4DR6C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 53
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr6C02
4LF5C 3AF5A 4KHPC 2E8FA 1ZB8A 2UUCC 1N34C 2EGTA 1ML8A 4DCUA 3J81D 4DV6C 1IBKC 1XNQC 2CY1A 5LMNC 1XMOC 4JI4C 4YY3C 4B3MC 2CXCA 1IBMC 1XNRC 4X64C 2HJGA 1N36C 2ZM6C 1LQLA 1ZB9A 3J80D 4NXNC 2QL8A 4LF4C 4DCVA 4JV5C 3CJEA 1N32C 4K0KC 4DCTA 5BR8C 2E7GA 2ASBA 1KKGA 3EERA 2KZFA 1PA4A 3OTOC 2E5LC 4XX2A 4JI0C 1MKYA 1HNZC 1UKKA 1JOSA 1NYEA 4NOZA 4JI1C 1HNXC 4DR4C 4JI8C 4B3SC 3JAMD 2VQEC 4YHHC 3R9XA 4DUYC 3AF6A 2PN2A 1N33C 4JI3C 4JYAC 4JI7C 4DR7C 4DR1C 4DV0C 4JI6C 1HH2P 2E8EA 5A2QD 2UUBC 2OPLA 1FJGC 2E8CA 2DYJA 5IT9D 2XR1A 2OPLB 2YCBA 2HHHC 3J7AD 4MH4A 4X66C 4X62C 4DV5C 4DR3C 2UXDC 1IBLC 4DR2C 2UXBC 4JI2C 4LF7C 1K0RA 3IEUA 1L2FA 4DV3C 4GKKC 1HNWC 2D7VA 1EGAA 4DUZC 4DR5C 1USPA 1HR0C 1QWIA 4DCSA 1I94C 2ATWA 2UUAC 4B3RC 4MTNA 3T1HC 4OX9C 2VQFC 4DV1C 5IWAC 2F4VC 5FLXD 4LFCC 3GKUA 2JMPA 2UXCC 4LF6C 2UU9C 4DV2C 4DV7C 3T1YC 1WH9A 4LF9C 3R9WA 4X65C 4AQYC 1XMQC 1WF3A 2PT7G 3LUSA 4LFAC 4DR6C 1VLAA 2BJOA 1N2FA 4DV4C 4JI5C 5LMUC 2ONFA 1J5EC 4BSZA 4LFBC 3IEVA 4NXMC 4GKJC 4B3TC 1USPB 3I07A 4LF8C
chains in the Genus database with same CATH superfamily
2WP0C 1V60A 3L95X 5A1IA 2OO4A 2QVYX 4D4GA 3GR1A 4L4QA 1ML8A 3LGXA 3J81D 4DV6C 1IBKC 3NYQA 2QW0X 2CY1A 5ADZA 1IBMC 4KTVA 1XNRC 1N36C 2QL8A 4OYCA 3CJEA 5KYVA 5BR8C 3LNVA 2ASBA 3EERA 1PG4A 1GPMA 1O9TA 5BSVA 4DG9A 4JI0C 3VNRA 1MKYA 1MXBA 3PESA 1NYEA 4PUGA 2Y4NA 2DHMA 4R1MA 4B3SC 4G37A 2KDNA 2ZTBA 4ZLPA 2JNVA 4JI7C 4ISBA 1FUGA 4DV0C 1HH2P 2E8EA 4PHTA 5AE3A 2MMAB 2PROA 1FJGC 5T8SA 2DYJA 2OPLB 2YCBA 1XRAA 1IB8A 2P2BA 1XRCA 2MM9A 3CW8X 3TUFA 2P2QA 1IBLC 2P2JA 3N2QA 1K0RA 3CW9A 1L2FA 3E7WA 1HNWC 4DUZC 1P4EC 5KYTA 3NYRA 3L8CA 1I94C 3IMLA 4LE5A 4RM2A 3SO4A 3UX2A 5A19A 3T1HC 4OX9C 4RVOA 2VQFC 3CQ1A 3PBKA 4DV1C 1T5DX 3UZ0A 2F4VC 4WV3A 2YWBA 2Z51A 2JMPA 5CZXA 2KZ0A 1RY2A 1WH9A 4X65C 4U5YD 5LMUC 3DLPX 4PZPA 4NXMC 5K85A 3A4IA 4LF8C 3TR3A 2D1SA 4KHPC 1N34C 3FCCA 4GS5A 1FLOA 4IZ6A 3UOWA 2HJGA 3FCEA 4D56A 4NXNC 4TPSB 2D28C 4LF4C 1P4EA 4FUTA 4JV5C 2QVXX 2E5LC 4XX2A 2CU6A 1BA3A 1HNZC 1JOSA 1HNXC 4DR4C 2BH1X 3JAMD 4G36A 2NCLA 3AF6A 3CQ3A 2M5OA 4JI3C 1XS3A 4HPVA 4BC9A 4DR1C 4EATA 4R0MA 3E7XA 5IT9D 1V25A 3J7AD 1V26A 2P20A 2OBVA 2UXDC 2ZZNA 3A26A 1XDXA 4DR2C 1MDBA 4JI2C 4LF7C 3GPCA 4DV3C 2Y27A 1O93A 4D57A 3PROC 4RVNA 4GXQA 5IWAC 1RG9A 3AY0A 5FLXD 3GKUA 2UXCC 1P7LA 3IPLA 3UX3A 4DV2C 4DV7C 3S82A 4LF9C 3R9WA 3A9VA 4AQYC 1XMQC 2PT7G 4FTFA 4DR6C 5BSUA 1N2FA 4I9GA 5E7QA 1J5EC 4LFBC 3IEVA 4B3TC 3N54B 1NY8A 1AMUA 1USPB 4WS9A 3NPDA 2UUCC 3K6RA 3VNQA 1QM4A 2D1QA 3O2EA 2V7BA 4ODJA 1M6XC 2D1RA 2Y4OA 3TDEA 1O90A 4X64C 3J80D 4BCAA 1O92A 1UWDA 4DCVA 4DCTA 2E7GA 2KZFA 5BSRA 1PA4A 2ZZMA 4NOZA 5A1GA 2P02A 2PG1E 1XHJA 4JI8C 4FUQA 3R9XA 1LCIA 2PN2A 5BSWA 1WCJA 2P2MA 4DR7C 5BSMA 3B7WA 5A2QD 2UUBC 3RV2A 2E8CA 3TQIA 5BURA 2XR1A 4ZJZA 4KTTA 2HHHC 2YWCA 4NDNA 4X62C 4DV5C 1MXAA 1M6XA 4R1LA 3R44A 4I9FA 2D27A 1ULTA 5JRHA 3C5EA 4GKKC 2D7VA 4DR5C 1QWIA 4DCSA 4PUHA 5IFIA 4MTNA 4PUIA 5BUSA 3CQ2A 2UU9C 3ETCA 4L7IA 1PG3A 4D4IA 1WF3A 5BSTA 4LFAC 4RMNA 2WD9A 3ETOA 2BJOA 4DV4C 4JI5C 1XRBA 2E0GA 4BSZA 1PU1A 4GKJC 1T5HX 3H2TA 3I08A 3VNSA 3I07A 4LF5C 3AF5A 1MD9A 2E8FA 1ZB8A 2EGTA 3A9UA 4DCUA 1XNQC 1XMOC 2YX1A 5LMNC 1VEHA 4JI4C 3GR0A 4YY3C 4B3MC 2CXCA 5DV9A 5AE1A 3RG2A 2ZM6C 1LQLA 1ZB9A 3DAYA 2M5HA 1N32C 4K0KC 1KKGA 5T8TA 5CZVA 3OTOC 4OXIA 4BBYA 1YGTA 1UKKA 4JI1C 3A25A 5GTDA 2VQEC 4YHHC 4K0BA 4DUYC 3FM7A 1N33C 1MXCA 4JYAC 4RM3A 4JI6C 3KXWA 2OPLA 3EQ6A 4GXRA 2AYAA 5K8FA 4MH4A 4X66C 5H9UA 2UXBC 3IEUA 2DPLA 4BC7A 1EGAA 5LCIA 1USPA 1HR0C 5AE2A 2ATWA 2UUAC 4JM1A 4L2ZA 4RLFA 2MCQA 1MDFA 4B3RC 2VZEA 2QVZX 2VSQA 4LFCC 4IR7A 3G7SA 1YJ7A 4LF6C 3T1YC 4G1IA 3UEBA 2D1TA 3LUSA 5KEIA 3NI2A 3DHVA 4PROC 1VLAA 3LNOA 5BUQA 2ONFA 1TH5A 3LAXA 4RLQA 4DG8A 2P2FA 4DR3C
chains in the Genus database with same CATH topology
2WP0C 3L95X 5A1IA 2OO4A 2QVYX 4D4GA 3GR1A 4L4QA 1ML8A 3LGXA 3J81D 4DV6C 1IBKC 3NYQA 2QW0X 2CY1A 5ADZA 1IBMC 4KTVA 1XNRC 1N36C 2QL8A 4OYCA 3CJEA 5KYVA 5BR8C 3LNVA 2ASBA 3EERA 1PG4A 1GPMA 1O9TA 5BSVA 4DG9A 4JI0C 3VNRA 1MKYA 1MXBA 3PESA 1NYEA 2Y4NA 4R1MA 4B3SC 4G37A 4ZLPA 4JI7C 4ISBA 1FUGA 4DV0C 1HH2P 2E8EA 4PHTA 5AE3A 2PROA 1FJGC 5T8SA 2DYJA 2OPLB 2YCBA 1XRAA 2P2BA 1XRCA 3CW8X 3TUFA 2P2QA 1IBLC 2P2JA 3N2QA 1K0RA 3CW9A 1L2FA 3E7WA 1HNWC 4DUZC 5KYTA 3NYRA 3L8CA 1I94C 3IMLA 4LE5A 4RM2A 3SO4A 3T1HC 5A19A 4OX9C 4RVOA 2VQFC 3PBKA 4DV1C 1T5DX 3UZ0A 2F4VC 4WV3A 2YWBA 2JMPA 5CZXA 1RY2A 1WH9A 4X65C 4U5YD 5LMUC 3DLPX 4PZPA 4NXMC 5K85A 3A4IA 4LF8C 2D1SA 4KHPC 1N34C 3FCCA 4GS5A 4IZ6A 3UOWA 2HJGA 3FCEA 4D56A 4NXNC 4TPSB 2D28C 4LF4C 4FUTA 4JV5C 2QVXX 2E5LC 4XX2A 1BA3A 1HNZC 1JOSA 1HNXC 4DR4C 2BH1X 3JAMD 4G36A 3AF6A 4JI3C 4HPVA 4BC9A 4DR1C 4EATA 4R0MA 3E7XA 5IT9D 1V25A 3J7AD 1V26A 2P20A 2OBVA 2UXDC 4DR2C 1MDBA 4JI2C 4LF7C 3GPCA 4DV3C 2Y27A 1O93A 4D57A 3PROC 4RVNA 4GXQA 5IWAC 1RG9A 5FLXD 3GKUA 2UXCC 1P7LA 3IPLA 4DV2C 4DV7C 3S82A 4LF9C 3R9WA 3A9VA 4AQYC 1XMQC 2PT7G 4FTFA 4DR6C 5BSUA 1N2FA 4I9GA 5E7QA 1J5EC 4LFBC 3IEVA 4B3TC 3N54B 1AMUA 1USPB 4WS9A 3NPDA 2UUCC 3VNQA 1QM4A 2D1QA 2V7BA 4ODJA 2D1RA 2Y4OA 3TDEA 1O90A 4X64C 3J80D 4BCAA 1O92A 4DCVA 4DCTA 2E7GA 2KZFA 5BSRA 1PA4A 4NOZA 5A1GA 2P02A 4JI8C 4FUQA 3R9XA 1LCIA 2PN2A 5BSWA 2P2MA 4DR7C 5BSMA 3B7WA 5A2QD 2UUBC 3RV2A 2E8CA 3TQIA 5BURA 2XR1A 4ZJZA 4KTTA 2HHHC 2YWCA 4NDNA 4X62C 4DV5C 1MXAA 4R1LA 3R44A 4I9FA 2D27A 1ULTA 5JRHA 3C5EA 4GKKC 2D7VA 4DR5C 1QWIA 4DCSA 5IFIA 4MTNA 5BUSA 2UU9C 3ETCA 4L7IA 1PG3A 4D4IA 1WF3A 5BSTA 4LFAC 4RMNA 2WD9A 3ETOA 2BJOA 4DV4C 4JI5C 1XRBA 2E0GA 4BSZA 4GKJC 1T5HX 3H2TA 3I08A 3VNSA 3I07A 4LF5C 3AF5A 1MD9A 2E8FA 1ZB8A 2EGTA 3A9UA 4DCUA 1XNQC 1XMOC 5LMNC 4JI4C 3GR0A 4YY3C 4B3MC 2CXCA 5DV9A 5AE1A 3RG2A 2ZM6C 1LQLA 1ZB9A 3DAYA 1N32C 4K0KC 1KKGA 5T8TA 5CZVA 3OTOC 4OXIA 4BBYA 1UKKA 4JI1C 5GTDA 2VQEC 4YHHC 4K0BA 4DUYC 1N33C 1MXCA 4JYAC 4RM3A 4JI6C 3KXWA 2OPLA 3EQ6A 4GXRA 2AYAA 5K8FA 4MH4A 4X66C 5H9UA 2UXBC 3IEUA 2DPLA 4BC7A 1EGAA 1USPA 1HR0C 5AE2A 2ATWA 2UUAC 4JM1A 4L2ZA 4RLFA 1MDFA 4B3RC 2VZEA 2QVZX 2VSQA 4LFCC 4IR7A 3G7SA 1YJ7A 4LF6C 3T1YC 4G1IA 2D1TA 3LUSA 5KEIA 3NI2A 3DHVA 4PROC 1VLAA 5BUQA 2ONFA 3LAXA 4RLQA 4DG8A 2P2FA 4DR3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 C;  3AF5 A;  4KHP C;  2E8F A;  1ZB8 A;  2UUC C;  1N34 C;  2EGT A;  1ML8 A;  4DCU A;  3J81 D;  4DV6 C;  1IBK C;  1XNQ C;  2CY1 A;  5LMN C;  1XMO C;  4JI4 C;  4YY3 C;  4B3M C;  2CXC A;  1IBM C;  1XNR C;  4X64 C;  2HJG A;  1N36 C;  2ZM6 C;  1LQL A;  1ZB9 A;  3J80 D;  4NXN C;  2QL8 A;  4LF4 C;  4DCV A;  4JV5 C;  3CJE A;  1N32 C;  4K0K C;  4DCT A;  5BR8 C;  2E7G A;  2ASB A;  1KKG A;  3EER A;  2KZF A;  1PA4 A;  3OTO C;  2E5L C;  4XX2 A;  4JI0 C;  1MKY A;  1HNZ C;  1UKK A;  1JOS A;  1NYE A;  4NOZ A;  4JI1 C;  1HNX C;  4DR4 C;  4JI8 C;  4B3S C;  3JAM D;  2VQE C;  4YHH C;  3R9X A;  4DUY C;  3AF6 A;  2PN2 A;  1N33 C;  4JI3 C;  4JYA C;  4JI7 C;  4DR7 C;  4DR1 C;  4DV0 C;  4JI6 C;  1HH2 P;  2E8E A;  5A2Q D;  2UUB C;  2OPL A;  1FJG C;  2E8C A;  2DYJ A;  5IT9 D;  2XR1 A;  2OPL B;  2YCB A;  2HHH C;  3J7A D;  4MH4 A;  4X66 C;  4X62 C;  4DV5 C;  4DR3 C;  2UXD C;  1IBL C;  4DR2 C;  2UXB C;  4JI2 C;  4LF7 C;  1K0R A;  3IEU A;  1L2F A;  4DV3 C;  4GKK C;  1HNW C;  2D7V A;  1EGA A;  4DUZ C;  4DR5 C;  1USP A;  1HR0 C;  1QWI A;  4DCS A;  1I94 C;  2ATW A;  2UUA C;  4B3R C;  4MTN A;  3T1H C;  4OX9 C;  2VQF C;  4DV1 C;  5IWA C;  2F4V C;  5FLX D;  4LFC C;  3GKU A;  2JMP A;  2UXC C;  4LF6 C;  2UU9 C;  4DV2 C;  4DV7 C;  3T1Y C;  1WH9 A;  4LF9 C;  3R9W A;  4X65 C;  4AQY C;  1XMQ C;  1WF3 A;  2PT7 G;  3LUS A;  4LFA C;  4DR6 C;  1VLA A;  2BJO A;  1N2F A;  4DV4 C;  4JI5 C;  5LMU C;  2ONF A;  1J5E C;  4BSZ A;  4LFB C;  3IEV A;  4NXM C;  4GKJ C;  4B3T C;  1USP B;  3I07 A;  4LF8 C; 
#chains in the Genus database with same CATH topology
 2WP0 C;  1V60 A;  3L95 X;  5A1I A;  2OO4 A;  2QVY X;  4D4G A;  3GR1 A;  4L4Q A;  1ML8 A;  3LGX A;  3J81 D;  4DV6 C;  1IBK C;  3NYQ A;  2QW0 X;  2CY1 A;  5ADZ A;  1IBM C;  4KTV A;  1XNR C;  1N36 C;  2QL8 A;  4OYC A;  3CJE A;  5KYV A;  5BR8 C;  3LNV A;  2ASB A;  3EER A;  1PG4 A;  1GPM A;  1O9T A;  5BSV A;  4DG9 A;  4JI0 C;  3VNR A;  1MKY A;  1MXB A;  3PES A;  1NYE A;  4PUG A;  2Y4N A;  2DHM A;  4R1M A;  4B3S C;  4G37 A;  2KDN A;  2ZTB A;  4ZLP A;  2JNV A;  4JI7 C;  4ISB A;  1FUG A;  4DV0 C;  1HH2 P;  2E8E A;  4PHT A;  5AE3 A;  2MMA B;  2PRO A;  1FJG C;  5T8S A;  2DYJ A;  2OPL B;  2YCB A;  1XRA A;  1IB8 A;  2P2B A;  1XRC A;  2MM9 A;  3CW8 X;  3TUF A;  2P2Q A;  1IBL C;  2P2J A;  3N2Q A;  1K0R A;  3CW9 A;  1L2F A;  3E7W A;  1HNW C;  4DUZ C;  1P4E C;  5KYT A;  3NYR A;  3L8C A;  1I94 C;  3IML A;  4LE5 A;  4RM2 A;  3SO4 A;  3UX2 A;  5A19 A;  3T1H C;  4OX9 C;  4RVO A;  2VQF C;  3CQ1 A;  3PBK A;  4DV1 C;  1T5D X;  3UZ0 A;  2F4V C;  4WV3 A;  2YWB A;  2Z51 A;  2JMP A;  5CZX A;  2KZ0 A;  1RY2 A;  1WH9 A;  4X65 C;  4U5Y D;  5LMU C;  3DLP X;  4PZP A;  4NXM C;  5K85 A;  3A4I A;  4LF8 C;  3TR3 A;  2D1S A;  4KHP C;  1N34 C;  3FCC A;  4GS5 A;  1FLO A;  4IZ6 A;  3UOW A;  2HJG A;  3FCE A;  4D56 A;  4NXN C;  4TPS B;  2D28 C;  4LF4 C;  1P4E A;  4FUT A;  4JV5 C;  2QVX X;  2E5L C;  4XX2 A;  2CU6 A;  1BA3 A;  1HNZ C;  1JOS A;  1HNX C;  4DR4 C;  2BH1 X;  3JAM D;  4G36 A;  2NCL A;  3AF6 A;  3CQ3 A;  2M5O A;  4JI3 C;  1XS3 A;  4HPV A;  4BC9 A;  4DR1 C;  4EAT A;  4R0M A;  3E7X A;  5IT9 D;  1V25 A;  3J7A D;  1V26 A;  2P20 A;  2OBV A;  2UXD C;  2ZZN A;  3A26 A;  1XDX A;  4DR2 C;  1MDB A;  4JI2 C;  4LF7 C;  3GPC A;  4DV3 C;  2Y27 A;  1O93 A;  4D57 A;  3PRO C;  4RVN A;  4GXQ A;  5IWA C;  1RG9 A;  3AY0 A;  5FLX D;  3GKU A;  2UXC C;  1P7L A;  3IPL A;  3UX3 A;  4DV2 C;  4DV7 C;  3S82 A;  4LF9 C;  3R9W A;  3A9V A;  4AQY C;  1XMQ C;  2PT7 G;  4FTF A;  4DR6 C;  5BSU A;  1N2F A;  4I9G A;  5E7Q A;  1J5E C;  4LFB C;  3IEV A;  4B3T C;  3N54 B;  1NY8 A;  1AMU A;  1USP B;  4WS9 A;  3NPD A;  2UUC C;  3K6R A;  3VNQ A;  1QM4 A;  2D1Q A;  3O2E A;  2V7B A;  4ODJ A;  1M6X C;  2D1R A;  2Y4O A;  3TDE A;  1O90 A;  4X64 C;  3J80 D;  4BCA A;  1O92 A;  1UWD A;  4DCV A;  4DCT A;  2E7G A;  2KZF A;  5BSR A;  1PA4 A;  2ZZM A;  4NOZ A;  5A1G A;  2P02 A;  2PG1 E;  1XHJ A;  4JI8 C;  4FUQ A;  3R9X A;  1LCI A;  2PN2 A;  5BSW A;  1WCJ A;  2P2M A;  4DR7 C;  5BSM A;  3B7W A;  5A2Q D;  2UUB C;  3RV2 A;  2E8C A;  3TQI A;  5BUR A;  2XR1 A;  4ZJZ A;  4KTT A;  2HHH C;  2YWC A;  4NDN A;  4X62 C;  4DV5 C;  1MXA A;  1M6X A;  4R1L A;  3R44 A;  4I9F A;  2D27 A;  1ULT A;  5JRH A;  3C5E A;  4GKK C;  2D7V A;  4DR5 C;  1QWI A;  4DCS A;  4PUH A;  5IFI A;  4MTN A;  4PUI A;  5BUS A;  3CQ2 A;  2UU9 C;  3ETC A;  4L7I A;  1PG3 A;  4D4I A;  1WF3 A;  5BST A;  4LFA C;  4RMN A;  2WD9 A;  3ETO A;  2BJO A;  4DV4 C;  4JI5 C;  1XRB A;  2E0G A;  4BSZ A;  1PU1 A;  4GKJ C;  1T5H X;  3H2T A;  3I08 A;  3VNS A;  3I07 A;  4LF5 C;  3AF5 A;  1MD9 A;  2E8F A;  1ZB8 A;  2EGT A;  3A9U A;  4DCU A;  1XNQ C;  1XMO C;  2YX1 A;  5LMN C;  1VEH A;  4JI4 C;  3GR0 A;  4YY3 C;  4B3M C;  2CXC A;  5DV9 A;  5AE1 A;  3RG2 A;  2ZM6 C;  1LQL A;  1ZB9 A;  3DAY A;  2M5H A;  1N32 C;  4K0K C;  1KKG A;  5T8T A;  5CZV A;  3OTO C;  4OXI A;  4BBY A;  1YGT A;  1UKK A;  4JI1 C;  3A25 A;  5GTD A;  2VQE C;  4YHH C;  4K0B A;  4DUY C;  3FM7 A;  1N33 C;  1MXC A;  4JYA C;  4RM3 A;  4JI6 C;  3KXW A;  2OPL A;  3EQ6 A;  4GXR A;  2AYA A;  5K8F A;  4MH4 A;  4X66 C;  5H9U A;  2UXB C;  3IEU A;  2DPL A;  4BC7 A;  1EGA A;  5LCI A;  1USP A;  1HR0 C;  5AE2 A;  2ATW A;  2UUA C;  4JM1 A;  4L2Z A;  4RLF A;  2MCQ A;  1MDF A;  4B3R C;  2VZE A;  2QVZ X;  2VSQ A;  4LFC C;  4IR7 A;  3G7S A;  1YJ7 A;  4LF6 C;  3T1Y C;  4G1I A;  3UEB A;  2D1T A;  3LUS A;  5KEI A;  3NI2 A;  3DHV A;  4PRO C;  1VLA A;  3LNO A;  5BUQ A;  2ONF A;  1TH5 A;  3LAX A;  4RLQ A;  4DG8 A;  2P2F A;  4DR3 C; 
#chains in the Genus database with same CATH homology
 2WP0 C;  3L95 X;  5A1I A;  2OO4 A;  2QVY X;  4D4G A;  3GR1 A;  4L4Q A;  1ML8 A;  3LGX A;  3J81 D;  4DV6 C;  1IBK C;  3NYQ A;  2QW0 X;  2CY1 A;  5ADZ A;  1IBM C;  4KTV A;  1XNR C;  1N36 C;  2QL8 A;  4OYC A;  3CJE A;  5KYV A;  5BR8 C;  3LNV A;  2ASB A;  3EER A;  1PG4 A;  1GPM A;  1O9T A;  5BSV A;  4DG9 A;  4JI0 C;  3VNR A;  1MKY A;  1MXB A;  3PES A;  1NYE A;  2Y4N A;  4R1M A;  4B3S C;  4G37 A;  4ZLP A;  4JI7 C;  4ISB A;  1FUG A;  4DV0 C;  1HH2 P;  2E8E A;  4PHT A;  5AE3 A;  2PRO A;  1FJG C;  5T8S A;  2DYJ A;  2OPL B;  2YCB A;  1XRA A;  2P2B A;  1XRC A;  3CW8 X;  3TUF A;  2P2Q A;  1IBL C;  2P2J A;  3N2Q A;  1K0R A;  3CW9 A;  1L2F A;  3E7W A;  1HNW C;  4DUZ C;  5KYT A;  3NYR A;  3L8C A;  1I94 C;  3IML A;  4LE5 A;  4RM2 A;  3SO4 A;  3T1H C;  5A19 A;  4OX9 C;  4RVO A;  2VQF C;  3PBK A;  4DV1 C;  1T5D X;  3UZ0 A;  2F4V C;  4WV3 A;  2YWB A;  2JMP A;  5CZX A;  1RY2 A;  1WH9 A;  4X65 C;  4U5Y D;  5LMU C;  3DLP X;  4PZP A;  4NXM C;  5K85 A;  3A4I A;  4LF8 C;  2D1S A;  4KHP C;  1N34 C;  3FCC A;  4GS5 A;  4IZ6 A;  3UOW A;  2HJG A;  3FCE A;  4D56 A;  4NXN C;  4TPS B;  2D28 C;  4LF4 C;  4FUT A;  4JV5 C;  2QVX X;  2E5L C;  4XX2 A;  1BA3 A;  1HNZ C;  1JOS A;  1HNX C;  4DR4 C;  2BH1 X;  3JAM D;  4G36 A;  3AF6 A;  4JI3 C;  4HPV A;  4BC9 A;  4DR1 C;  4EAT A;  4R0M A;  3E7X A;  5IT9 D;  1V25 A;  3J7A D;  1V26 A;  2P20 A;  2OBV A;  2UXD C;  4DR2 C;  1MDB A;  4JI2 C;  4LF7 C;  3GPC A;  4DV3 C;  2Y27 A;  1O93 A;  4D57 A;  3PRO C;  4RVN A;  4GXQ A;  5IWA C;  1RG9 A;  5FLX D;  3GKU A;  2UXC C;  1P7L A;  3IPL A;  4DV2 C;  4DV7 C;  3S82 A;  4LF9 C;  3R9W A;  3A9V A;  4AQY C;  1XMQ C;  2PT7 G;  4FTF A;  4DR6 C;  5BSU A;  1N2F A;  4I9G A;  5E7Q A;  1J5E C;  4LFB C;  3IEV A;  4B3T C;  3N54 B;  1AMU A;  1USP B;  4WS9 A;  3NPD A;  2UUC C;  3VNQ A;  1QM4 A;  2D1Q A;  2V7B A;  4ODJ A;  2D1R A;  2Y4O A;  3TDE A;  1O90 A;  4X64 C;  3J80 D;  4BCA A;  1O92 A;  4DCV A;  4DCT A;  2E7G A;  2KZF A;  5BSR A;  1PA4 A;  4NOZ A;  5A1G A;  2P02 A;  4JI8 C;  4FUQ A;  3R9X A;  1LCI A;  2PN2 A;  5BSW A;  2P2M A;  4DR7 C;  5BSM A;  3B7W A;  5A2Q D;  2UUB C;  3RV2 A;  2E8C A;  3TQI A;  5BUR A;  2XR1 A;  4ZJZ A;  4KTT A;  2HHH C;  2YWC A;  4NDN A;  4X62 C;  4DV5 C;  1MXA A;  4R1L A;  3R44 A;  4I9F A;  2D27 A;  1ULT A;  5JRH A;  3C5E A;  4GKK C;  2D7V A;  4DR5 C;  1QWI A;  4DCS A;  5IFI A;  4MTN A;  5BUS A;  2UU9 C;  3ETC A;  4L7I A;  1PG3 A;  4D4I A;  1WF3 A;  5BST A;  4LFA C;  4RMN A;  2WD9 A;  3ETO A;  2BJO A;  4DV4 C;  4JI5 C;  1XRB A;  2E0G A;  4BSZ A;  4GKJ C;  1T5H X;  3H2T A;  3I08 A;  3VNS A;  3I07 A;  4LF5 C;  3AF5 A;  1MD9 A;  2E8F A;  1ZB8 A;  2EGT A;  3A9U A;  4DCU A;  1XNQ C;  1XMO C;  5LMN C;  4JI4 C;  3GR0 A;  4YY3 C;  4B3M C;  2CXC A;  5DV9 A;  5AE1 A;  3RG2 A;  2ZM6 C;  1LQL A;  1ZB9 A;  3DAY A;  1N32 C;  4K0K C;  1KKG A;  5T8T A;  5CZV A;  3OTO C;  4OXI A;  4BBY A;  1UKK A;  4JI1 C;  5GTD A;  2VQE C;  4YHH C;  4K0B A;  4DUY C;  1N33 C;  1MXC A;  4JYA C;  4RM3 A;  4JI6 C;  3KXW A;  2OPL A;  3EQ6 A;  4GXR A;  2AYA A;  5K8F A;  4MH4 A;  4X66 C;  5H9U A;  2UXB C;  3IEU A;  2DPL A;  4BC7 A;  1EGA A;  1USP A;  1HR0 C;  5AE2 A;  2ATW A;  2UUA C;  4JM1 A;  4L2Z A;  4RLF A;  1MDF A;  4B3R C;  2VZE A;  2QVZ X;  2VSQ A;  4LFC C;  4IR7 A;  3G7S A;  1YJ7 A;  4LF6 C;  3T1Y C;  4G1I A;  2D1T A;  3LUS A;  5KEI A;  3NI2 A;  3DHV A;  4PRO C;  1VLA A;  5BUQ A;  2ONF A;  3LAX A;  4RLQ A;  4DG8 A;  2P2F A;  4DR3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...