4NXNC

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4nxnC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4nxnC02
1XMQC 2E8EA 3T1HC 4MH4A 4GKKC 4B3MC 4NXNC 4DV7C 1FJGC 4LF7C 2E5LC 2PT7G 1HH2P 4GKJC 4LFCC 3AF5A 4LF8C 4DV0C 5IWAC 4JI4C 1UKKA 1L2FA 1EGAA 1XMOC 1IBLC 4DR7C 2UXDC 1WH9A 1USPA 4X65C 4DR6C 4DR2C 5IT9D 1KKGA 2E8CA 4DV2C 1N36C 4LFAC 4DV1C 4JI0C 3JAMD 1J5EC 1MKYA 2OPLB 4B3RC 1ML8A 3R9WA 2ASBA 4DCVA 4OX9C 4JYAC 2VQEC 1N32C 3IEUA 1WF3A 3OTOC 4YY3C 4JI5C 2XR1A 3LUSA 2QL8A 2UUAC 5LMUC 4JI6C 4JI3C 2OPLA 1QWIA 3GKUA 4KHPC 2HJGA 1PA4A 5A2QD 4AQYC 4MTNA 4NXMC 4B3TC 3J81D 4LF5C 3J80D 2UXCC 4JV5C 2UXBC 3IEVA 4B3SC 1K0RA 1VLAA 4LF6C 4JI1C 1HNXC 1USPB 1ZB9A 1HNZC 4LF9C 4DCUA 2ATWA 2EGTA 3I07A 1XNRC 3T1YC 2HHHC 2PN2A 4X64C 2DYJA 4X66C 2CXCA 4X62C 1HNWC 1ZB8A 4JI2C 2CY1A 1LQLA 4DV3C 4XX2A 2UU9C 2KZFA 3R9XA 1HR0C 3AF6A 4YHHC 2F4VC 4DV4C 4DR4C 5FLXD 1N34C 1I94C 2E7GA 2BJOA 4LF4C 2YCBA 3CJEA 2D7VA 4DR3C 4DUZC 1N2FA 3J7AD 4DV5C 1N33C 2JMPA 1XNQC 4DUYC 4K0KC 4JI8C 4DCSA 4NOZA 4DV6C 1NYEA 4JI7C 2ONFA 2ZM6C 4DR1C 1JOSA 4DCTA 4BSZA 5LMNC 2UUBC 2UUCC 4DR5C 3EERA 1IBKC 4LFBC 2E8FA 2VQFC 5BR8C 1IBMC
chains in the Genus database with same CATH superfamily
4MH4A 1PU1A 2D1RA 4B3MC 2YWCA 3O2EA 1HH2P 5AE2A 1O90A 3N54B 4DV0C 2QVZX 4RM3A 2VZEA 1V25A 3KXWA 1L2FA 1EGAA 4JI4C 3A26A 1IBLC 4DR7C 1NY8A 2UXDC 1O92A 1ULTA 4X65C 3LGXA 5K85A 3DLPX 3DHVA 1KKGA 2E8CA 3B7WA 4FTFA 4DG8A 4I9FA 2Y27A 2QVXX 1J5EC 1M6XA 1ML8A 3VNSA 5BSUA 2P2JA 3IEUA 4RM2A 4YY3C 4I9GA 1IB8A 2QVYX 4JI5C 2XR1A 3LUSA 5LMUC 4JI3C 2OPLA 4D56A 3GKUA 4R1MA 3IMLA 4FUTA 2ZZMA 4MTNA 4NXMC 4B3TC 2UXCC 2UXBC 4B3SC 3UX2A 1XHJA 3FCEA 1K0RA 3UX3A 3ETOA 3E7WA 1USPB 3A25A 2Y4NA 2PN2A 3TDEA 2CXCA 4X62C 2P02A 1HNWC 4JI2C 5H9UA 3UZ0A 3IPLA 3FCCA 3NI2A 2UU9C 4G1IA 4OXIA 3NYQA 5BSVA 4YHHC 5FLXD 2E7GA 5A19A 2YCBA 3CJEA 2D7VA 3H2TA 2PG1E 1XNQC 4NOZA 3A9VA 1JOSA 4DR5C 2WD9A 2OO4A 2DHMA 1VEHA 4LFBC 3PROC 1MDBA 2E5LC 2M5HA 4EATA 4LFCC 3AF5A 1XRBA 4LF8C 3UOWA 2QW0X 5IWAC 2P2FA 1UKKA 1WH9A 1USPA 2M5OA 4RVOA 2CU6A 4DR6C 1O93A 4DR2C 5KEIA 4DV2C 1N36C 4OYCA 4JI0C 1MKYA 5AE1A 3R9WA 4JYAC 4OX9C 2ZZNA 2VQEC 3NPDA 4WS9A 5T8TA 3OTOC 1V26A 4JI6C 2V7BA 3AY0A 3UEBA 4KHPC 5A2QD 4AQYC 3I08A 1RG9A 3CQ2A 3J81D 3RG2A 5BSWA 4BC7A 5DV9A 3S82A 4LF5C 4R1LA 2D1TA 1VLAA 4K0BA 1PG3A 5T8SA 2P20A 1HNXC 4G36A 2D28C 3CQ3A 1XNRC 3T1YC 2DYJA 4L4QA 4D57A 3GR1A 2OBVA 3R9XA 2JNVA 3AF6A 4DR4C 3C5EA 5E7QA 1I94C 1PG4A 3A9UA 2NCLA 4DR3C 3PBKA 4DUZC 1YGTA 2P2QA 2JMPA 4RLFA 4JI8C 1FLOA 3L8CA 5KYTA 2ONFA 5LMNC 4DCTA 3FM7A 1T5DX 5BSMA 1IBKC 4TPSB 4B3RC 5BR8C 1IBMC 1XMQC 2E8EA 3T1HC 1MXCA 1FJGC 4DV7C 1P7LA 4KTVA 2VSQA 1XRAA 5A1IA 4GXQA 4HPVA 1XMOC 1MDFA 4PHTA 3N2QA 4D4IA 5IT9D 4ISBA 1M6XC 4LFAC 4DV1C 2D1QA 2OPLB 3DAYA 1N32C 4KTTA 3NYRA 1WF3A 5CZVA 1UWDA 2DPLA 2QL8A 5KYVA 2D27A 1QWIA 4RVNA 1MD9A 1O9TA 1FUGA 3PESA 4G37A 3J80D 5BUQA 4JV5C 5JRHA 3CQ1A 4NDNA 2Z51A 3LAXA 4U5YD 1MXAA 1ZB9A 4LF9C 4LE5A 4DCUA 2ATWA 2EGTA 3I07A 4PZPA 3L95X 4X64C 4X66C 2YX1A 4D4GA 4PROC 1LQLA 3TQIA 3E7XA 2KZFA 2MMAB 1MXBA 1LCIA 4IR7A 4PUHA 1WCJA 1N34C 5IFIA 2BJOA 1N2FA 3EQ6A 3A4IA 3SO4A 2YWBA 4ZJZA 5BUSA 4DG9A 2ZM6C 5CZXA 5LCIA 4DR1C 2Y4OA 2UUBC 4L7IA 3VNRA 5GTDA 4GXRA 2VQFC 1XRCA 3R44A 3LNOA 4PUGA 1YJ7A 4GKKC 2WP0C 4NXNC 4BC9A 4LF7C 3ETCA 2PT7G 4GKJC 5A1GA 1RY2A 3LNVA 3TUFA 2ZTBA 1BA3A 4RLQA 4PUIA 3JAMD 2PROA 2P2BA 2ASBA 4DCVA 1AMUA 5ADZA 1P4EA 2BH1X 2KZ0A 1GPMA 5K8FA 2UUAC 1XS3A 4FUQA 2HJGA 1PA4A 3K6RA 5AE3A 4L2ZA 2P2MA 4RMNA 1V60A 3IEVA 3GR0A 1T5HX 3RV2A 4R0MA 4LF6C 4JI1C 5BSTA 5BSRA 1HNZC 2HHHC 4IZ6A 4BCAA 2E0GA 1ZB8A 2CY1A 2AYAA 3CW8X 4DV3C 4XX2A 4ZLPA 4WV3A 2D1SA 1HR0C 2F4VC 4DV4C 3G7SA 2MM9A 3CW9A 4LF4C 2KDNA 2MCQA 3J7AD 4DV5C 1N33C 4BBYA 4GS5A 4DUYC 1TH5A 4K0KC 4DCSA 1XDXA 3GPCA 4DV6C 1NYEA 4JI7C 5BURA 4BSZA 4ODJA 2UUCC 1QM4A 3EERA 1P4EC 3VNQA 2E8FA 3TR3A 4JM1A
chains in the Genus database with same CATH topology
4MH4A 4B3MC 2D1RA 2YWCA 1HH2P 5AE2A 1O90A 3N54B 4DV0C 2QVZX 4RM3A 2VZEA 1V25A 3KXWA 1L2FA 1EGAA 4JI4C 1IBLC 4DR7C 2UXDC 1O92A 1ULTA 4X65C 3LGXA 5K85A 3DLPX 3DHVA 1KKGA 2E8CA 3B7WA 4FTFA 4DG8A 4I9FA 2Y27A 2QVXX 1J5EC 1ML8A 3VNSA 5BSUA 2P2JA 3IEUA 4RM2A 4YY3C 4I9GA 2QVYX 4JI5C 2XR1A 3LUSA 5LMUC 4JI3C 2OPLA 4D56A 3GKUA 4R1MA 3IMLA 4FUTA 4MTNA 4NXMC 4B3TC 2UXCC 2UXBC 4B3SC 3FCEA 1K0RA 3ETOA 3E7WA 1USPB 2Y4NA 2PN2A 3TDEA 2CXCA 4X62C 2P02A 1HNWC 4JI2C 5H9UA 3UZ0A 3IPLA 2UU9C 3FCCA 3NI2A 4G1IA 4OXIA 3NYQA 5BSVA 4YHHC 5FLXD 2E7GA 5A19A 2YCBA 3CJEA 2D7VA 3H2TA 1XNQC 4NOZA 3A9VA 1JOSA 4DR5C 2WD9A 2OO4A 4LFBC 3PROC 1MDBA 2E5LC 4EATA 4LFCC 3AF5A 1XRBA 4LF8C 3UOWA 2QW0X 5IWAC 2P2FA 1UKKA 1WH9A 1USPA 4RVOA 4DR6C 1O93A 4DR2C 5KEIA 4DV2C 1N36C 4OYCA 4JI0C 1MKYA 5AE1A 3R9WA 4JYAC 4OX9C 2VQEC 3NPDA 4WS9A 5T8TA 3OTOC 1V26A 4JI6C 2V7BA 4KHPC 5A2QD 4AQYC 3I08A 1RG9A 3J81D 3RG2A 5BSWA 4BC7A 5DV9A 3S82A 4LF5C 4R1LA 2D1TA 1VLAA 4K0BA 1PG3A 5T8SA 2P20A 1HNXC 4G36A 2D28C 1XNRC 3T1YC 2DYJA 4L4QA 4D57A 3GR1A 2OBVA 3R9XA 3AF6A 4DR4C 3C5EA 5E7QA 1I94C 1PG4A 3A9UA 4DR3C 3PBKA 4DUZC 2P2QA 2JMPA 4RLFA 4JI8C 3L8CA 5KYTA 2ONFA 5LMNC 4DCTA 1T5DX 5BSMA 1IBKC 4TPSB 4B3RC 5BR8C 1IBMC 1XMQC 2E8EA 3T1HC 1MXCA 1FJGC 4DV7C 1P7LA 4KTVA 2VSQA 1XRAA 5A1IA 4GXQA 4HPVA 1XMOC 1MDFA 4PHTA 3N2QA 4D4IA 5IT9D 4ISBA 4LFAC 4DV1C 2D1QA 2OPLB 3DAYA 1N32C 4KTTA 3NYRA 1WF3A 5CZVA 2DPLA 2QL8A 5KYVA 2D27A 1QWIA 4RVNA 1MD9A 1O9TA 1FUGA 3PESA 4G37A 3J80D 5BUQA 4JV5C 5JRHA 4NDNA 3LAXA 4U5YD 1MXAA 1ZB9A 4LF9C 4LE5A 4DCUA 2ATWA 2EGTA 3I07A 4PZPA 3L95X 4X64C 4X66C 4D4GA 4PROC 1LQLA 3TQIA 3E7XA 2KZFA 1MXBA 1LCIA 4IR7A 1N34C 5IFIA 2BJOA 1N2FA 3EQ6A 3A4IA 3SO4A 2YWBA 4ZJZA 5BUSA 4DG9A 2ZM6C 5CZXA 4DR1C 2Y4OA 2UUBC 4L7IA 3VNRA 5GTDA 4GXRA 2VQFC 1XRCA 3R44A 4GKKC 1YJ7A 2WP0C 4NXNC 4BC9A 4LF7C 3ETCA 2PT7G 4GKJC 5A1GA 1RY2A 3LNVA 3TUFA 1BA3A 4RLQA 3JAMD 2PROA 2P2BA 2ASBA 4DCVA 1AMUA 5ADZA 2BH1X 5K8FA 1GPMA 2UUAC 4FUQA 2HJGA 1PA4A 5AE3A 4L2ZA 2P2MA 4RMNA 3IEVA 3GR0A 1T5HX 3RV2A 4R0MA 4LF6C 4JI1C 5BSTA 5BSRA 1HNZC 2HHHC 4IZ6A 4BCAA 2E0GA 1ZB8A 2CY1A 2AYAA 3CW8X 4DV3C 4XX2A 4ZLPA 4WV3A 2D1SA 1HR0C 2F4VC 4DV4C 3G7SA 3CW9A 4LF4C 3J7AD 4DV5C 1N33C 4BBYA 4GS5A 4DUYC 4K0KC 4DCSA 3GPCA 4DV6C 1NYEA 4JI7C 5BURA 4BSZA 4ODJA 2UUCC 1QM4A 3EERA 3VNQA 2E8FA 4JM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ C;  2E8E A;  3T1H C;  4MH4 A;  4GKK C;  4B3M C;  4NXN C;  4DV7 C;  1FJG C;  4LF7 C;  2E5L C;  2PT7 G;  1HH2 P;  4GKJ C;  4LFC C;  3AF5 A;  4LF8 C;  4DV0 C;  5IWA C;  4JI4 C;  1UKK A;  1L2F A;  1EGA A;  1XMO C;  1IBL C;  4DR7 C;  2UXD C;  1WH9 A;  1USP A;  4X65 C;  4DR6 C;  4DR2 C;  5IT9 D;  1KKG A;  2E8C A;  4DV2 C;  1N36 C;  4LFA C;  4DV1 C;  4JI0 C;  3JAM D;  1J5E C;  1MKY A;  2OPL B;  4B3R C;  1ML8 A;  3R9W A;  2ASB A;  4DCV A;  4OX9 C;  4JYA C;  2VQE C;  1N32 C;  3IEU A;  1WF3 A;  3OTO C;  4YY3 C;  4JI5 C;  2XR1 A;  3LUS A;  2QL8 A;  2UUA C;  5LMU C;  4JI6 C;  4JI3 C;  2OPL A;  1QWI A;  3GKU A;  4KHP C;  2HJG A;  1PA4 A;  5A2Q D;  4AQY C;  4MTN A;  4NXM C;  4B3T C;  3J81 D;  4LF5 C;  3J80 D;  2UXC C;  4JV5 C;  2UXB C;  3IEV A;  4B3S C;  1K0R A;  1VLA A;  4LF6 C;  4JI1 C;  1HNX C;  1USP B;  1ZB9 A;  1HNZ C;  4LF9 C;  4DCU A;  2ATW A;  2EGT A;  3I07 A;  1XNR C;  3T1Y C;  2HHH C;  2PN2 A;  4X64 C;  2DYJ A;  4X66 C;  2CXC A;  4X62 C;  1HNW C;  1ZB8 A;  4JI2 C;  2CY1 A;  1LQL A;  4DV3 C;  4XX2 A;  2UU9 C;  2KZF A;  3R9X A;  1HR0 C;  3AF6 A;  4YHH C;  2F4V C;  4DV4 C;  4DR4 C;  5FLX D;  1N34 C;  1I94 C;  2E7G A;  2BJO A;  4LF4 C;  2YCB A;  3CJE A;  2D7V A;  4DR3 C;  4DUZ C;  1N2F A;  3J7A D;  4DV5 C;  1N33 C;  2JMP A;  1XNQ C;  4DUY C;  4K0K C;  4JI8 C;  4DCS A;  4NOZ A;  4DV6 C;  1NYE A;  4JI7 C;  2ONF A;  2ZM6 C;  4DR1 C;  1JOS A;  4DCT A;  4BSZ A;  5LMN C;  2UUB C;  2UUC C;  4DR5 C;  3EER A;  1IBK C;  4LFB C;  2E8F A;  2VQF C;  5BR8 C;  1IBM C; 
#chains in the Genus database with same CATH topology
 4MH4 A;  1PU1 A;  2D1R A;  4B3M C;  2YWC A;  3O2E A;  1HH2 P;  5AE2 A;  1O90 A;  3N54 B;  4DV0 C;  2QVZ X;  4RM3 A;  2VZE A;  1V25 A;  3KXW A;  1L2F A;  1EGA A;  4JI4 C;  3A26 A;  1IBL C;  4DR7 C;  1NY8 A;  2UXD C;  1O92 A;  1ULT A;  4X65 C;  3LGX A;  5K85 A;  3DLP X;  3DHV A;  1KKG A;  2E8C A;  3B7W A;  4FTF A;  4DG8 A;  4I9F A;  2Y27 A;  2QVX X;  1J5E C;  1M6X A;  1ML8 A;  3VNS A;  5BSU A;  2P2J A;  3IEU A;  4RM2 A;  4YY3 C;  4I9G A;  1IB8 A;  2QVY X;  4JI5 C;  2XR1 A;  3LUS A;  5LMU C;  4JI3 C;  2OPL A;  4D56 A;  3GKU A;  4R1M A;  3IML A;  4FUT A;  2ZZM A;  4MTN A;  4NXM C;  4B3T C;  2UXC C;  2UXB C;  4B3S C;  3UX2 A;  1XHJ A;  3FCE A;  1K0R A;  3UX3 A;  3ETO A;  3E7W A;  1USP B;  3A25 A;  2Y4N A;  2PN2 A;  3TDE A;  2CXC A;  4X62 C;  2P02 A;  1HNW C;  4JI2 C;  5H9U A;  3UZ0 A;  3IPL A;  3FCC A;  3NI2 A;  2UU9 C;  4G1I A;  4OXI A;  3NYQ A;  5BSV A;  4YHH C;  5FLX D;  2E7G A;  5A19 A;  2YCB A;  3CJE A;  2D7V A;  3H2T A;  2PG1 E;  1XNQ C;  4NOZ A;  3A9V A;  1JOS A;  4DR5 C;  2WD9 A;  2OO4 A;  2DHM A;  1VEH A;  4LFB C;  3PRO C;  1MDB A;  2E5L C;  2M5H A;  4EAT A;  4LFC C;  3AF5 A;  1XRB A;  4LF8 C;  3UOW A;  2QW0 X;  5IWA C;  2P2F A;  1UKK A;  1WH9 A;  1USP A;  2M5O A;  4RVO A;  2CU6 A;  4DR6 C;  1O93 A;  4DR2 C;  5KEI A;  4DV2 C;  1N36 C;  4OYC A;  4JI0 C;  1MKY A;  5AE1 A;  3R9W A;  4JYA C;  4OX9 C;  2ZZN A;  2VQE C;  3NPD A;  4WS9 A;  5T8T A;  3OTO C;  1V26 A;  4JI6 C;  2V7B A;  3AY0 A;  3UEB A;  4KHP C;  5A2Q D;  4AQY C;  3I08 A;  1RG9 A;  3CQ2 A;  3J81 D;  3RG2 A;  5BSW A;  4BC7 A;  5DV9 A;  3S82 A;  4LF5 C;  4R1L A;  2D1T A;  1VLA A;  4K0B A;  1PG3 A;  5T8S A;  2P20 A;  1HNX C;  4G36 A;  2D28 C;  3CQ3 A;  1XNR C;  3T1Y C;  2DYJ A;  4L4Q A;  4D57 A;  3GR1 A;  2OBV A;  3R9X A;  2JNV A;  3AF6 A;  4DR4 C;  3C5E A;  5E7Q A;  1I94 C;  1PG4 A;  3A9U A;  2NCL A;  4DR3 C;  3PBK A;  4DUZ C;  1YGT A;  2P2Q A;  2JMP A;  4RLF A;  4JI8 C;  1FLO A;  3L8C A;  5KYT A;  2ONF A;  5LMN C;  4DCT A;  3FM7 A;  1T5D X;  5BSM A;  1IBK C;  4TPS B;  4B3R C;  5BR8 C;  1IBM C;  1XMQ C;  2E8E A;  3T1H C;  1MXC A;  1FJG C;  4DV7 C;  1P7L A;  4KTV A;  2VSQ A;  1XRA A;  5A1I A;  4GXQ A;  4HPV A;  1XMO C;  1MDF A;  4PHT A;  3N2Q A;  4D4I A;  5IT9 D;  4ISB A;  1M6X C;  4LFA C;  4DV1 C;  2D1Q A;  2OPL B;  3DAY A;  1N32 C;  4KTT A;  3NYR A;  1WF3 A;  5CZV A;  1UWD A;  2DPL A;  2QL8 A;  5KYV A;  2D27 A;  1QWI A;  4RVN A;  1MD9 A;  1O9T A;  1FUG A;  3PES A;  4G37 A;  3J80 D;  5BUQ A;  4JV5 C;  5JRH A;  3CQ1 A;  4NDN A;  2Z51 A;  3LAX A;  4U5Y D;  1MXA A;  1ZB9 A;  4LF9 C;  4LE5 A;  4DCU A;  2ATW A;  2EGT A;  3I07 A;  4PZP A;  3L95 X;  4X64 C;  4X66 C;  2YX1 A;  4D4G A;  4PRO C;  1LQL A;  3TQI A;  3E7X A;  2KZF A;  2MMA B;  1MXB A;  1LCI A;  4IR7 A;  4PUH A;  1WCJ A;  1N34 C;  5IFI A;  2BJO A;  1N2F A;  3EQ6 A;  3A4I A;  3SO4 A;  2YWB A;  4ZJZ A;  5BUS A;  4DG9 A;  2ZM6 C;  5CZX A;  5LCI A;  4DR1 C;  2Y4O A;  2UUB C;  4L7I A;  3VNR A;  5GTD A;  4GXR A;  2VQF C;  1XRC A;  3R44 A;  3LNO A;  4PUG A;  1YJ7 A;  4GKK C;  2WP0 C;  4NXN C;  4BC9 A;  4LF7 C;  3ETC A;  2PT7 G;  4GKJ C;  5A1G A;  1RY2 A;  3LNV A;  3TUF A;  2ZTB A;  1BA3 A;  4RLQ A;  4PUI A;  3JAM D;  2PRO A;  2P2B A;  2ASB A;  4DCV A;  1AMU A;  5ADZ A;  1P4E A;  2BH1 X;  2KZ0 A;  1GPM A;  5K8F A;  2UUA C;  1XS3 A;  4FUQ A;  2HJG A;  1PA4 A;  3K6R A;  5AE3 A;  4L2Z A;  2P2M A;  4RMN A;  1V60 A;  3IEV A;  3GR0 A;  1T5H X;  3RV2 A;  4R0M A;  4LF6 C;  4JI1 C;  5BST A;  5BSR A;  1HNZ C;  2HHH C;  4IZ6 A;  4BCA A;  2E0G A;  1ZB8 A;  2CY1 A;  2AYA A;  3CW8 X;  4DV3 C;  4XX2 A;  4ZLP A;  4WV3 A;  2D1S A;  1HR0 C;  2F4V C;  4DV4 C;  3G7S A;  2MM9 A;  3CW9 A;  4LF4 C;  2KDN A;  2MCQ A;  3J7A D;  4DV5 C;  1N33 C;  4BBY A;  4GS5 A;  4DUY C;  1TH5 A;  4K0K C;  4DCS A;  1XDX A;  3GPC A;  4DV6 C;  1NYE A;  4JI7 C;  5BUR A;  4BSZ A;  4ODJ A;  2UUC C;  1QM4 A;  3EER A;  1P4E C;  3VNQ A;  2E8F A;  3TR3 A;  4JM1 A; 
#chains in the Genus database with same CATH homology
 4MH4 A;  4B3M C;  2D1R A;  2YWC A;  1HH2 P;  5AE2 A;  1O90 A;  3N54 B;  4DV0 C;  2QVZ X;  4RM3 A;  2VZE A;  1V25 A;  3KXW A;  1L2F A;  1EGA A;  4JI4 C;  1IBL C;  4DR7 C;  2UXD C;  1O92 A;  1ULT A;  4X65 C;  3LGX A;  5K85 A;  3DLP X;  3DHV A;  1KKG A;  2E8C A;  3B7W A;  4FTF A;  4DG8 A;  4I9F A;  2Y27 A;  2QVX X;  1J5E C;  1ML8 A;  3VNS A;  5BSU A;  2P2J A;  3IEU A;  4RM2 A;  4YY3 C;  4I9G A;  2QVY X;  4JI5 C;  2XR1 A;  3LUS A;  5LMU C;  4JI3 C;  2OPL A;  4D56 A;  3GKU A;  4R1M A;  3IML A;  4FUT A;  4MTN A;  4NXM C;  4B3T C;  2UXC C;  2UXB C;  4B3S C;  3FCE A;  1K0R A;  3ETO A;  3E7W A;  1USP B;  2Y4N A;  2PN2 A;  3TDE A;  2CXC A;  4X62 C;  2P02 A;  1HNW C;  4JI2 C;  5H9U A;  3UZ0 A;  3IPL A;  2UU9 C;  3FCC A;  3NI2 A;  4G1I A;  4OXI A;  3NYQ A;  5BSV A;  4YHH C;  5FLX D;  2E7G A;  5A19 A;  2YCB A;  3CJE A;  2D7V A;  3H2T A;  1XNQ C;  4NOZ A;  3A9V A;  1JOS A;  4DR5 C;  2WD9 A;  2OO4 A;  4LFB C;  3PRO C;  1MDB A;  2E5L C;  4EAT A;  4LFC C;  3AF5 A;  1XRB A;  4LF8 C;  3UOW A;  2QW0 X;  5IWA C;  2P2F A;  1UKK A;  1WH9 A;  1USP A;  4RVO A;  4DR6 C;  1O93 A;  4DR2 C;  5KEI A;  4DV2 C;  1N36 C;  4OYC A;  4JI0 C;  1MKY A;  5AE1 A;  3R9W A;  4JYA C;  4OX9 C;  2VQE C;  3NPD A;  4WS9 A;  5T8T A;  3OTO C;  1V26 A;  4JI6 C;  2V7B A;  4KHP C;  5A2Q D;  4AQY C;  3I08 A;  1RG9 A;  3J81 D;  3RG2 A;  5BSW A;  4BC7 A;  5DV9 A;  3S82 A;  4LF5 C;  4R1L A;  2D1T A;  1VLA A;  4K0B A;  1PG3 A;  5T8S A;  2P20 A;  1HNX C;  4G36 A;  2D28 C;  1XNR C;  3T1Y C;  2DYJ A;  4L4Q A;  4D57 A;  3GR1 A;  2OBV A;  3R9X A;  3AF6 A;  4DR4 C;  3C5E A;  5E7Q A;  1I94 C;  1PG4 A;  3A9U A;  4DR3 C;  3PBK A;  4DUZ C;  2P2Q A;  2JMP A;  4RLF A;  4JI8 C;  3L8C A;  5KYT A;  2ONF A;  5LMN C;  4DCT A;  1T5D X;  5BSM A;  1IBK C;  4TPS B;  4B3R C;  5BR8 C;  1IBM C;  1XMQ C;  2E8E A;  3T1H C;  1MXC A;  1FJG C;  4DV7 C;  1P7L A;  4KTV A;  2VSQ A;  1XRA A;  5A1I A;  4GXQ A;  4HPV A;  1XMO C;  1MDF A;  4PHT A;  3N2Q A;  4D4I A;  5IT9 D;  4ISB A;  4LFA C;  4DV1 C;  2D1Q A;  2OPL B;  3DAY A;  1N32 C;  4KTT A;  3NYR A;  1WF3 A;  5CZV A;  2DPL A;  2QL8 A;  5KYV A;  2D27 A;  1QWI A;  4RVN A;  1MD9 A;  1O9T A;  1FUG A;  3PES A;  4G37 A;  3J80 D;  5BUQ A;  4JV5 C;  5JRH A;  4NDN A;  3LAX A;  4U5Y D;  1MXA A;  1ZB9 A;  4LF9 C;  4LE5 A;  4DCU A;  2ATW A;  2EGT A;  3I07 A;  4PZP A;  3L95 X;  4X64 C;  4X66 C;  4D4G A;  4PRO C;  1LQL A;  3TQI A;  3E7X A;  2KZF A;  1MXB A;  1LCI A;  4IR7 A;  1N34 C;  5IFI A;  2BJO A;  1N2F A;  3EQ6 A;  3A4I A;  3SO4 A;  2YWB A;  4ZJZ A;  5BUS A;  4DG9 A;  2ZM6 C;  5CZX A;  4DR1 C;  2Y4O A;  2UUB C;  4L7I A;  3VNR A;  5GTD A;  4GXR A;  2VQF C;  1XRC A;  3R44 A;  4GKK C;  1YJ7 A;  2WP0 C;  4NXN C;  4BC9 A;  4LF7 C;  3ETC A;  2PT7 G;  4GKJ C;  5A1G A;  1RY2 A;  3LNV A;  3TUF A;  1BA3 A;  4RLQ A;  3JAM D;  2PRO A;  2P2B A;  2ASB A;  4DCV A;  1AMU A;  5ADZ A;  2BH1 X;  5K8F A;  1GPM A;  2UUA C;  4FUQ A;  2HJG A;  1PA4 A;  5AE3 A;  4L2Z A;  2P2M A;  4RMN A;  3IEV A;  3GR0 A;  1T5H X;  3RV2 A;  4R0M A;  4LF6 C;  4JI1 C;  5BST A;  5BSR A;  1HNZ C;  2HHH C;  4IZ6 A;  4BCA A;  2E0G A;  1ZB8 A;  2CY1 A;  2AYA A;  3CW8 X;  4DV3 C;  4XX2 A;  4ZLP A;  4WV3 A;  2D1S A;  1HR0 C;  2F4V C;  4DV4 C;  3G7S A;  3CW9 A;  4LF4 C;  3J7A D;  4DV5 C;  1N33 C;  4BBY A;  4GS5 A;  4DUY C;  4K0K C;  4DCS A;  3GPC A;  4DV6 C;  1NYE A;  4JI7 C;  5BUR A;  4BSZ A;  4ODJ A;  2UUC C;  1QM4 A;  3EER A;  3VNQ A;  2E8F A;  4JM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...