4DR6C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 53
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr6C02
4DV5C 1WH9A 2HHHC 1ZB8A 2UUAC 4NXNC 2OPLB 4X64C 4NXMC 2ASBA 2PT7G 4DCSA 4JI5C 2PN2A 2CXCA 2ATWA 3CJEA 2EGTA 4LF8C 4LF5C 5IWAC 3EERA 3IEUA 2E8EA 4DV2C 4DR1C 2OPLA 4YY3C 1HNXC 5FLXD 4LF9C 3IEVA 4LFAC 4X62C 3R9WA 4OX9C 4JI6C 2UXDC 1ML8A 4BSZA 4DV4C 4LF6C 3J80D 1N33C 1XNQC 4JI3C 1HNZC 1FJGC 2BJOA 1L2FA 4DCTA 3AF6A 1IBLC 2VQFC 1HH2P 4B3TC 1QWIA 1ZB9A 5LMUC 4X66C 1JOSA 4JI0C 4JYAC 1USPA 4JI4C 2E5LC 1UKKA 3I07A 3JAMD 4B3SC 2DYJA 4DR2C 4GKJC 4B3RC 3T1HC 4JI2C 2KZFA 1K0RA 2D7VA 1XNRC 4DR7C 4DUYC 2ZM6C 2QL8A 1HNWC 3AF5A 1XMOC 2E8CA 1NYEA 5IT9D 4NOZA 1HR0C 5A2QD 4JI8C 3R9XA 1N32C 1XMQC 1LQLA 2UXBC 1KKGA 4KHPC 4DR5C 2UUCC 4DV6C 3T1YC 4AQYC 4DV3C 4DR4C 4JV5C 4B3MC 1IBMC 4DV0C 4LF7C 1EGAA 1I94C 1MKYA 3J7AD 1IBKC 2E8FA 2F4VC 4JI1C 3OTOC 4DV1C 4LF4C 3LUSA 4X65C 4XX2A 1WF3A 2CY1A 4DUZC 2UXCC 4MTNA 2ONFA 1PA4A 1N34C 2VQEC 4LFBC 3GKUA 4DR3C 2HJGA 2XR1A 4JI7C 1VLAA 1J5EC 4LFCC 4K0KC 2YCBA 2UU9C 2JMPA 2E7GA 2UUBC 3J81D 4YHHC 1N36C 4DR6C 4DCUA 4DCVA 5LMNC 4DV7C 1N2FA 4GKKC 4MH4A 1USPB 5BR8C
chains in the Genus database with same CATH superfamily
4RLQA 1MXBA 3KXWA 3C5EA 4K0BA 2UUAC 2OPLB 4NXMC 2PT7G 2P02A 4DCSA 2OBVA 2CXCA 4FUQA 1XDXA 4LF8C 4DR1C 4YY3C 5FLXD 4IR7A 3R9WA 1P7LA 1QM4A 4DV4C 3EQ6A 4G36A 3A9UA 1YGTA 4LF6C 1FUGA 2ZZNA 1N33C 1XNQC 2NCLA 1FJGC 3RG2A 3S82A 4DCTA 1IBLC 1XHJA 2YWBA 4JI4C 2E5LC 4PHTA 4R1LA 3CQ2A 3TQIA 4DR2C 4B3RC 3T1HC 3IMLA 4DR7C 2ZM6C 4FTFA 4U5YD 4D57A 3R9XA 1XMQC 2YX1A 5AE2A 4AQYC 4WV3A 3IPLA 4ZJZA 3J7AD 2P2BA 2V7BA 4JI1C 3OTOC 4LF4C 5ADZA 3NPDA 4RVNA 3FCEA 3H2TA 4X65C 4GXQA 4DUZC 2UXCC 3LNOA 2ONFA 5T8TA 1PA4A 1O9TA 2DPLA 2YWCA 4LFBC 2P2QA 2D28C 3PBKA 3CQ3A 2MM9A 2E7GA 2UUBC 1O92A 4DV5C 1WH9A 2HHHC 3VNQA 2ASBA 1IB8A 1XRCA 2ATWA 4JI5C 3UX2A 2EGTA 3L8CA 2M5OA 5CZVA 3DLPX 4LF9C 1T5DX 4LFAC 4RLFA 4OX9C 4JI6C 2VZEA 1ML8A 4D4GA 3J80D 2VSQA 4IZ6A 1HNZC 4PUHA 3VNSA 5BSVA 2VQFC 1HH2P 1QWIA 2OO4A 2Y4NA 4X66C 5DV9A 4JYAC 1P4EC 3I07A 5H9UA 3TUFA 3FCCA 3JAMD 4RM3A 4JI2C 2KZFA 5BSWA 2QL8A 4ZLPA 1XMOC 2ZZMA 2E8CA 1NYEA 1UWDA 2ZTBA 2PROA 5BSMA 5BUSA 4PUGA 1TH5A 2P20A 2E0GA 1LQLA 2MMAB 4DR5C 2UUCC 4DV6C 3LNVA 3T1YC 3A9VA 4JV5C 1IBMC 3LGXA 3VNRA 1I94C 4KTTA 3A4IA 4KTVA 2JNVA 1IBKC 1MXCA 2F4VC 4L2ZA 4ODJA 4G1IA 2KDNA 4GS5A 1NY8A 3GKUA 5K8FA 5AE1A 1VLAA 4K0KC 5T8SA 4DG9A 2UU9C 2P2FA 2AYAA 3TDEA 2DHMA 1GPMA 4DCUA 5LMNC 4PUIA 1N2FA 4MH4A 3UEBA 1USPB 4TPSB 3NYRA 5GTDA 3GR0A 2PN2A 3CJEA 4D56A 3RV2A 2BH1X 3E7WA 4L4QA 1PG4A 4LE5A 1P4EA 4WS9A 1MXAA 3NYQA 2CU6A 1V25A 4L7IA 3O2EA 4BC7A 5BSRA 2UXDC 3LAXA 2Y27A 4JI3C 2P2JA 1L2FA 3G7SA 3AF6A 3ETOA 3PROC 3A26A 4B3TC 4R1MA 1YJ7A 2WP0C 1JOSA 4JI0C 1USPA 1RY2A 5BSTA 3CQ1A 2PG1E 1LCIA 4BCAA 2DYJA 5BSUA 1PG3A 4GKJC 3DHVA 3UX3A 1K0RA 5IFIA 4DUYC 1HNWC 5KEIA 3I08A 1O90A 4ISBA 3E7XA 5E7QA 1HR0C 1N32C 4DG8A 2UXBC 2QVXX 1KKGA 3GR1A 4B3MC 1ULTA 1EGAA 3R44A 5JRHA 2E8FA 4EATA 4D4IA 4OYCA 4DV1C 5CZXA 4XX2A 1WF3A 2CY1A 4MTNA 2P2MA 3PESA 4RM2A 2VQEC 4PROC 2HJGA 5AE3A 2QVZX 2JMPA 1MD9A 1FLOA 4DR6C 3GPCA 4DCVA 1V26A 4GKKC 3N54B 5BR8C 4BC9A 1ZB8A 4NXNC 1MDFA 4X64C 1BA3A 4BBYA 3DAYA 3B7WA 4LF5C 1M6XC 5IWAC 3EERA 4R0MA 3IEUA 4I9GA 2E8EA 4DV2C 2OPLA 1HNXC 2D1QA 4PZPA 3IEVA 4X62C 1T5HX 2D1SA 4BSZA 2Y4OA 1XRBA 3NI2A 1MDBA 5LCIA 3TR3A 2BJOA 3FM7A 4RVOA 1VEHA 1ZB9A 5LMUC 5BUQA 1PU1A 1UKKA 2MCQA 4B3SC 1XRAA 2QVYX 2D7VA 2D1RA 1XNRC 4G37A 3AF5A 3L95X 3AY0A 5KYTA 1O93A 5IT9D 4NOZA 5A2QD 4FUTA 4JI8C 3CW9A 4KHPC 2QW0X 2WD9A 2D27A 4RMNA 3ETCA 1AMUA 1RG9A 4DV3C 4DR4C 4DV0C 4LF7C 3UOWA 1MKYA 2KZ0A 3CW8X 4JM1A 5KYVA 1XS3A 3LUSA 5A1IA 5A19A 3UZ0A 5BURA 1WCJA 2M5HA 3N2QA 1N34C 1V60A 4DR3C 4HPVA 2XR1A 3K6RA 4JI7C 1J5EC 4LFCC 1M6XA 2D1TA 2YCBA 5A1GA 4I9FA 4NDNA 3SO4A 4OXIA 4GXRA 5K85A 3J81D 4YHHC 1N36C 2Z51A 4DV7C 3A25A
chains in the Genus database with same CATH topology
4RLQA 1MXBA 3KXWA 3C5EA 4K0BA 2UUAC 2OPLB 4NXMC 2PT7G 2P02A 4DCSA 2OBVA 2CXCA 4FUQA 4LF8C 4DR1C 4YY3C 5FLXD 4IR7A 3R9WA 1P7LA 1QM4A 4DV4C 3EQ6A 4G36A 3A9UA 4LF6C 1FUGA 1N33C 1XNQC 1FJGC 3RG2A 3S82A 4DCTA 1IBLC 2YWBA 4JI4C 2E5LC 4PHTA 4R1LA 3TQIA 4DR2C 4B3RC 3T1HC 3IMLA 4DR7C 2ZM6C 4FTFA 4U5YD 4D57A 3R9XA 1XMQC 5AE2A 4AQYC 4WV3A 3IPLA 4ZJZA 3J7AD 2P2BA 2V7BA 4JI1C 3OTOC 4LF4C 5ADZA 3NPDA 4RVNA 3FCEA 3H2TA 4X65C 4GXQA 4DUZC 2UXCC 2ONFA 5T8TA 1PA4A 1O9TA 2DPLA 2YWCA 4LFBC 2P2QA 2D28C 3PBKA 2E7GA 2UUBC 1O92A 4DV5C 1WH9A 2HHHC 3VNQA 2ASBA 1XRCA 2ATWA 4JI5C 2EGTA 3L8CA 5CZVA 3DLPX 4LF9C 1T5DX 4LFAC 4RLFA 4OX9C 4JI6C 2VZEA 1ML8A 4D4GA 3J80D 2VSQA 4IZ6A 1HNZC 3VNSA 5BSVA 2VQFC 1HH2P 1QWIA 2OO4A 2Y4NA 4X66C 5DV9A 4JYAC 3I07A 5H9UA 3TUFA 3FCCA 3JAMD 4RM3A 4JI2C 2KZFA 5BSWA 2QL8A 4ZLPA 1XMOC 2E8CA 1NYEA 2PROA 5BSMA 5BUSA 2P20A 2E0GA 1LQLA 4DR5C 2UUCC 4DV6C 3LNVA 3T1YC 3A9VA 4JV5C 1IBMC 3LGXA 3VNRA 1I94C 4KTTA 3A4IA 4KTVA 1IBKC 1MXCA 2F4VC 4L2ZA 4ODJA 4G1IA 4GS5A 3GKUA 5K8FA 5AE1A 1VLAA 4K0KC 5T8SA 4DG9A 2UU9C 2P2FA 2AYAA 3TDEA 1GPMA 4DCUA 5LMNC 1N2FA 4MH4A 1USPB 4TPSB 3NYRA 5GTDA 3GR0A 2PN2A 3CJEA 4D56A 3RV2A 2BH1X 3E7WA 4L4QA 1PG4A 4LE5A 4WS9A 1MXAA 3NYQA 1V25A 4L7IA 4BC7A 5BSRA 2UXDC 3LAXA 2Y27A 4JI3C 2P2JA 1L2FA 3G7SA 3AF6A 3ETOA 3PROC 4B3TC 4R1MA 1YJ7A 2WP0C 1JOSA 4JI0C 1USPA 1RY2A 5BSTA 1LCIA 4BCAA 2DYJA 5BSUA 1PG3A 4GKJC 3DHVA 1K0RA 5IFIA 4DUYC 1HNWC 5KEIA 3I08A 1O90A 4ISBA 3E7XA 5E7QA 1HR0C 1N32C 4DG8A 2UXBC 2QVXX 1KKGA 3GR1A 4B3MC 1ULTA 1EGAA 3R44A 5JRHA 2E8FA 4EATA 4D4IA 4OYCA 4DV1C 5CZXA 4XX2A 1WF3A 2CY1A 4MTNA 2P2MA 3PESA 4RM2A 2VQEC 4PROC 2HJGA 5AE3A 2QVZX 2JMPA 1MD9A 4DR6C 3GPCA 4DCVA 1V26A 4GKKC 5BR8C 3N54B 4BC9A 1ZB8A 4NXNC 1MDFA 4X64C 1BA3A 4BBYA 3DAYA 3B7WA 4LF5C 5IWAC 3EERA 4R0MA 3IEUA 4I9GA 2E8EA 4DV2C 2OPLA 1HNXC 2D1QA 4PZPA 3IEVA 4X62C 1T5HX 2D1SA 4BSZA 2Y4OA 1XRBA 3NI2A 1MDBA 2BJOA 4RVOA 1ZB9A 5LMUC 5BUQA 1UKKA 4B3SC 1XRAA 2QVYX 2D7VA 2D1RA 1XNRC 4G37A 3AF5A 3L95X 5KYTA 1O93A 5IT9D 4NOZA 5A2QD 4FUTA 4JI8C 3CW9A 4KHPC 2QW0X 2WD9A 2D27A 4RMNA 3ETCA 1AMUA 1RG9A 4DV3C 4DR4C 4DV0C 4LF7C 3UOWA 1MKYA 3CW8X 4JM1A 5KYVA 3LUSA 5A1IA 5A19A 3UZ0A 5BURA 3N2QA 1N34C 4DR3C 4HPVA 2XR1A 4JI7C 1J5EC 4LFCC 2D1TA 2YCBA 5A1GA 4I9FA 4NDNA 3SO4A 4OXIA 4GXRA 5K85A 3J81D 4YHHC 1N36C 4DV7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 C;  1WH9 A;  2HHH C;  1ZB8 A;  2UUA C;  4NXN C;  2OPL B;  4X64 C;  4NXM C;  2ASB A;  2PT7 G;  4DCS A;  4JI5 C;  2PN2 A;  2CXC A;  2ATW A;  3CJE A;  2EGT A;  4LF8 C;  4LF5 C;  5IWA C;  3EER A;  3IEU A;  2E8E A;  4DV2 C;  4DR1 C;  2OPL A;  4YY3 C;  1HNX C;  5FLX D;  4LF9 C;  3IEV A;  4LFA C;  4X62 C;  3R9W A;  4OX9 C;  4JI6 C;  2UXD C;  1ML8 A;  4BSZ A;  4DV4 C;  4LF6 C;  3J80 D;  1N33 C;  1XNQ C;  4JI3 C;  1HNZ C;  1FJG C;  2BJO A;  1L2F A;  4DCT A;  3AF6 A;  1IBL C;  2VQF C;  1HH2 P;  4B3T C;  1QWI A;  1ZB9 A;  5LMU C;  4X66 C;  1JOS A;  4JI0 C;  4JYA C;  1USP A;  4JI4 C;  2E5L C;  1UKK A;  3I07 A;  3JAM D;  4B3S C;  2DYJ A;  4DR2 C;  4GKJ C;  4B3R C;  3T1H C;  4JI2 C;  2KZF A;  1K0R A;  2D7V A;  1XNR C;  4DR7 C;  4DUY C;  2ZM6 C;  2QL8 A;  1HNW C;  3AF5 A;  1XMO C;  2E8C A;  1NYE A;  5IT9 D;  4NOZ A;  1HR0 C;  5A2Q D;  4JI8 C;  3R9X A;  1N32 C;  1XMQ C;  1LQL A;  2UXB C;  1KKG A;  4KHP C;  4DR5 C;  2UUC C;  4DV6 C;  3T1Y C;  4AQY C;  4DV3 C;  4DR4 C;  4JV5 C;  4B3M C;  1IBM C;  4DV0 C;  4LF7 C;  1EGA A;  1I94 C;  1MKY A;  3J7A D;  1IBK C;  2E8F A;  2F4V C;  4JI1 C;  3OTO C;  4DV1 C;  4LF4 C;  3LUS A;  4X65 C;  4XX2 A;  1WF3 A;  2CY1 A;  4DUZ C;  2UXC C;  4MTN A;  2ONF A;  1PA4 A;  1N34 C;  2VQE C;  4LFB C;  3GKU A;  4DR3 C;  2HJG A;  2XR1 A;  4JI7 C;  1VLA A;  1J5E C;  4LFC C;  4K0K C;  2YCB A;  2UU9 C;  2JMP A;  2E7G A;  2UUB C;  3J81 D;  4YHH C;  1N36 C;  4DR6 C;  4DCU A;  4DCV A;  5LMN C;  4DV7 C;  1N2F A;  4GKK C;  4MH4 A;  1USP B;  5BR8 C; 
#chains in the Genus database with same CATH topology
 4RLQ A;  1MXB A;  3KXW A;  3C5E A;  4K0B A;  2UUA C;  2OPL B;  4NXM C;  2PT7 G;  2P02 A;  4DCS A;  2OBV A;  2CXC A;  4FUQ A;  1XDX A;  4LF8 C;  4DR1 C;  4YY3 C;  5FLX D;  4IR7 A;  3R9W A;  1P7L A;  1QM4 A;  4DV4 C;  3EQ6 A;  4G36 A;  3A9U A;  1YGT A;  4LF6 C;  1FUG A;  2ZZN A;  1N33 C;  1XNQ C;  2NCL A;  1FJG C;  3RG2 A;  3S82 A;  4DCT A;  1IBL C;  1XHJ A;  2YWB A;  4JI4 C;  2E5L C;  4PHT A;  4R1L A;  3CQ2 A;  3TQI A;  4DR2 C;  4B3R C;  3T1H C;  3IML A;  4DR7 C;  2ZM6 C;  4FTF A;  4U5Y D;  4D57 A;  3R9X A;  1XMQ C;  2YX1 A;  5AE2 A;  4AQY C;  4WV3 A;  3IPL A;  4ZJZ A;  3J7A D;  2P2B A;  2V7B A;  4JI1 C;  3OTO C;  4LF4 C;  5ADZ A;  3NPD A;  4RVN A;  3FCE A;  3H2T A;  4X65 C;  4GXQ A;  4DUZ C;  2UXC C;  3LNO A;  2ONF A;  5T8T A;  1PA4 A;  1O9T A;  2DPL A;  2YWC A;  4LFB C;  2P2Q A;  2D28 C;  3PBK A;  3CQ3 A;  2MM9 A;  2E7G A;  2UUB C;  1O92 A;  4DV5 C;  1WH9 A;  2HHH C;  3VNQ A;  2ASB A;  1IB8 A;  1XRC A;  2ATW A;  4JI5 C;  3UX2 A;  2EGT A;  3L8C A;  2M5O A;  5CZV A;  3DLP X;  4LF9 C;  1T5D X;  4LFA C;  4RLF A;  4OX9 C;  4JI6 C;  2VZE A;  1ML8 A;  4D4G A;  3J80 D;  2VSQ A;  4IZ6 A;  1HNZ C;  4PUH A;  3VNS A;  5BSV A;  2VQF C;  1HH2 P;  1QWI A;  2OO4 A;  2Y4N A;  4X66 C;  5DV9 A;  4JYA C;  1P4E C;  3I07 A;  5H9U A;  3TUF A;  3FCC A;  3JAM D;  4RM3 A;  4JI2 C;  2KZF A;  5BSW A;  2QL8 A;  4ZLP A;  1XMO C;  2ZZM A;  2E8C A;  1NYE A;  1UWD A;  2ZTB A;  2PRO A;  5BSM A;  5BUS A;  4PUG A;  1TH5 A;  2P20 A;  2E0G A;  1LQL A;  2MMA B;  4DR5 C;  2UUC C;  4DV6 C;  3LNV A;  3T1Y C;  3A9V A;  4JV5 C;  1IBM C;  3LGX A;  3VNR A;  1I94 C;  4KTT A;  3A4I A;  4KTV A;  2JNV A;  1IBK C;  1MXC A;  2F4V C;  4L2Z A;  4ODJ A;  4G1I A;  2KDN A;  4GS5 A;  1NY8 A;  3GKU A;  5K8F A;  5AE1 A;  1VLA A;  4K0K C;  5T8S A;  4DG9 A;  2UU9 C;  2P2F A;  2AYA A;  3TDE A;  2DHM A;  1GPM A;  4DCU A;  5LMN C;  4PUI A;  1N2F A;  4MH4 A;  3UEB A;  1USP B;  4TPS B;  3NYR A;  5GTD A;  3GR0 A;  2PN2 A;  3CJE A;  4D56 A;  3RV2 A;  2BH1 X;  3E7W A;  4L4Q A;  1PG4 A;  4LE5 A;  1P4E A;  4WS9 A;  1MXA A;  3NYQ A;  2CU6 A;  1V25 A;  4L7I A;  3O2E A;  4BC7 A;  5BSR A;  2UXD C;  3LAX A;  2Y27 A;  4JI3 C;  2P2J A;  1L2F A;  3G7S A;  3AF6 A;  3ETO A;  3PRO C;  3A26 A;  4B3T C;  4R1M A;  1YJ7 A;  2WP0 C;  1JOS A;  4JI0 C;  1USP A;  1RY2 A;  5BST A;  3CQ1 A;  2PG1 E;  1LCI A;  4BCA A;  2DYJ A;  5BSU A;  1PG3 A;  4GKJ C;  3DHV A;  3UX3 A;  1K0R A;  5IFI A;  4DUY C;  1HNW C;  5KEI A;  3I08 A;  1O90 A;  4ISB A;  3E7X A;  5E7Q A;  1HR0 C;  1N32 C;  4DG8 A;  2UXB C;  2QVX X;  1KKG A;  3GR1 A;  4B3M C;  1ULT A;  1EGA A;  3R44 A;  5JRH A;  2E8F A;  4EAT A;  4D4I A;  4OYC A;  4DV1 C;  5CZX A;  4XX2 A;  1WF3 A;  2CY1 A;  4MTN A;  2P2M A;  3PES A;  4RM2 A;  2VQE C;  4PRO C;  2HJG A;  5AE3 A;  2QVZ X;  2JMP A;  1MD9 A;  1FLO A;  4DR6 C;  3GPC A;  4DCV A;  1V26 A;  4GKK C;  3N54 B;  5BR8 C;  4BC9 A;  1ZB8 A;  4NXN C;  1MDF A;  4X64 C;  1BA3 A;  4BBY A;  3DAY A;  3B7W A;  4LF5 C;  1M6X C;  5IWA C;  3EER A;  4R0M A;  3IEU A;  4I9G A;  2E8E A;  4DV2 C;  2OPL A;  1HNX C;  2D1Q A;  4PZP A;  3IEV A;  4X62 C;  1T5H X;  2D1S A;  4BSZ A;  2Y4O A;  1XRB A;  3NI2 A;  1MDB A;  5LCI A;  3TR3 A;  2BJO A;  3FM7 A;  4RVO A;  1VEH A;  1ZB9 A;  5LMU C;  5BUQ A;  1PU1 A;  1UKK A;  2MCQ A;  4B3S C;  1XRA A;  2QVY X;  2D7V A;  2D1R A;  1XNR C;  4G37 A;  3AF5 A;  3L95 X;  3AY0 A;  5KYT A;  1O93 A;  5IT9 D;  4NOZ A;  5A2Q D;  4FUT A;  4JI8 C;  3CW9 A;  4KHP C;  2QW0 X;  2WD9 A;  2D27 A;  4RMN A;  3ETC A;  1AMU A;  1RG9 A;  4DV3 C;  4DR4 C;  4DV0 C;  4LF7 C;  3UOW A;  1MKY A;  2KZ0 A;  3CW8 X;  4JM1 A;  5KYV A;  1XS3 A;  3LUS A;  5A1I A;  5A19 A;  3UZ0 A;  5BUR A;  1WCJ A;  2M5H A;  3N2Q A;  1N34 C;  1V60 A;  4DR3 C;  4HPV A;  2XR1 A;  3K6R A;  4JI7 C;  1J5E C;  4LFC C;  1M6X A;  2D1T A;  2YCB A;  5A1G A;  4I9F A;  4NDN A;  3SO4 A;  4OXI A;  4GXR A;  5K85 A;  3J81 D;  4YHH C;  1N36 C;  2Z51 A;  4DV7 C;  3A25 A; 
#chains in the Genus database with same CATH homology
 4RLQ A;  1MXB A;  3KXW A;  3C5E A;  4K0B A;  2UUA C;  2OPL B;  4NXM C;  2PT7 G;  2P02 A;  4DCS A;  2OBV A;  2CXC A;  4FUQ A;  4LF8 C;  4DR1 C;  4YY3 C;  5FLX D;  4IR7 A;  3R9W A;  1P7L A;  1QM4 A;  4DV4 C;  3EQ6 A;  4G36 A;  3A9U A;  4LF6 C;  1FUG A;  1N33 C;  1XNQ C;  1FJG C;  3RG2 A;  3S82 A;  4DCT A;  1IBL C;  2YWB A;  4JI4 C;  2E5L C;  4PHT A;  4R1L A;  3TQI A;  4DR2 C;  4B3R C;  3T1H C;  3IML A;  4DR7 C;  2ZM6 C;  4FTF A;  4U5Y D;  4D57 A;  3R9X A;  1XMQ C;  5AE2 A;  4AQY C;  4WV3 A;  3IPL A;  4ZJZ A;  3J7A D;  2P2B A;  2V7B A;  4JI1 C;  3OTO C;  4LF4 C;  5ADZ A;  3NPD A;  4RVN A;  3FCE A;  3H2T A;  4X65 C;  4GXQ A;  4DUZ C;  2UXC C;  2ONF A;  5T8T A;  1PA4 A;  1O9T A;  2DPL A;  2YWC A;  4LFB C;  2P2Q A;  2D28 C;  3PBK A;  2E7G A;  2UUB C;  1O92 A;  4DV5 C;  1WH9 A;  2HHH C;  3VNQ A;  2ASB A;  1XRC A;  2ATW A;  4JI5 C;  2EGT A;  3L8C A;  5CZV A;  3DLP X;  4LF9 C;  1T5D X;  4LFA C;  4RLF A;  4OX9 C;  4JI6 C;  2VZE A;  1ML8 A;  4D4G A;  3J80 D;  2VSQ A;  4IZ6 A;  1HNZ C;  3VNS A;  5BSV A;  2VQF C;  1HH2 P;  1QWI A;  2OO4 A;  2Y4N A;  4X66 C;  5DV9 A;  4JYA C;  3I07 A;  5H9U A;  3TUF A;  3FCC A;  3JAM D;  4RM3 A;  4JI2 C;  2KZF A;  5BSW A;  2QL8 A;  4ZLP A;  1XMO C;  2E8C A;  1NYE A;  2PRO A;  5BSM A;  5BUS A;  2P20 A;  2E0G A;  1LQL A;  4DR5 C;  2UUC C;  4DV6 C;  3LNV A;  3T1Y C;  3A9V A;  4JV5 C;  1IBM C;  3LGX A;  3VNR A;  1I94 C;  4KTT A;  3A4I A;  4KTV A;  1IBK C;  1MXC A;  2F4V C;  4L2Z A;  4ODJ A;  4G1I A;  4GS5 A;  3GKU A;  5K8F A;  5AE1 A;  1VLA A;  4K0K C;  5T8S A;  4DG9 A;  2UU9 C;  2P2F A;  2AYA A;  3TDE A;  1GPM A;  4DCU A;  5LMN C;  1N2F A;  4MH4 A;  1USP B;  4TPS B;  3NYR A;  5GTD A;  3GR0 A;  2PN2 A;  3CJE A;  4D56 A;  3RV2 A;  2BH1 X;  3E7W A;  4L4Q A;  1PG4 A;  4LE5 A;  4WS9 A;  1MXA A;  3NYQ A;  1V25 A;  4L7I A;  4BC7 A;  5BSR A;  2UXD C;  3LAX A;  2Y27 A;  4JI3 C;  2P2J A;  1L2F A;  3G7S A;  3AF6 A;  3ETO A;  3PRO C;  4B3T C;  4R1M A;  1YJ7 A;  2WP0 C;  1JOS A;  4JI0 C;  1USP A;  1RY2 A;  5BST A;  1LCI A;  4BCA A;  2DYJ A;  5BSU A;  1PG3 A;  4GKJ C;  3DHV A;  1K0R A;  5IFI A;  4DUY C;  1HNW C;  5KEI A;  3I08 A;  1O90 A;  4ISB A;  3E7X A;  5E7Q A;  1HR0 C;  1N32 C;  4DG8 A;  2UXB C;  2QVX X;  1KKG A;  3GR1 A;  4B3M C;  1ULT A;  1EGA A;  3R44 A;  5JRH A;  2E8F A;  4EAT A;  4D4I A;  4OYC A;  4DV1 C;  5CZX A;  4XX2 A;  1WF3 A;  2CY1 A;  4MTN A;  2P2M A;  3PES A;  4RM2 A;  2VQE C;  4PRO C;  2HJG A;  5AE3 A;  2QVZ X;  2JMP A;  1MD9 A;  4DR6 C;  3GPC A;  4DCV A;  1V26 A;  4GKK C;  5BR8 C;  3N54 B;  4BC9 A;  1ZB8 A;  4NXN C;  1MDF A;  4X64 C;  1BA3 A;  4BBY A;  3DAY A;  3B7W A;  4LF5 C;  5IWA C;  3EER A;  4R0M A;  3IEU A;  4I9G A;  2E8E A;  4DV2 C;  2OPL A;  1HNX C;  2D1Q A;  4PZP A;  3IEV A;  4X62 C;  1T5H X;  2D1S A;  4BSZ A;  2Y4O A;  1XRB A;  3NI2 A;  1MDB A;  2BJO A;  4RVO A;  1ZB9 A;  5LMU C;  5BUQ A;  1UKK A;  4B3S C;  1XRA A;  2QVY X;  2D7V A;  2D1R A;  1XNR C;  4G37 A;  3AF5 A;  3L95 X;  5KYT A;  1O93 A;  5IT9 D;  4NOZ A;  5A2Q D;  4FUT A;  4JI8 C;  3CW9 A;  4KHP C;  2QW0 X;  2WD9 A;  2D27 A;  4RMN A;  3ETC A;  1AMU A;  1RG9 A;  4DV3 C;  4DR4 C;  4DV0 C;  4LF7 C;  3UOW A;  1MKY A;  3CW8 X;  4JM1 A;  5KYV A;  3LUS A;  5A1I A;  5A19 A;  3UZ0 A;  5BUR A;  3N2Q A;  1N34 C;  4DR3 C;  4HPV A;  2XR1 A;  4JI7 C;  1J5E C;  4LFC C;  2D1T A;  2YCB A;  5A1G A;  4I9F A;  4NDN A;  3SO4 A;  4OXI A;  4GXR A;  5K85 A;  3J81 D;  4YHH C;  1N36 C;  4DV7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...