4NXNC

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4nxnC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4nxnC02
3AF5A 4B3SC 1ML8A 4DV0C 4OX9C 4BSZA 2VQFC 3EERA 3J7AD 2E8EA 4B3MC 4JI3C 1MKYA 4DR5C 4DV1C 5LMUC 2E7GA 2UUAC 5FLXD 4JI6C 1UKKA 4DR3C 3T1YC 4DR4C 2HHHC 3R9XA 1IBLC 2UXCC 4JYAC 3T1HC 4MH4A 1HNZC 1WF3A 2E8FA 3AF6A 4JI1C 1HH2P 1ZB9A 4B3RC 4JI4C 2UUBC 4LF8C 1N34C 1HR0C 2PN2A 2ZM6C 2D7VA 1N36C 4JI8C 5BR8C 4DUYC 4X66C 4DV7C 2BJOA 1FJGC 2UU9C 4XX2A 2HJGA 1QWIA 3LUSA 4GKJC 1USPB 4DV4C 1KKGA 4B3TC 4X64C 1VLAA 1HNWC 1NYEA 4AQYC 2XR1A 3IEUA 4DR7C 2ASBA 4JV5C 3GKUA 4YY3C 2OPLB 4DCUA 4DCTA 1IBKC 4DR6C 1USPA 2CXCA 4NOZA 4LF4C 4LF9C 3R9WA 2UXDC 4DV6C 2ATWA 2E8CA 2DYJA 4GKKC 1JOSA 4JI7C 2UXBC 4LFCC 2ONFA 4YHHC 2F4VC 5LMNC 4MTNA 4DV3C 4DV5C 1IBMC 1J5EC 1K0RA 4NXMC 4DCVA 4DR1C 1N33C 4LFBC 3IEVA 1LQLA 1PA4A 5IWAC 4DV2C 1N32C 1I94C 1WH9A 3CJEA 4KHPC 2VQEC 4JI5C 2UUCC 1XNRC 1L2FA 4X65C 2JMPA 2YCBA 3OTOC 1XMOC 5A2QD 4LFAC 3JAMD 4X62C 4DCSA 4DR2C 1XMQC 1EGAA 4LF7C 1HNXC 1ZB8A 4LF5C 3J81D 4NXNC 2CY1A 2QL8A 4JI0C 4LF6C 4JI2C 2OPLA 2PT7G 4K0KC 5IT9D 2KZFA 2E5LC 2EGTA 3I07A 1N2FA 4DUZC 1XNQC 3J80D
chains in the Genus database with same CATH superfamily
1RG9A 1ML8A 4OX9C 3EERA 4D57A 5AE1A 1AMUA 4RVNA 4JI3C 4B3MC 4RM2A 3CQ2A 4I9FA 4DV1C 4R0MA 1VEHA 3T1YC 3DLPX 4KTTA 2UXCC 4G37A 3AF6A 1HH2P 2UUBC 2PN2A 3AY0A 5BSWA 5A1IA 4X66C 1XDXA 3LAXA 4DV7C 2BJOA 3UZ0A 5IFIA 1KKGA 3CQ3A 1P4EC 5A19A 3A9VA 4U5YD 2QVYX 2E0GA 1O92A 1VLAA 3FM7A 2YX1A 4WS9A 3E7WA 4RMNA 2OPLB 1YJ7A 4DCUA 3KXWA 4K0BA 2CXCA 3R9WA 4BBYA 3L8CA 5BSTA 4GKKC 3UX2A 3PROC 2ONFA 1NY8A 3IMLA 4DV5C 3CW8X 4PUHA 4LFBC 1LQLA 1PA4A 5K85A 2V7BA 2UUCC 4PZPA 5H9UA 1V26A 3JAMD 4DR2C 4DCSA 4G1IA 1ZB8A 4NXNC 3DHVA 4LF6C 2P2MA 1O9TA 2MMAB 2PT7G 4K0KC 1MXAA 4ZJZA 2KZFA 2DHMA 2EGTA 1XNQC 1O93A 3AF5A 4HPVA 4B3SC 2VQFC 2P2JA 4GXQA 4D56A 2M5OA 4NDNA 4WV3A 2MM9A 1MKYA 2ZZNA 1UWDA 5KYVA 2UUAC 2ZTBA 1UKKA 2PG1E 1P4EA 4DR4C 5ADZA 2HHHC 5AE3A 4JYAC 5AE2A 4MH4A 1HNZC 1WF3A 2E8FA 4JI1C 4B3RC 4JI4C 4LF8C 4RLQA 4ISBA 2ZM6C 3NI2A 5KYTA 3CW9A 3TQIA 4JI8C 5BR8C 4DUYC 1M6XA 2DPLA 3GR1A 2D1RA 1QWIA 4RLFA 4LE5A 1MDBA 1XRBA 3K6RA 2BH1X 4ZLPA 4AQYC 5BUQA 4YY3C 3UOWA 2D1QA 4OYCA 3A25A 2P20A 2CU6A 1IBKC 1RY2A 2UXDC 4PHTA 3I08A 4LF9C 1IB8A 3A4IA 4FTFA 4RM3A 1O90A 2ATWA 2E8CA 1GPMA 5LCIA 4BCAA 5LMNC 4MTNA 4DV3C 1J5EC 2OBVA 4NXMC 4DCVA 2MCQA 3IEVA 3RG2A 5IWAC 4L7IA 4DV2C 1N32C 2D28C 1WH9A 2VQEC 4JI5C 1XRCA 4OXIA 4BC9A 1V25A 5A2QD 2QVZX 3FCEA 4D4IA 4X62C 4LF7C 3NPDA 1HNXC 3LGXA 2KDNA 5BSVA 2CY1A 3FCCA 3IPLA 3VNSA 3LNOA 4JI2C 3H2TA 3L95X 3I07A 3J80D 3GR0A 2VZEA 4DV0C 4GXRA 3UEBA 2AYAA 3J7AD 2E8EA 4DR5C 3ETOA 2E7GA 2D1SA 5FLXD 4DR3C 4L2ZA 3VNQA 3T1HC 1ZB9A 5T8SA 3N54B 1N34C 1HR0C 3EQ6A 1WCJA 1PG3A 2OO4A 4PUIA 1MXBA 1FJGC 4XX2A 3A26A 4DG9A 4DV4C 2WD9A 2Y27A 2YWCA 1T5HX 3RV2A 1MD9A 1NYEA 2M5HA 3TUFA 1T5DX 3NYRA 1P7LA 3VNRA 4DR7C 4JV5C 3GKUA 3E7XA 4DCTA 2NCLA 4TPSB 5BSMA 2DYJA 3DAYA 3PESA 4JI7C 2UXBC 4LFCC 2ZZMA 2QVXX 4JM1A 1YGTA 3UX3A 4DR1C 3GPCA 5GTDA 2WP0C 3TDEA 3S82A 4KHPC 1XNRC 1L2FA 1PU1A 2YCBA 3OTOC 4D4GA 5BUSA 1XMOC 2KZ0A 4R1MA 4BC7A 4LFAC 1XMQC 3J81D 4L4QA 2JNVA 4JI0C 3TR3A 4ODJA 1XRAA 2E5LC 4DUZC 1BA3A 1LCIA 4BSZA 5E7QA 1XS3A 2D1TA 2YWBA 3O2EA 5DV9A 5LMUC 4JI6C 1ULTA 2PROA 5A1GA 2Y4NA 5BSRA 3R9XA 1IBLC 4PUGA 4FUTA 4IR7A 4EATA 5BSUA 5CZVA 3ETCA 2D27A 2Z51A 5CZXA 4G36A 2D7VA 1N36C 4DG8A 3A9UA 5JRHA 2P2QA 2UU9C 2HJGA 2P02A 3LUSA 4GKJC 1PG4A 1USPB 4B3TC 4PROC 4X64C 1MDFA 1HNWC 2XR1A 3R44A 1M6XC 3CQ1A 3IEUA 2ASBA 3N2QA 1XHJA 4DR6C 3SO4A 3LNVA 1USPA 5K8FA 4NOZA 4LF4C 4DV6C 1MXCA 2P2BA 4GS5A 1JOSA 3PBKA 4YHHC 2F4VC 1IBMC 3C5EA 2P2FA 1K0RA 5BURA 2VSQA 5T8TA 1N33C 1I94C 3CJEA 3B7WA 4FUQA 4RVOA 4X65C 4IZ6A 1V60A 2JMPA 4R1LA 2Y4OA 1TH5A 1EGAA 3G7SA 4LF5C 2QL8A 4KTVA 2OPLA 5KEIA 1FUGA 5IT9D 2QW0X 4I9GA 1QM4A 1FLOA 1N2FA 3NYQA
chains in the Genus database with same CATH topology
1RG9A 1ML8A 4OX9C 3EERA 4D57A 5AE1A 1AMUA 4RVNA 4JI3C 4B3MC 4RM2A 4I9FA 4DV1C 4R0MA 3T1YC 3DLPX 4KTTA 2UXCC 4G37A 3AF6A 1HH2P 2UUBC 2PN2A 5BSWA 5A1IA 4X66C 3LAXA 4DV7C 2BJOA 3UZ0A 5IFIA 1KKGA 5A19A 3A9VA 4U5YD 2QVYX 2E0GA 1O92A 1VLAA 4WS9A 3E7WA 4RMNA 2OPLB 1YJ7A 4DCUA 3KXWA 4K0BA 2CXCA 3R9WA 4BBYA 3L8CA 5BSTA 4GKKC 3PROC 2ONFA 3IMLA 4DV5C 3CW8X 4LFBC 1LQLA 1PA4A 5K85A 2V7BA 2UUCC 4PZPA 5H9UA 1V26A 3JAMD 4DR2C 4DCSA 4G1IA 1ZB8A 4NXNC 3DHVA 4LF6C 2P2MA 1O9TA 2PT7G 4K0KC 1MXAA 4ZJZA 2KZFA 2EGTA 1XNQC 1O93A 3AF5A 4HPVA 4B3SC 2VQFC 2P2JA 4GXQA 4D56A 4NDNA 4WV3A 1MKYA 5KYVA 2UUAC 1UKKA 4DR4C 5ADZA 2HHHC 5AE3A 4JYAC 5AE2A 4MH4A 1HNZC 1WF3A 4JI1C 2E8FA 4B3RC 4JI4C 4LF8C 4RLQA 4ISBA 2ZM6C 3NI2A 5KYTA 3CW9A 3TQIA 4JI8C 5BR8C 4DUYC 2DPLA 3GR1A 2D1RA 1QWIA 4RLFA 4LE5A 1MDBA 1XRBA 2BH1X 4ZLPA 4AQYC 5BUQA 4YY3C 3UOWA 2D1QA 4OYCA 2P20A 1IBKC 1RY2A 2UXDC 4PHTA 3I08A 4LF9C 3A4IA 4FTFA 4RM3A 1O90A 2ATWA 2E8CA 1GPMA 4BCAA 5LMNC 4MTNA 4DV3C 1J5EC 2OBVA 4NXMC 4DCVA 3IEVA 3RG2A 5IWAC 4L7IA 4DV2C 1N32C 2D28C 1WH9A 2VQEC 4JI5C 1XRCA 4OXIA 4BC9A 1V25A 2QVZX 5A2QD 3FCEA 4D4IA 4X62C 4LF7C 3NPDA 1HNXC 3LGXA 5BSVA 2CY1A 3FCCA 3IPLA 3VNSA 4JI2C 3H2TA 3L95X 3I07A 3J80D 3GR0A 2VZEA 4DV0C 4GXRA 2AYAA 3J7AD 2E8EA 4DR5C 3ETOA 2E7GA 2D1SA 5FLXD 4DR3C 4L2ZA 3VNQA 3T1HC 1ZB9A 5T8SA 3N54B 1N34C 1HR0C 3EQ6A 1PG3A 2OO4A 1MXBA 1FJGC 4XX2A 4DG9A 4DV4C 2WD9A 2Y27A 2YWCA 1T5HX 3RV2A 1MD9A 1NYEA 3TUFA 1T5DX 3NYRA 1P7LA 3VNRA 4DR7C 4JV5C 3GKUA 3E7XA 4DCTA 4TPSB 5BSMA 2DYJA 3DAYA 3PESA 4JI7C 2UXBC 4LFCC 2QVXX 4JM1A 4DR1C 3GPCA 5GTDA 2WP0C 3TDEA 3S82A 4KHPC 1XNRC 1L2FA 2YCBA 3OTOC 4D4GA 5BUSA 1XMOC 4R1MA 4BC7A 4LFAC 1XMQC 3J81D 4L4QA 4JI0C 4ODJA 1XRAA 2E5LC 4DUZC 1BA3A 1LCIA 4BSZA 5E7QA 2D1TA 2YWBA 5DV9A 5LMUC 4JI6C 1ULTA 2PROA 5A1GA 2Y4NA 5BSRA 3R9XA 1IBLC 4FUTA 4IR7A 4EATA 5BSUA 5CZVA 3ETCA 2D27A 5CZXA 4G36A 2D7VA 1N36C 4DG8A 3A9UA 5JRHA 2P2QA 2UU9C 2HJGA 2P02A 3LUSA 4GKJC 1PG4A 1USPB 4B3TC 4PROC 4X64C 1MDFA 1HNWC 2XR1A 3R44A 3IEUA 2ASBA 3N2QA 4DR6C 3SO4A 3LNVA 1USPA 5K8FA 4NOZA 4LF4C 4DV6C 1MXCA 2P2BA 4GS5A 1JOSA 3PBKA 4YHHC 2F4VC 1IBMC 3C5EA 2P2FA 1K0RA 5BURA 2VSQA 5T8TA 1N33C 1I94C 3CJEA 3B7WA 4FUQA 4RVOA 4X65C 4IZ6A 2JMPA 4R1LA 2Y4OA 3G7SA 1EGAA 4LF5C 2QL8A 4KTVA 2OPLA 5KEIA 1FUGA 5IT9D 2QW0X 4I9GA 1QM4A 1N2FA 3NYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AF5 A;  4B3S C;  1ML8 A;  4DV0 C;  4OX9 C;  4BSZ A;  2VQF C;  3EER A;  3J7A D;  2E8E A;  4B3M C;  4JI3 C;  1MKY A;  4DR5 C;  4DV1 C;  5LMU C;  2E7G A;  2UUA C;  5FLX D;  4JI6 C;  1UKK A;  4DR3 C;  3T1Y C;  4DR4 C;  2HHH C;  3R9X A;  1IBL C;  2UXC C;  4JYA C;  3T1H C;  4MH4 A;  1HNZ C;  1WF3 A;  2E8F A;  3AF6 A;  4JI1 C;  1HH2 P;  1ZB9 A;  4B3R C;  4JI4 C;  2UUB C;  4LF8 C;  1N34 C;  1HR0 C;  2PN2 A;  2ZM6 C;  2D7V A;  1N36 C;  4JI8 C;  5BR8 C;  4DUY C;  4X66 C;  4DV7 C;  2BJO A;  1FJG C;  2UU9 C;  4XX2 A;  2HJG A;  1QWI A;  3LUS A;  4GKJ C;  1USP B;  4DV4 C;  1KKG A;  4B3T C;  4X64 C;  1VLA A;  1HNW C;  1NYE A;  4AQY C;  2XR1 A;  3IEU A;  4DR7 C;  2ASB A;  4JV5 C;  3GKU A;  4YY3 C;  2OPL B;  4DCU A;  4DCT A;  1IBK C;  4DR6 C;  1USP A;  2CXC A;  4NOZ A;  4LF4 C;  4LF9 C;  3R9W A;  2UXD C;  4DV6 C;  2ATW A;  2E8C A;  2DYJ A;  4GKK C;  1JOS A;  4JI7 C;  2UXB C;  4LFC C;  2ONF A;  4YHH C;  2F4V C;  5LMN C;  4MTN A;  4DV3 C;  4DV5 C;  1IBM C;  1J5E C;  1K0R A;  4NXM C;  4DCV A;  4DR1 C;  1N33 C;  4LFB C;  3IEV A;  1LQL A;  1PA4 A;  5IWA C;  4DV2 C;  1N32 C;  1I94 C;  1WH9 A;  3CJE A;  4KHP C;  2VQE C;  4JI5 C;  2UUC C;  1XNR C;  1L2F A;  4X65 C;  2JMP A;  2YCB A;  3OTO C;  1XMO C;  5A2Q D;  4LFA C;  3JAM D;  4X62 C;  4DCS A;  4DR2 C;  1XMQ C;  1EGA A;  4LF7 C;  1HNX C;  1ZB8 A;  4LF5 C;  3J81 D;  4NXN C;  2CY1 A;  2QL8 A;  4JI0 C;  4LF6 C;  4JI2 C;  2OPL A;  2PT7 G;  4K0K C;  5IT9 D;  2KZF A;  2E5L C;  2EGT A;  3I07 A;  1N2F A;  4DUZ C;  1XNQ C;  3J80 D; 
#chains in the Genus database with same CATH topology
 1RG9 A;  1ML8 A;  4OX9 C;  3EER A;  4D57 A;  5AE1 A;  1AMU A;  4RVN A;  4JI3 C;  4B3M C;  4RM2 A;  3CQ2 A;  4I9F A;  4DV1 C;  4R0M A;  1VEH A;  3T1Y C;  3DLP X;  4KTT A;  2UXC C;  4G37 A;  3AF6 A;  1HH2 P;  2UUB C;  2PN2 A;  3AY0 A;  5BSW A;  5A1I A;  4X66 C;  1XDX A;  3LAX A;  4DV7 C;  2BJO A;  3UZ0 A;  5IFI A;  1KKG A;  3CQ3 A;  1P4E C;  5A19 A;  3A9V A;  4U5Y D;  2QVY X;  2E0G A;  1O92 A;  1VLA A;  3FM7 A;  2YX1 A;  4WS9 A;  3E7W A;  4RMN A;  2OPL B;  1YJ7 A;  4DCU A;  3KXW A;  4K0B A;  2CXC A;  3R9W A;  4BBY A;  3L8C A;  5BST A;  4GKK C;  3UX2 A;  3PRO C;  2ONF A;  1NY8 A;  3IML A;  4DV5 C;  3CW8 X;  4PUH A;  4LFB C;  1LQL A;  1PA4 A;  5K85 A;  2V7B A;  2UUC C;  4PZP A;  5H9U A;  1V26 A;  3JAM D;  4DR2 C;  4DCS A;  4G1I A;  1ZB8 A;  4NXN C;  3DHV A;  4LF6 C;  2P2M A;  1O9T A;  2MMA B;  2PT7 G;  4K0K C;  1MXA A;  4ZJZ A;  2KZF A;  2DHM A;  2EGT A;  1XNQ C;  1O93 A;  3AF5 A;  4HPV A;  4B3S C;  2VQF C;  2P2J A;  4GXQ A;  4D56 A;  2M5O A;  4NDN A;  4WV3 A;  2MM9 A;  1MKY A;  2ZZN A;  1UWD A;  5KYV A;  2UUA C;  2ZTB A;  1UKK A;  2PG1 E;  1P4E A;  4DR4 C;  5ADZ A;  2HHH C;  5AE3 A;  4JYA C;  5AE2 A;  4MH4 A;  1HNZ C;  1WF3 A;  2E8F A;  4JI1 C;  4B3R C;  4JI4 C;  4LF8 C;  4RLQ A;  4ISB A;  2ZM6 C;  3NI2 A;  5KYT A;  3CW9 A;  3TQI A;  4JI8 C;  5BR8 C;  4DUY C;  1M6X A;  2DPL A;  3GR1 A;  2D1R A;  1QWI A;  4RLF A;  4LE5 A;  1MDB A;  1XRB A;  3K6R A;  2BH1 X;  4ZLP A;  4AQY C;  5BUQ A;  4YY3 C;  3UOW A;  2D1Q A;  4OYC A;  3A25 A;  2P20 A;  2CU6 A;  1IBK C;  1RY2 A;  2UXD C;  4PHT A;  3I08 A;  4LF9 C;  1IB8 A;  3A4I A;  4FTF A;  4RM3 A;  1O90 A;  2ATW A;  2E8C A;  1GPM A;  5LCI A;  4BCA A;  5LMN C;  4MTN A;  4DV3 C;  1J5E C;  2OBV A;  4NXM C;  4DCV A;  2MCQ A;  3IEV A;  3RG2 A;  5IWA C;  4L7I A;  4DV2 C;  1N32 C;  2D28 C;  1WH9 A;  2VQE C;  4JI5 C;  1XRC A;  4OXI A;  4BC9 A;  1V25 A;  5A2Q D;  2QVZ X;  3FCE A;  4D4I A;  4X62 C;  4LF7 C;  3NPD A;  1HNX C;  3LGX A;  2KDN A;  5BSV A;  2CY1 A;  3FCC A;  3IPL A;  3VNS A;  3LNO A;  4JI2 C;  3H2T A;  3L95 X;  3I07 A;  3J80 D;  3GR0 A;  2VZE A;  4DV0 C;  4GXR A;  3UEB A;  2AYA A;  3J7A D;  2E8E A;  4DR5 C;  3ETO A;  2E7G A;  2D1S A;  5FLX D;  4DR3 C;  4L2Z A;  3VNQ A;  3T1H C;  1ZB9 A;  5T8S A;  3N54 B;  1N34 C;  1HR0 C;  3EQ6 A;  1WCJ A;  1PG3 A;  2OO4 A;  4PUI A;  1MXB A;  1FJG C;  4XX2 A;  3A26 A;  4DG9 A;  4DV4 C;  2WD9 A;  2Y27 A;  2YWC A;  1T5H X;  3RV2 A;  1MD9 A;  1NYE A;  2M5H A;  3TUF A;  1T5D X;  3NYR A;  1P7L A;  3VNR A;  4DR7 C;  4JV5 C;  3GKU A;  3E7X A;  4DCT A;  2NCL A;  4TPS B;  5BSM A;  2DYJ A;  3DAY A;  3PES A;  4JI7 C;  2UXB C;  4LFC C;  2ZZM A;  2QVX X;  4JM1 A;  1YGT A;  3UX3 A;  4DR1 C;  3GPC A;  5GTD A;  2WP0 C;  3TDE A;  3S82 A;  4KHP C;  1XNR C;  1L2F A;  1PU1 A;  2YCB A;  3OTO C;  4D4G A;  5BUS A;  1XMO C;  2KZ0 A;  4R1M A;  4BC7 A;  4LFA C;  1XMQ C;  3J81 D;  4L4Q A;  2JNV A;  4JI0 C;  3TR3 A;  4ODJ A;  1XRA A;  2E5L C;  4DUZ C;  1BA3 A;  1LCI A;  4BSZ A;  5E7Q A;  1XS3 A;  2D1T A;  2YWB A;  3O2E A;  5DV9 A;  5LMU C;  4JI6 C;  1ULT A;  2PRO A;  5A1G A;  2Y4N A;  5BSR A;  3R9X A;  1IBL C;  4PUG A;  4FUT A;  4IR7 A;  4EAT A;  5BSU A;  5CZV A;  3ETC A;  2D27 A;  2Z51 A;  5CZX A;  4G36 A;  2D7V A;  1N36 C;  4DG8 A;  3A9U A;  5JRH A;  2P2Q A;  2UU9 C;  2HJG A;  2P02 A;  3LUS A;  4GKJ C;  1PG4 A;  1USP B;  4B3T C;  4PRO C;  4X64 C;  1MDF A;  1HNW C;  2XR1 A;  3R44 A;  1M6X C;  3CQ1 A;  3IEU A;  2ASB A;  3N2Q A;  1XHJ A;  4DR6 C;  3SO4 A;  3LNV A;  1USP A;  5K8F A;  4NOZ A;  4LF4 C;  4DV6 C;  1MXC A;  2P2B A;  4GS5 A;  1JOS A;  3PBK A;  4YHH C;  2F4V C;  1IBM C;  3C5E A;  2P2F A;  1K0R A;  5BUR A;  2VSQ A;  5T8T A;  1N33 C;  1I94 C;  3CJE A;  3B7W A;  4FUQ A;  4RVO A;  4X65 C;  4IZ6 A;  1V60 A;  2JMP A;  4R1L A;  2Y4O A;  1TH5 A;  1EGA A;  3G7S A;  4LF5 C;  2QL8 A;  4KTV A;  2OPL A;  5KEI A;  1FUG A;  5IT9 D;  2QW0 X;  4I9G A;  1QM4 A;  1FLO A;  1N2F A;  3NYQ A; 
#chains in the Genus database with same CATH homology
 1RG9 A;  1ML8 A;  4OX9 C;  3EER A;  4D57 A;  5AE1 A;  1AMU A;  4RVN A;  4JI3 C;  4B3M C;  4RM2 A;  4I9F A;  4DV1 C;  4R0M A;  3T1Y C;  3DLP X;  4KTT A;  2UXC C;  4G37 A;  3AF6 A;  1HH2 P;  2UUB C;  2PN2 A;  5BSW A;  5A1I A;  4X66 C;  3LAX A;  4DV7 C;  2BJO A;  3UZ0 A;  5IFI A;  1KKG A;  5A19 A;  3A9V A;  4U5Y D;  2QVY X;  2E0G A;  1O92 A;  1VLA A;  4WS9 A;  3E7W A;  4RMN A;  2OPL B;  1YJ7 A;  4DCU A;  3KXW A;  4K0B A;  2CXC A;  3R9W A;  4BBY A;  3L8C A;  5BST A;  4GKK C;  3PRO C;  2ONF A;  3IML A;  4DV5 C;  3CW8 X;  4LFB C;  1LQL A;  1PA4 A;  5K85 A;  2V7B A;  2UUC C;  4PZP A;  5H9U A;  1V26 A;  3JAM D;  4DR2 C;  4DCS A;  4G1I A;  1ZB8 A;  4NXN C;  3DHV A;  4LF6 C;  2P2M A;  1O9T A;  2PT7 G;  4K0K C;  1MXA A;  4ZJZ A;  2KZF A;  2EGT A;  1XNQ C;  1O93 A;  3AF5 A;  4HPV A;  4B3S C;  2VQF C;  2P2J A;  4GXQ A;  4D56 A;  4NDN A;  4WV3 A;  1MKY A;  5KYV A;  2UUA C;  1UKK A;  4DR4 C;  5ADZ A;  2HHH C;  5AE3 A;  4JYA C;  5AE2 A;  4MH4 A;  1HNZ C;  1WF3 A;  4JI1 C;  2E8F A;  4B3R C;  4JI4 C;  4LF8 C;  4RLQ A;  4ISB A;  2ZM6 C;  3NI2 A;  5KYT A;  3CW9 A;  3TQI A;  4JI8 C;  5BR8 C;  4DUY C;  2DPL A;  3GR1 A;  2D1R A;  1QWI A;  4RLF A;  4LE5 A;  1MDB A;  1XRB A;  2BH1 X;  4ZLP A;  4AQY C;  5BUQ A;  4YY3 C;  3UOW A;  2D1Q A;  4OYC A;  2P20 A;  1IBK C;  1RY2 A;  2UXD C;  4PHT A;  3I08 A;  4LF9 C;  3A4I A;  4FTF A;  4RM3 A;  1O90 A;  2ATW A;  2E8C A;  1GPM A;  4BCA A;  5LMN C;  4MTN A;  4DV3 C;  1J5E C;  2OBV A;  4NXM C;  4DCV A;  3IEV A;  3RG2 A;  5IWA C;  4L7I A;  4DV2 C;  1N32 C;  2D28 C;  1WH9 A;  2VQE C;  4JI5 C;  1XRC A;  4OXI A;  4BC9 A;  1V25 A;  2QVZ X;  5A2Q D;  3FCE A;  4D4I A;  4X62 C;  4LF7 C;  3NPD A;  1HNX C;  3LGX A;  5BSV A;  2CY1 A;  3FCC A;  3IPL A;  3VNS A;  4JI2 C;  3H2T A;  3L95 X;  3I07 A;  3J80 D;  3GR0 A;  2VZE A;  4DV0 C;  4GXR A;  2AYA A;  3J7A D;  2E8E A;  4DR5 C;  3ETO A;  2E7G A;  2D1S A;  5FLX D;  4DR3 C;  4L2Z A;  3VNQ A;  3T1H C;  1ZB9 A;  5T8S A;  3N54 B;  1N34 C;  1HR0 C;  3EQ6 A;  1PG3 A;  2OO4 A;  1MXB A;  1FJG C;  4XX2 A;  4DG9 A;  4DV4 C;  2WD9 A;  2Y27 A;  2YWC A;  1T5H X;  3RV2 A;  1MD9 A;  1NYE A;  3TUF A;  1T5D X;  3NYR A;  1P7L A;  3VNR A;  4DR7 C;  4JV5 C;  3GKU A;  3E7X A;  4DCT A;  4TPS B;  5BSM A;  2DYJ A;  3DAY A;  3PES A;  4JI7 C;  2UXB C;  4LFC C;  2QVX X;  4JM1 A;  4DR1 C;  3GPC A;  5GTD A;  2WP0 C;  3TDE A;  3S82 A;  4KHP C;  1XNR C;  1L2F A;  2YCB A;  3OTO C;  4D4G A;  5BUS A;  1XMO C;  4R1M A;  4BC7 A;  4LFA C;  1XMQ C;  3J81 D;  4L4Q A;  4JI0 C;  4ODJ A;  1XRA A;  2E5L C;  4DUZ C;  1BA3 A;  1LCI A;  4BSZ A;  5E7Q A;  2D1T A;  2YWB A;  5DV9 A;  5LMU C;  4JI6 C;  1ULT A;  2PRO A;  5A1G A;  2Y4N A;  5BSR A;  3R9X A;  1IBL C;  4FUT A;  4IR7 A;  4EAT A;  5BSU A;  5CZV A;  3ETC A;  2D27 A;  5CZX A;  4G36 A;  2D7V A;  1N36 C;  4DG8 A;  3A9U A;  5JRH A;  2P2Q A;  2UU9 C;  2HJG A;  2P02 A;  3LUS A;  4GKJ C;  1PG4 A;  1USP B;  4B3T C;  4PRO C;  4X64 C;  1MDF A;  1HNW C;  2XR1 A;  3R44 A;  3IEU A;  2ASB A;  3N2Q A;  4DR6 C;  3SO4 A;  3LNV A;  1USP A;  5K8F A;  4NOZ A;  4LF4 C;  4DV6 C;  1MXC A;  2P2B A;  4GS5 A;  1JOS A;  3PBK A;  4YHH C;  2F4V C;  1IBM C;  3C5E A;  2P2F A;  1K0R A;  5BUR A;  2VSQ A;  5T8T A;  1N33 C;  1I94 C;  3CJE A;  3B7W A;  4FUQ A;  4RVO A;  4X65 C;  4IZ6 A;  2JMP A;  4R1L A;  2Y4O A;  3G7S A;  1EGA A;  4LF5 C;  2QL8 A;  4KTV A;  2OPL A;  5KEI A;  1FUG A;  5IT9 D;  2QW0 X;  4I9G A;  1QM4 A;  1N2F A;  3NYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...