZB8A 1PA4A 2UUBC 4OX9C 2PT7G 4DV1C 4B3TC 4DCTA 3T1YC 1LQLA 3AF6A 2EGTA 4MH4A 4DR6C 2HHHC 3JAMD 2E7GA 2OPLA 5LMUC 4DR5C 4LF6C 2DYJA 3LUSA 1J5EC 1VLAA 2CXCA 2KZFA 1WF3A 4X66C 4LFBC 3I07A 4B3MC 4DV2C 4DR3C 2ATWA 4DV0C 2F4VC 1NYEA 4JI2C 4JV5C 4X64C 1XNRC 2UXCC 2ONFA 1EGAA 4YY3C 3J80D 1IBLC 4DV7C 2YCBA 4LF9C 1ZB9A 1USPB 1HH2P 1K0RA 2PN2A 1HR0C 1JOSA 4NXNC 3IEVA 2UXBC 4JI7C 4DR2C 1QWIA 4JI4C 2XR1A 4JI3C 4LFCC 1XMQC 4LF5C 3EERA 4JI8C 1XNQC 4DR1C 1HNZC 1N32C 4AQYC 2UUCC 4DCSA 4DV3C 4DUZC 4DV6C 2E8CA 2UXDC 4JI1C 3IEUA 1HNWC 1WH9A 4JI0C 4YHHC 5A2QD 4X62C 4NXMC 4XX2A 1N34C 2E8FA 2UUAC 4DV5C 2E8EA 3T1HC 4B3RC 4NOZA 1UKKA 2JMPA 2ASBA 1XMOC 1FJGC 4JYAC 1N36C 4LF4C 5BR8C 5IWAC 5IT9D 3R9WA 1IBMC 4LF8C 1L2FA 4DCVA 3AF5A 3OTOC 4GKJC 2QL8A 4DR7C 2HJGA 1USPA 2D7VA 1IBKC 1MKYA 3CJEA 2UU9C 4X65C 4GKKC 4BSZA 3J81D 5FLXD 2E5LC 2VQEC 2VQFC 4K0KC 3GKUA 4DCUA 1ML8A 4DUYC 4JI6C 4JI5C 2OPLB 4DV4C 1I94C 2CY1A 4MTNA
chains in the Genus database with same CATH superfamily
4ZLPA 4LFAC 1HNXC 2E0GA 4OX9C 2PT7G 3T1YC 4JM1A 5LCIA 5ADZA 2M5OA 3AF6A 3FCCA 1RG9A 2P2BA 5AE3A 3RV2A 2OPLA 4WS9A 4DR5C 4IZ6A 4U5YD 4ZJZA 3S82A 1T5DX 1MDFA 1TH5A 4R0MA 4B3MC 5GTDA 1UWDA 1MXBA 4DV2C 2F4VC 1XS3A 2UXCC 1XNRC 3NPDA 3J80D 2ZZNA 5BSMA 1LCIA 1XHJA 4DV7C 4NXNC 1K0RA 3LGXA 3ETOA 2UXBC 3VNRA 1GPMA 1QWIA 4JI4C 3TR3A 4LFCC 1YJ7A 4JI8C 1V60A 3KXWA 4PROC 2MM9A 3IEUA 4D4GA 2YWCA 4JI0C 5A1IA 1HNWC 4BC7A 4NXMC 2KZ0A 2UUAC 3A4IA 3E7XA 2E8EA 3IMLA 3T1HC 4B3RC 4NOZA 4JYAC 2Y4OA 1N36C 2YWBA 5IWAC 2YX1A 3UZ0A 3OTOC 2QL8A 4DR7C 1NY8A 2HJGA 4RM3A 2QW0X 5BURA 4L2ZA 1IBKC 1MKYA 3FCEA 2UU9C 4G36A 5FLXD 3PROC 3DAYA 4K0KC 4DCUA 3GR1A 5BSTA 4DUYC 5T8TA 2OPLB 3LNVA 3VNQA 4DR4C 5IFIA 4LF7C 1KKGA 4HPVA 1VEHA 4MH4A 2NCLA 5BSVA 3L8CA 4ODJA 2M5HA 4R1LA 2DYJA 3LUSA 5BUSA 1WF3A 4X66C 4LFBC 3I07A 3G7SA 2DPLA 3FM7A 4EATA 5CZXA 2ATWA 1NYEA 2ONFA 3LNOA 4LE5A 4ISBA 1USPB 3IPLA 2PN2A 1JOSA 3IEVA 4IR7A 4DR2C 4JI3C 5KYVA 1XMQC 1XNQC 1P4EC 2OO4A 4G37A 3UEBA 4DV3C 4DUZC 4GXQA 3GR0A 4JI1C 5BSUA 1WH9A 5BSRA 3CQ1A 1XRCA 1XDXA 1O92A 1IB8A 2DHMA 4KTTA 4BBYA 4DV5C 3A25A 4LF4C 4D56A 5BR8C 1IBMC 4LF8C 3H2TA 4RM2A 5A19A 4GKJC 4DCVA 4FUTA 4D4IA 2D1TA 1BA3A 3CW9A 1MD9A 2D7VA 4KTVA 4GKKC 3J81D 5BUQA 2E5LC 3GPCA 5AE1A 3I08A 3GKUA 5DV9A 4NDNA 2P2MA 1ML8A 2VZEA 4JI6C 1O90A 5BSWA 1I94C 3NI2A 2BJOA 3R9XA 3R44A 1N33C 3J7AD 2ZM6C 1PA4A 3NYQA 4B3TC 4PUIA 4PUHA 4PUGA 2BH1X 4BC9A 1YGTA 4DR6C 4DG9A 2HHHC 3JAMD 2E7GA 5LMUC 2D27A 2VSQA 3EQ6A 2P2JA 4DR3C 1MXCA 1EGAA 4YY3C 1MDBA 1HR0C 1HH2P 3TUFA 2AYAA 3TDEA 2Y27A 4JI7C 2XR1A 5K8FA 4R1MA 1N32C 1XRBA 2PROA 2WP0C 4DCSA 3E7WA 4DV6C 4RVOA 2UXDC 4RVNA 4X62C 4XX2A 1AMUA 1XRAA 2E8FA 3UX2A 1V26A 2JMPA 3PBKA 2ASBA 1XMOC 1FJGC 3NYRA 4TPSB 5IT9D 1FLOA 3DHVA 1O93A 2D1SA 4RLFA 3RG2A 2JNVA 1WCJA 1USPA 3A26A 2CU6A 3UOWA 5KEIA 4PHTA 2P20A 3CJEA 1PG3A 1FUGA 4X65C 4BSZA 1M6XC 2VQEC 2VQFC 3C5EA 1V25A 3L95X 2WD9A 2MMAB 2P02A 4DV4C 3VNSA 2CY1A 3O2EA 4KHPC 3SO4A 5LMNC 4OYCA 2OBVA 4RMNA 4B3SC 1N2FA 4K0BA 1ZB8A 2UUBC 1RY2A 4DV1C 2QVXX 3UX3A 2D1RA 4DCTA 1LQLA 3AY0A 2EGTA 1O9TA 5A1GA 5K85A 4FTFA 2QVZX 3A9UA 4DG8A 1P7LA 4BCAA 5E7QA 4PZPA 3PESA 4LF6C 5CZVA 3CQ2A 1J5EC 1VLAA 2CXCA 2D1QA 2KZFA 5T8SA 1PG4A 2Z51A 1QM4A 3CQ3A 4I9GA 3CW8X 4RLQA 4L7IA 3K6RA 4DV0C 4JI2C 4JV5C 4X64C 2D28C 2ZTBA 1IBLC 2PG1E 2YCBA 4LF9C 1ZB9A 1PU1A 4GS5A 2ZZMA 5AE2A 4FUQA 4LF5C 3EERA 4DR1C 3DLPX 1HNZC 4AQYC 2UUCC 2MCQA 2P2QA 2KDNA 2E8CA 4L4QA 3LAXA 4YHHC 1P4EA 5A2QD 3ETCA 1N34C 4GXRA 2V7BA 5H9UA 4WV3A 1ULTA 3N54B 1UKKA 4I9FA 4OXIA 3R9WA 1M6XA 1L2FA 2QVYX 3AF5A 4D57A 3A9VA 1T5HX 2P2FA 3N2QA 1MXAA 3TQIA 5JRHA 5KYTA 2Y4NA 4JI5C 3B7WA 4G1IA 4MTNA
chains in the Genus database with same CATH topology
4ZLPA 4LFAC 1HNXC 2E0GA 4OX9C 2PT7G 3T1YC 4JM1A 5ADZA 3AF6A 3FCCA 1RG9A 2P2BA 5AE3A 3RV2A 2OPLA 4WS9A 4DR5C 4IZ6A 4U5YD 4ZJZA 3S82A 1T5DX 1MDFA 4B3MC 4R0MA 5GTDA 1MXBA 4DV2C 2F4VC 2UXCC 1XNRC 3NPDA 3J80D 5BSMA 1LCIA 4DV7C 4NXNC 1K0RA 3LGXA 3ETOA 2UXBC 3VNRA 1GPMA 1QWIA 4JI4C 4LFCC 1YJ7A 4JI8C 3KXWA 4PROC 3IEUA 4D4GA 2YWCA 4JI0C 5A1IA 1HNWC 4BC7A 4NXMC 2UUAC 3A4IA 3E7XA 2E8EA 3IMLA 3T1HC 4B3RC 4NOZA 4JYAC 2Y4OA 1N36C 2YWBA 5IWAC 3UZ0A 3OTOC 2QL8A 4DR7C 2HJGA 4RM3A 2QW0X 5BURA 4L2ZA 1IBKC 1MKYA 3FCEA 2UU9C 4G36A 5FLXD 3PROC 3DAYA 4K0KC 4DCUA 3GR1A 5BSTA 4DUYC 5T8TA 2OPLB 3LNVA 3VNQA 4DR4C 5IFIA 4LF7C 1KKGA 4HPVA 4MH4A 5BSVA 3L8CA 4ODJA 4R1LA 2DYJA 3LUSA 5BUSA 1WF3A 4X66C 4LFBC 3I07A 3G7SA 2DPLA 4EATA 5CZXA 2ATWA 1NYEA 2ONFA 4LE5A 4ISBA 1USPB 3IPLA 2PN2A 1JOSA 3IEVA 4IR7A 4DR2C 4JI3C 5KYVA 1XMQC 1XNQC 2OO4A 4G37A 4DV3C 4DUZC 4GXQA 3GR0A 4JI1C 5BSUA 1WH9A 5BSRA 1XRCA 1O92A 4KTTA 4BBYA 4DV5C 4LF4C 4D56A 5BR8C 1IBMC 4LF8C 3H2TA 4RM2A 5A19A 4GKJC 4DCVA 4FUTA 4D4IA 2D1TA 1BA3A 3CW9A 1MD9A 2D7VA 4KTVA 4GKKC 3J81D 5BUQA 2E5LC 3GPCA 5AE1A 3I08A 3GKUA 5DV9A 4NDNA 2P2MA 1ML8A 2VZEA 4JI6C 1O90A 1I94C 5BSWA 3NI2A 2BJOA 3R9XA 3R44A 1N33C 3J7AD 2ZM6C 1PA4A 3NYQA 4B3TC 2BH1X 4BC9A 4DR6C 4DG9A 2HHHC 3JAMD 2E7GA 5LMUC 2D27A 2VSQA 3EQ6A 2P2JA 4DR3C 1MXCA 1EGAA 4YY3C 1MDBA 1HR0C 1HH2P 3TUFA 2AYAA 3TDEA 2Y27A 4JI7C 2XR1A 5K8FA 4R1MA 1N32C 1XRBA 2PROA 2WP0C 4DCSA 3E7WA 4DV6C 4RVOA 2UXDC 4RVNA 4X62C 4XX2A 1AMUA 1XRAA 2E8FA 1V26A 2JMPA 3PBKA 2ASBA 1XMOC 1FJGC 3NYRA 4TPSB 5IT9D 3DHVA 1O93A 2D1SA 4RLFA 3RG2A 1USPA 3UOWA 5KEIA 4PHTA 2P20A 3CJEA 1PG3A 1FUGA 4X65C 4BSZA 2VQEC 2VQFC 3C5EA 1V25A 3L95X 2WD9A 2P02A 4DV4C 3VNSA 2CY1A 4KHPC 3SO4A 5LMNC 4OYCA 2OBVA 4RMNA 4B3SC 1N2FA 4K0BA 1ZB8A 2UUBC 1RY2A 4DV1C 2QVXX 2D1RA 4DCTA 1LQLA 2EGTA 1O9TA 5A1GA 5K85A 4FTFA 2QVZX 3A9UA 4DG8A 1P7LA 4BCAA 5E7QA 4PZPA 3PESA 4LF6C 5CZVA 1J5EC 1VLAA 2CXCA 2D1QA 2KZFA 5T8SA 1PG4A 1QM4A 4I9GA 3CW8X 4RLQA 4L7IA 4DV0C 4JI2C 4JV5C 4X64C 2D28C 1IBLC 2YCBA 4LF9C 1ZB9A 4GS5A 5AE2A 4FUQA 4LF5C 3EERA 4DR1C 3DLPX 1HNZC 4AQYC 2UUCC 2P2QA 2E8CA 4L4QA 3LAXA 4YHHC 5A2QD 3ETCA 1N34C 4GXRA 2V7BA 5H9UA 4WV3A 1ULTA 3N54B 1UKKA 4I9FA 4OXIA 3R9WA 1L2FA 2QVYX 3AF5A 4D57A 3A9VA 1T5HX 2P2FA 3N2QA 1MXAA 3TQIA 5JRHA 5KYTA 2Y4NA 4JI5C 3B7WA 4G1IA 4MTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJO A;  3R9X A;  4DR4 C;  4KHP C;  5LMN C;  4LF7 C;  4LFA C;  1N33 C;  1HNX C;  3J7A D;  4B3S C;  1KKG A;  1N2F A;  2ZM6 C;  1ZB8 A;  1PA4 A;  2UUB C;  4OX9 C;  2PT7 G;  4DV1 C;  4B3T C;  4DCT A;  3T1Y C;  1LQL A;  3AF6 A;  2EGT A;  4MH4 A;  4DR6 C;  2HHH C;  3JAM D;  2E7G A;  2OPL A;  5LMU C;  4DR5 C;  4LF6 C;  2DYJ A;  3LUS A;  1J5E C;  1VLA A;  2CXC A;  2KZF A;  1WF3 A;  4X66 C;  4LFB C;  3I07 A;  4B3M C;  4DV2 C;  4DR3 C;  2ATW A;  4DV0 C;  2F4V C;  1NYE A;  4JI2 C;  4JV5 C;  4X64 C;  1XNR C;  2UXC C;  2ONF A;  1EGA A;  4YY3 C;  3J80 D;  1IBL C;  4DV7 C;  2YCB A;  4LF9 C;  1ZB9 A;  1USP B;  1HH2 P;  1K0R A;  2PN2 A;  1HR0 C;  1JOS A;  4NXN C;  3IEV A;  2UXB C;  4JI7 C;  4DR2 C;  1QWI A;  4JI4 C;  2XR1 A;  4JI3 C;  4LFC C;  1XMQ C;  4LF5 C;  3EER A;  4JI8 C;  1XNQ C;  4DR1 C;  1HNZ C;  1N32 C;  4AQY C;  2UUC C;  4DCS A;  4DV3 C;  4DUZ C;  4DV6 C;  2E8C A;  2UXD C;  4JI1 C;  3IEU A;  1HNW C;  1WH9 A;  4JI0 C;  4YHH C;  5A2Q D;  4X62 C;  4NXM C;  4XX2 A;  1N34 C;  2E8F A;  2UUA C;  4DV5 C;  2E8E A;  3T1H C;  4B3R C;  4NOZ A;  1UKK A;  2JMP A;  2ASB A;  1XMO C;  1FJG C;  4JYA C;  1N36 C;  4LF4 C;  5BR8 C;  5IWA C;  5IT9 D;  3R9W A;  1IBM C;  4LF8 C;  1L2F A;  4DCV A;  3AF5 A;  3OTO C;  4GKJ C;  2QL8 A;  4DR7 C;  2HJG A;  1USP A;  2D7V A;  1IBK C;  1MKY A;  3CJE A;  2UU9 C;  4X65 C;  4GKK C;  4BSZ A;  3J81 D;  5FLX D;  2E5L C;  2VQE C;  2VQF C;  4K0K C;  3GKU A;  4DCU A;  1ML8 A;  4DUY C;  4JI6 C;  4JI5 C;  2OPL B;  4DV4 C;  1I94 C;  2CY1 A;  4MTN A; 
#chains in the Genus database with same CATH topology
 4ZLP A;  4LFA C;  1HNX C;  2E0G A;  4OX9 C;  2PT7 G;  3T1Y C;  4JM1 A;  5LCI A;  5ADZ A;  2M5O A;  3AF6 A;  3FCC A;  1RG9 A;  2P2B A;  5AE3 A;  3RV2 A;  2OPL A;  4WS9 A;  4DR5 C;  4IZ6 A;  4U5Y D;  4ZJZ A;  3S82 A;  1T5D X;  1MDF A;  1TH5 A;  4R0M A;  4B3M C;  5GTD A;  1UWD A;  1MXB A;  4DV2 C;  2F4V C;  1XS3 A;  2UXC C;  1XNR C;  3NPD A;  3J80 D;  2ZZN A;  5BSM A;  1LCI A;  1XHJ A;  4DV7 C;  4NXN C;  1K0R A;  3LGX A;  3ETO A;  2UXB C;  3VNR A;  1GPM A;  1QWI A;  4JI4 C;  3TR3 A;  4LFC C;  1YJ7 A;  4JI8 C;  1V60 A;  3KXW A;  4PRO C;  2MM9 A;  3IEU A;  4D4G A;  2YWC A;  4JI0 C;  5A1I A;  1HNW C;  4BC7 A;  4NXM C;  2KZ0 A;  2UUA C;  3A4I A;  3E7X A;  2E8E A;  3IML A;  3T1H C;  4B3R C;  4NOZ A;  4JYA C;  2Y4O A;  1N36 C;  2YWB A;  5IWA C;  2YX1 A;  3UZ0 A;  3OTO C;  2QL8 A;  4DR7 C;  1NY8 A;  2HJG A;  4RM3 A;  2QW0 X;  5BUR A;  4L2Z A;  1IBK C;  1MKY A;  3FCE A;  2UU9 C;  4G36 A;  5FLX D;  3PRO C;  3DAY A;  4K0K C;  4DCU A;  3GR1 A;  5BST A;  4DUY C;  5T8T A;  2OPL B;  3LNV A;  3VNQ A;  4DR4 C;  5IFI A;  4LF7 C;  1KKG A;  4HPV A;  1VEH A;  4MH4 A;  2NCL A;  5BSV A;  3L8C A;  4ODJ A;  2M5H A;  4R1L A;  2DYJ A;  3LUS A;  5BUS A;  1WF3 A;  4X66 C;  4LFB C;  3I07 A;  3G7S A;  2DPL A;  3FM7 A;  4EAT A;  5CZX A;  2ATW A;  1NYE A;  2ONF A;  3LNO A;  4LE5 A;  4ISB A;  1USP B;  3IPL A;  2PN2 A;  1JOS A;  3IEV A;  4IR7 A;  4DR2 C;  4JI3 C;  5KYV A;  1XMQ C;  1XNQ C;  1P4E C;  2OO4 A;  4G37 A;  3UEB A;  4DV3 C;  4DUZ C;  4GXQ A;  3GR0 A;  4JI1 C;  5BSU A;  1WH9 A;  5BSR A;  3CQ1 A;  1XRC A;  1XDX A;  1O92 A;  1IB8 A;  2DHM A;  4KTT A;  4BBY A;  4DV5 C;  3A25 A;  4LF4 C;  4D56 A;  5BR8 C;  1IBM C;  4LF8 C;  3H2T A;  4RM2 A;  5A19 A;  4GKJ C;  4DCV A;  4FUT A;  4D4I A;  2D1T A;  1BA3 A;  3CW9 A;  1MD9 A;  2D7V A;  4KTV A;  4GKK C;  3J81 D;  5BUQ A;  2E5L C;  3GPC A;  5AE1 A;  3I08 A;  3GKU A;  5DV9 A;  4NDN A;  2P2M A;  1ML8 A;  2VZE A;  4JI6 C;  1O90 A;  5BSW A;  1I94 C;  3NI2 A;  2BJO A;  3R9X A;  3R44 A;  1N33 C;  3J7A D;  2ZM6 C;  1PA4 A;  3NYQ A;  4B3T C;  4PUI A;  4PUH A;  4PUG A;  2BH1 X;  4BC9 A;  1YGT A;  4DR6 C;  4DG9 A;  2HHH C;  3JAM D;  2E7G A;  5LMU C;  2D27 A;  2VSQ A;  3EQ6 A;  2P2J A;  4DR3 C;  1MXC A;  1EGA A;  4YY3 C;  1MDB A;  1HR0 C;  1HH2 P;  3TUF A;  2AYA A;  3TDE A;  2Y27 A;  4JI7 C;  2XR1 A;  5K8F A;  4R1M A;  1N32 C;  1XRB A;  2PRO A;  2WP0 C;  4DCS A;  3E7W A;  4DV6 C;  4RVO A;  2UXD C;  4RVN A;  4X62 C;  4XX2 A;  1AMU A;  1XRA A;  2E8F A;  3UX2 A;  1V26 A;  2JMP A;  3PBK A;  2ASB A;  1XMO C;  1FJG C;  3NYR A;  4TPS B;  5IT9 D;  1FLO A;  3DHV A;  1O93 A;  2D1S A;  4RLF A;  3RG2 A;  2JNV A;  1WCJ A;  1USP A;  3A26 A;  2CU6 A;  3UOW A;  5KEI A;  4PHT A;  2P20 A;  3CJE A;  1PG3 A;  1FUG A;  4X65 C;  4BSZ A;  1M6X C;  2VQE C;  2VQF C;  3C5E A;  1V25 A;  3L95 X;  2WD9 A;  2MMA B;  2P02 A;  4DV4 C;  3VNS A;  2CY1 A;  3O2E A;  4KHP C;  3SO4 A;  5LMN C;  4OYC A;  2OBV A;  4RMN A;  4B3S C;  1N2F A;  4K0B A;  1ZB8 A;  2UUB C;  1RY2 A;  4DV1 C;  2QVX X;  3UX3 A;  2D1R A;  4DCT A;  1LQL A;  3AY0 A;  2EGT A;  1O9T A;  5A1G A;  5K85 A;  4FTF A;  2QVZ X;  3A9U A;  4DG8 A;  1P7L A;  4BCA A;  5E7Q A;  4PZP A;  3PES A;  4LF6 C;  5CZV A;  3CQ2 A;  1J5E C;  1VLA A;  2CXC A;  2D1Q A;  2KZF A;  5T8S A;  1PG4 A;  2Z51 A;  1QM4 A;  3CQ3 A;  4I9G A;  3CW8 X;  4RLQ A;  4L7I A;  3K6R A;  4DV0 C;  4JI2 C;  4JV5 C;  4X64 C;  2D28 C;  2ZTB A;  1IBL C;  2PG1 E;  2YCB A;  4LF9 C;  1ZB9 A;  1PU1 A;  4GS5 A;  2ZZM A;  5AE2 A;  4FUQ A;  4LF5 C;  3EER A;  4DR1 C;  3DLP X;  1HNZ C;  4AQY C;  2UUC C;  2MCQ A;  2P2Q A;  2KDN A;  2E8C A;  4L4Q A;  3LAX A;  4YHH C;  1P4E A;  5A2Q D;  3ETC A;  1N34 C;  4GXR A;  2V7B A;  5H9U A;  4WV3 A;  1ULT A;  3N54 B;  1UKK A;  4I9F A;  4OXI A;  3R9W A;  1M6X A;  1L2F A;  2QVY X;  3AF5 A;  4D57 A;  3A9V A;  1T5H X;  2P2F A;  3N2Q A;  1MXA A;  3TQI A;  5JRH A;  5KYT A;  2Y4N A;  4JI5 C;  3B7W A;  4G1I A;  4MTN A; 
#chains in the Genus database with same CATH homology
 4ZLP A;  4LFA C;  1HNX C;  2E0G A;  4OX9 C;  2PT7 G;  3T1Y C;  4JM1 A;  5ADZ A;  3AF6 A;  3FCC A;  1RG9 A;  2P2B A;  5AE3 A;  3RV2 A;  2OPL A;  4WS9 A;  4DR5 C;  4IZ6 A;  4U5Y D;  4ZJZ A;  3S82 A;  1T5D X;  1MDF A;  4B3M C;  4R0M A;  5GTD A;  1MXB A;  4DV2 C;  2F4V C;  2UXC C;  1XNR C;  3NPD A;  3J80 D;  5BSM A;  1LCI A;  4DV7 C;  4NXN C;  1K0R A;  3LGX A;  3ETO A;  2UXB C;  3VNR A;  1GPM A;  1QWI A;  4JI4 C;  4LFC C;  1YJ7 A;  4JI8 C;  3KXW A;  4PRO C;  3IEU A;  4D4G A;  2YWC A;  4JI0 C;  5A1I A;  1HNW C;  4BC7 A;  4NXM C;  2UUA C;  3A4I A;  3E7X A;  2E8E A;  3IML A;  3T1H C;  4B3R C;  4NOZ A;  4JYA C;  2Y4O A;  1N36 C;  2YWB A;  5IWA C;  3UZ0 A;  3OTO C;  2QL8 A;  4DR7 C;  2HJG A;  4RM3 A;  2QW0 X;  5BUR A;  4L2Z A;  1IBK C;  1MKY A;  3FCE A;  2UU9 C;  4G36 A;  5FLX D;  3PRO C;  3DAY A;  4K0K C;  4DCU A;  3GR1 A;  5BST A;  4DUY C;  5T8T A;  2OPL B;  3LNV A;  3VNQ A;  4DR4 C;  5IFI A;  4LF7 C;  1KKG A;  4HPV A;  4MH4 A;  5BSV A;  3L8C A;  4ODJ A;  4R1L A;  2DYJ A;  3LUS A;  5BUS A;  1WF3 A;  4X66 C;  4LFB C;  3I07 A;  3G7S A;  2DPL A;  4EAT A;  5CZX A;  2ATW A;  1NYE A;  2ONF A;  4LE5 A;  4ISB A;  1USP B;  3IPL A;  2PN2 A;  1JOS A;  3IEV A;  4IR7 A;  4DR2 C;  4JI3 C;  5KYV A;  1XMQ C;  1XNQ C;  2OO4 A;  4G37 A;  4DV3 C;  4DUZ C;  4GXQ A;  3GR0 A;  4JI1 C;  5BSU A;  1WH9 A;  5BSR A;  1XRC A;  1O92 A;  4KTT A;  4BBY A;  4DV5 C;  4LF4 C;  4D56 A;  5BR8 C;  1IBM C;  4LF8 C;  3H2T A;  4RM2 A;  5A19 A;  4GKJ C;  4DCV A;  4FUT A;  4D4I A;  2D1T A;  1BA3 A;  3CW9 A;  1MD9 A;  2D7V A;  4KTV A;  4GKK C;  3J81 D;  5BUQ A;  2E5L C;  3GPC A;  5AE1 A;  3I08 A;  3GKU A;  5DV9 A;  4NDN A;  2P2M A;  1ML8 A;  2VZE A;  4JI6 C;  1O90 A;  1I94 C;  5BSW A;  3NI2 A;  2BJO A;  3R9X A;  3R44 A;  1N33 C;  3J7A D;  2ZM6 C;  1PA4 A;  3NYQ A;  4B3T C;  2BH1 X;  4BC9 A;  4DR6 C;  4DG9 A;  2HHH C;  3JAM D;  2E7G A;  5LMU C;  2D27 A;  2VSQ A;  3EQ6 A;  2P2J A;  4DR3 C;  1MXC A;  1EGA A;  4YY3 C;  1MDB A;  1HR0 C;  1HH2 P;  3TUF A;  2AYA A;  3TDE A;  2Y27 A;  4JI7 C;  2XR1 A;  5K8F A;  4R1M A;  1N32 C;  1XRB A;  2PRO A;  2WP0 C;  4DCS A;  3E7W A;  4DV6 C;  4RVO A;  2UXD C;  4RVN A;  4X62 C;  4XX2 A;  1AMU A;  1XRA A;  2E8F A;  1V26 A;  2JMP A;  3PBK A;  2ASB A;  1XMO C;  1FJG C;  3NYR A;  4TPS B;  5IT9 D;  3DHV A;  1O93 A;  2D1S A;  4RLF A;  3RG2 A;  1USP A;  3UOW A;  5KEI A;  4PHT A;  2P20 A;  3CJE A;  1PG3 A;  1FUG A;  4X65 C;  4BSZ A;  2VQE C;  2VQF C;  3C5E A;  1V25 A;  3L95 X;  2WD9 A;  2P02 A;  4DV4 C;  3VNS A;  2CY1 A;  4KHP C;  3SO4 A;  5LMN C;  4OYC A;  2OBV A;  4RMN A;  4B3S C;  1N2F A;  4K0B A;  1ZB8 A;  2UUB C;  1RY2 A;  4DV1 C;  2QVX X;  2D1R A;  4DCT A;  1LQL A;  2EGT A;  1O9T A;  5A1G A;  5K85 A;  4FTF A;  2QVZ X;  3A9U A;  4DG8 A;  1P7L A;  4BCA A;  5E7Q A;  4PZP A;  3PES A;  4LF6 C;  5CZV A;  1J5E C;  1VLA A;  2CXC A;  2D1Q A;  2KZF A;  5T8S A;  1PG4 A;  1QM4 A;  4I9G A;  3CW8 X;  4RLQ A;  4L7I A;  4DV0 C;  4JI2 C;  4JV5 C;  4X64 C;  2D28 C;  1IBL C;  2YCB A;  4LF9 C;  1ZB9 A;  4GS5 A;  5AE2 A;  4FUQ A;  4LF5 C;  3EER A;  4DR1 C;  3DLP X;  1HNZ C;  4AQY C;  2UUC C;  2P2Q A;  2E8C A;  4L4Q A;  3LAX A;  4YHH C;  5A2Q D;  3ETC A;  1N34 C;  4GXR A;  2V7B A;  5H9U A;  4WV3 A;  1ULT A;  3N54 B;  1UKK A;  4I9F A;  4OXI A;  3R9W A;  1L2F A;  2QVY X;  3AF5 A;  4D57 A;  3A9V A;  1T5H X;  2P2F A;  3N2Q A;  1MXA A;  3TQI A;  5JRH A;  5KYT A;  2Y4N A;  4JI5 C;  3B7W A;  4G1I A;  4MTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...