4NXNC

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4nxnC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4nxnC02
4JYAC 1J5EC 1USPA 4JI4C 1PA4A 1IBKC 4LF9C 4JI1C 3CJEA 4DR7C 4MH4A 1N36C 2E5LC 2ZM6C 2VQEC 4LFBC 2VQFC 1EGAA 2UUCC 4YY3C 1KKGA 2DYJA 4NOZA 1XMQC 1FJGC 1ML8A 1XMOC 3R9WA 2EGTA 4JI0C 4DCSA 2CXCA 3R9XA 2OPLA 1NYEA 4X64C 1HH2P 1USPB 4K0KC 2E8CA 2JMPA 2HJGA 2D7VA 2E8EA 2ATWA 2QL8A 4XX2A 1N2FA 4DR5C 4DR2C 4X65C 1HNZC 5LMUC 4DV7C 1N32C 2KZFA 2XR1A 1XNQC 4DUYC 4LF5C 4DR6C 4JI5C 4GKKC 4LFCC 2PT7G 2UUAC 1N33C 3AF6A 4DCUA 5IWAC 4MTNA 2OPLB 4DCVA 3AF5A 1HNWC 5BR8C 4DR3C 2E8FA 2HHHC 2E7GA 4B3MC 4JI8C 4JI6C 4DV0C 4LF4C 3EERA 4JI2C 1MKYA 2UXDC 4DR4C 4AQYC 3IEVA 2UXBC 2UUBC 4GKJC 1HNXC 1I94C 4DV3C 5FLXD 4OX9C 3J80D 4DCTA 4JV5C 1HR0C 4DV1C 2ASBA 4NXMC 3T1YC 1K0RA 4YHHC 1UKKA 1JOSA 2UU9C 4DV4C 1IBMC 1ZB8A 4DV5C 1QWIA 1L2FA 3OTOC 3JAMD 2ONFA 1WH9A 3J7AD 2BJOA 5LMNC 4LFAC 4B3TC 3T1HC 1WF3A 4BSZA 4LF8C 1N34C 1XNRC 4B3SC 4DUZC 2CY1A 4DV2C 5IT9D 3I07A 4LF7C 4JI7C 2UXCC 2YCBA 4DV6C 4DR1C 4KHPC 4X62C 4NXNC 4B3RC 4JI3C 3IEUA 1VLAA 1ZB9A 3J81D 2F4VC 1LQLA 2PN2A 5A2QD 3GKUA 4X66C 4LF6C 1IBLC 3LUSA
chains in the Genus database with same CATH superfamily
4BBYA 4L7IA 3A4IA 1PA4A 2D1RA 3UOWA 2P02A 2ZTBA 2D1SA 5DV9A 1XHJA 4NDNA 2E5LC 3B7WA 2YWBA 1M6XA 1MDFA 4RM3A 4YY3C 1KKGA 1IB8A 3ETCA 3IMLA 4NOZA 1XMQC 3C5EA 2NCLA 2BH1X 4JI0C 5BSMA 1XRBA 4DCSA 2CXCA 2OPLA 1USPB 5A1GA 4GXQA 1N2FA 4DR5C 3DHVA 1MD9A 3UZ0A 2KZFA 2XR1A 4G36A 3A26A 4G1IA 1PG4A 2UUAC 3R44A 4R0MA 1N33C 1V60A 5CZXA 5IWAC 4MTNA 5KYVA 3AF5A 3DAYA 1T5DX 4BCAA 3FM7A 4JI8C 2ZZNA 4PHTA 4JI2C 1MKYA 1RG9A 1PU1A 4DR4C 2UXBC 1PG3A 3LNOA 4I9FA 1MDBA 3J80D 3N2QA 4DCTA 4FUTA 3S82A 1UKKA 4D4IA 1XDXA 1IBMC 1RY2A 4DV5C 4OYCA 2QW0X 1LCIA 2ONFA 1WH9A 5T8TA 3J7AD 3I08A 4R1LA 5LMNC 4B3TC 1N34C 4FUQA 2YWCA 4DV2C 2Y4OA 4I9GA 4PUGA 3UEBA 4WS9A 1FLOA 3G7SA 5A19A 1O9TA 3K6RA 4TPSB 3RV2A 3VNQA 3TDEA 3NYQA 3GKUA 5BUQA 4X66C 2M5HA 3TR3A 4HPVA 3GR0A 4WV3A 4JI4C 2YX1A 2DHMA 1T5HX 1N36C 2VQEC 5E7QA 4RLFA 4BC7A 3UX2A 2MM9A 3SO4A 1XMOC 3R9WA 3NPDA 1HH2P 2HJGA 1P7LA 2OO4A 4L2ZA 5BSTA 2D7VA 1GPMA 5BSUA 4XX2A 3LAXA 4D4GA 4DR2C 4X65C 2P20A 1HNZC 4DV7C 5AE3A 4ODJA 2MMAB 4GKKC 5KEIA 1YJ7A 5BURA 3AF6A 1M6XC 4DCUA 2OPLB 1QM4A 2P2BA 1V26A 4DR3C 2ZZMA 4RVNA 3O2EA 2HHHC 2E7GA 3TQIA 2PROA 3L8CA 4AQYC 1MXCA 1P4EA 1I94C 5FLXD 3GR1A 1HR0C 2ASBA 3A25A 4DG8A 3CQ3A 1ZB8A 3NI2A 3OTOC 4EATA 5IFIA 4KTVA 3T1HC 2CY1A 3I07A 4JI7C 4KHPC 1XRAA 2D1TA 3IPLA 2Z51A 4JI3C 1O93A 3J81D 2F4VC 5AE2A 2PN2A 2D1QA 5JRHA 2P2MA 4LF6C 5GTDA 1IBLC 4PZPA 2V7BA 4JYAC 3FCEA 3TUFA 4LF9C 4JI1C 4MH4A 2M5OA 2Y4NA 5KYTA 4LFBC 2VQFC 2UUCC 3A9UA 2P2JA 2EGTA 4R1MA 3R9XA 1NYEA 3E7XA 4X64C 4K0KC 4ZJZA 2E8CA 2ATWA 3CW9A 3PESA 4ZLPA 1TH5A 4GS5A 2QVXX 5LMUC 4DUYC 4LF5C 4JI5C 4PROC 4LFCC 3VNRA 1VEHA 2PT7G 4L4QA 2DPLA 3EQ6A 4IR7A 4KTTA 1HNWC 2MCQA 3CQ1A 5BR8C 1O92A 1MXAA 2E8FA 4B3MC 4JI6C 2KDNA 3EERA 2UXDC 3IEVA 4PUHA 2WD9A 2UUBC 4PUIA 4GKJC 1HNXC 4DV3C 4OX9C 4JV5C 2D27A 2CU6A 4NXMC 5T8SA 4YHHC 1UWDA 1JOSA 2UU9C 3ETOA 1QWIA 2VSQA 2P2FA 5AE1A 3JAMD 1FUGA 1WF3A 4G37A 4BSZA 4LF8C 1XNRC 4B3SC 5IT9D 5A1IA 2UXCC 4DR1C 5BSWA 5K8FA 4NXNC 3IEUA 1BA3A 1P4EC 2VZEA 1LQLA 2D28C 5A2QD 3E7WA 3LGXA 3GPCA 5BUSA 3PROC 1AMUA 3LUSA 1J5EC 1USPA 3AY0A 1O90A 1IBKC 3PBKA 1MXBA 2OBVA 3CJEA 4DR7C 4RVOA 2ZM6C 4GXRA 1EGAA 3LNVA 1XRCA 2DYJA 2PG1E 5LCIA 3CQ2A 2E0GA 4U5YD 5K85A 2Y27A 1FJGC 1ML8A 2WP0C 5CZVA 3NYRA 1WCJA 2AYAA 2QVYX 2JMPA 3VNSA 2E8EA 2QL8A 1N32C 1XNQC 4RMNA 3L95X 4DR6C 1V25A 3DLPX 3RG2A 4IZ6A 1XS3A 4DCVA 4D56A 4FTFA 1NY8A 3A9VA 4DV0C 4LF4C 2QVZX 3KXWA 3FCCA 1YGTA 4DG9A 4DV1C 4OXIA 3T1YC 1K0RA 4D57A 4JM1A 4DV4C 3N54B 3UX3A 1L2FA 5ADZA 2JNVA 1ULTA 2BJOA 4RM2A 3CW8X 4LFAC 5H9UA 4RLQA 4DUZC 4LF7C 3H2TA 4LE5A 2YCBA 4DV6C 2KZ0A 2P2QA 4X62C 4B3RC 5BSVA 1VLAA 4BC9A 1ZB9A 4K0BA 5BSRA 4ISBA
chains in the Genus database with same CATH topology
4BBYA 4L7IA 3A4IA 1PA4A 2D1RA 3UOWA 2P02A 2D1SA 5DV9A 4NDNA 2E5LC 3B7WA 2YWBA 1MDFA 4RM3A 4YY3C 1KKGA 3ETCA 3IMLA 4NOZA 1XMQC 3C5EA 2BH1X 4JI0C 5BSMA 1XRBA 4DCSA 2CXCA 2OPLA 1USPB 5A1GA 4GXQA 1N2FA 4DR5C 3DHVA 1MD9A 3UZ0A 2KZFA 2XR1A 4G36A 4G1IA 1PG4A 2UUAC 3R44A 4R0MA 1N33C 5CZXA 5IWAC 4MTNA 5KYVA 3AF5A 3DAYA 1T5DX 4BCAA 4JI8C 4PHTA 4JI2C 1MKYA 1RG9A 4DR4C 2UXBC 1PG3A 4I9FA 1MDBA 3J80D 3N2QA 4DCTA 4FUTA 3S82A 1UKKA 4D4IA 1IBMC 1RY2A 4DV5C 4OYCA 2QW0X 1LCIA 2ONFA 1WH9A 5T8TA 3J7AD 3I08A 4R1LA 5LMNC 4B3TC 1N34C 4FUQA 2YWCA 4DV2C 2Y4OA 4I9GA 4WS9A 3G7SA 5A19A 1O9TA 4TPSB 3RV2A 3VNQA 3TDEA 3NYQA 3GKUA 5BUQA 4X66C 4HPVA 3GR0A 4WV3A 4JI4C 1T5HX 1N36C 2VQEC 5E7QA 4RLFA 4BC7A 3SO4A 1XMOC 3R9WA 3NPDA 1HH2P 2HJGA 1P7LA 2OO4A 4L2ZA 5BSTA 2D7VA 1GPMA 5BSUA 4XX2A 3LAXA 4D4GA 4DR2C 4X65C 2P20A 1HNZC 4DV7C 5AE3A 4ODJA 4GKKC 5KEIA 1YJ7A 5BURA 3AF6A 4DCUA 2OPLB 1QM4A 2P2BA 1V26A 4DR3C 4RVNA 2HHHC 2E7GA 3TQIA 2PROA 3L8CA 4AQYC 1MXCA 1I94C 5FLXD 3GR1A 1HR0C 2ASBA 4DG8A 1ZB8A 3NI2A 3OTOC 4EATA 5IFIA 4KTVA 3T1HC 2CY1A 3I07A 4JI7C 4KHPC 1XRAA 2D1TA 3IPLA 4JI3C 1O93A 3J81D 2F4VC 5AE2A 2PN2A 2D1QA 5JRHA 2P2MA 4LF6C 5GTDA 1IBLC 4PZPA 2V7BA 4JYAC 3FCEA 3TUFA 4LF9C 4JI1C 4MH4A 2Y4NA 5KYTA 4LFBC 2VQFC 2UUCC 3A9UA 2P2JA 2EGTA 4R1MA 3R9XA 1NYEA 3E7XA 4X64C 4K0KC 4ZJZA 2E8CA 2ATWA 3CW9A 3PESA 4ZLPA 4GS5A 2QVXX 5LMUC 4DUYC 4LF5C 4JI5C 4PROC 4LFCC 3VNRA 2PT7G 4L4QA 2DPLA 3EQ6A 4IR7A 4KTTA 1HNWC 5BR8C 1O92A 1MXAA 2E8FA 4B3MC 4JI6C 3EERA 2UXDC 3IEVA 2WD9A 2UUBC 4GKJC 1HNXC 4DV3C 4OX9C 4JV5C 2D27A 4NXMC 5T8SA 4YHHC 1JOSA 2UU9C 3ETOA 1QWIA 2VSQA 2P2FA 5AE1A 3JAMD 1FUGA 1WF3A 4G37A 4BSZA 4LF8C 1XNRC 4B3SC 5IT9D 5A1IA 2UXCC 4DR1C 5BSWA 5K8FA 4NXNC 3IEUA 1BA3A 2VZEA 1LQLA 2D28C 5A2QD 3E7WA 3LGXA 3GPCA 5BUSA 3PROC 1AMUA 3LUSA 1J5EC 1USPA 1O90A 1IBKC 3PBKA 1MXBA 2OBVA 3CJEA 4DR7C 4RVOA 2ZM6C 4GXRA 1EGAA 3LNVA 1XRCA 2DYJA 2E0GA 4U5YD 5K85A 2Y27A 1FJGC 1ML8A 2WP0C 5CZVA 3NYRA 2AYAA 2QVYX 2JMPA 3VNSA 2E8EA 2QL8A 1N32C 1XNQC 4RMNA 3L95X 4DR6C 1V25A 3DLPX 3RG2A 4IZ6A 4DCVA 4D56A 4FTFA 3A9VA 4DV0C 4LF4C 2QVZX 3KXWA 3FCCA 4DG9A 4DV1C 4OXIA 3T1YC 1K0RA 4D57A 4JM1A 4DV4C 3N54B 1L2FA 5ADZA 1ULTA 2BJOA 4RM2A 3CW8X 4LFAC 5H9UA 4RLQA 4DUZC 4LF7C 3H2TA 4LE5A 2YCBA 4DV6C 2P2QA 4X62C 4B3RC 5BSVA 1VLAA 4BC9A 1ZB9A 4K0BA 5BSRA 4ISBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA C;  1J5E C;  1USP A;  4JI4 C;  1PA4 A;  1IBK C;  4LF9 C;  4JI1 C;  3CJE A;  4DR7 C;  4MH4 A;  1N36 C;  2E5L C;  2ZM6 C;  2VQE C;  4LFB C;  2VQF C;  1EGA A;  2UUC C;  4YY3 C;  1KKG A;  2DYJ A;  4NOZ A;  1XMQ C;  1FJG C;  1ML8 A;  1XMO C;  3R9W A;  2EGT A;  4JI0 C;  4DCS A;  2CXC A;  3R9X A;  2OPL A;  1NYE A;  4X64 C;  1HH2 P;  1USP B;  4K0K C;  2E8C A;  2JMP A;  2HJG A;  2D7V A;  2E8E A;  2ATW A;  2QL8 A;  4XX2 A;  1N2F A;  4DR5 C;  4DR2 C;  4X65 C;  1HNZ C;  5LMU C;  4DV7 C;  1N32 C;  2KZF A;  2XR1 A;  1XNQ C;  4DUY C;  4LF5 C;  4DR6 C;  4JI5 C;  4GKK C;  4LFC C;  2PT7 G;  2UUA C;  1N33 C;  3AF6 A;  4DCU A;  5IWA C;  4MTN A;  2OPL B;  4DCV A;  3AF5 A;  1HNW C;  5BR8 C;  4DR3 C;  2E8F A;  2HHH C;  2E7G A;  4B3M C;  4JI8 C;  4JI6 C;  4DV0 C;  4LF4 C;  3EER A;  4JI2 C;  1MKY A;  2UXD C;  4DR4 C;  4AQY C;  3IEV A;  2UXB C;  2UUB C;  4GKJ C;  1HNX C;  1I94 C;  4DV3 C;  5FLX D;  4OX9 C;  3J80 D;  4DCT A;  4JV5 C;  1HR0 C;  4DV1 C;  2ASB A;  4NXM C;  3T1Y C;  1K0R A;  4YHH C;  1UKK A;  1JOS A;  2UU9 C;  4DV4 C;  1IBM C;  1ZB8 A;  4DV5 C;  1QWI A;  1L2F A;  3OTO C;  3JAM D;  2ONF A;  1WH9 A;  3J7A D;  2BJO A;  5LMN C;  4LFA C;  4B3T C;  3T1H C;  1WF3 A;  4BSZ A;  4LF8 C;  1N34 C;  1XNR C;  4B3S C;  4DUZ C;  2CY1 A;  4DV2 C;  5IT9 D;  3I07 A;  4LF7 C;  4JI7 C;  2UXC C;  2YCB A;  4DV6 C;  4DR1 C;  4KHP C;  4X62 C;  4NXN C;  4B3R C;  4JI3 C;  3IEU A;  1VLA A;  1ZB9 A;  3J81 D;  2F4V C;  1LQL A;  2PN2 A;  5A2Q D;  3GKU A;  4X66 C;  4LF6 C;  1IBL C;  3LUS A; 
#chains in the Genus database with same CATH topology
 4BBY A;  4L7I A;  3A4I A;  1PA4 A;  2D1R A;  3UOW A;  2P02 A;  2ZTB A;  2D1S A;  5DV9 A;  1XHJ A;  4NDN A;  2E5L C;  3B7W A;  2YWB A;  1M6X A;  1MDF A;  4RM3 A;  4YY3 C;  1KKG A;  1IB8 A;  3ETC A;  3IML A;  4NOZ A;  1XMQ C;  3C5E A;  2NCL A;  2BH1 X;  4JI0 C;  5BSM A;  1XRB A;  4DCS A;  2CXC A;  2OPL A;  1USP B;  5A1G A;  4GXQ A;  1N2F A;  4DR5 C;  3DHV A;  1MD9 A;  3UZ0 A;  2KZF A;  2XR1 A;  4G36 A;  3A26 A;  4G1I A;  1PG4 A;  2UUA C;  3R44 A;  4R0M A;  1N33 C;  1V60 A;  5CZX A;  5IWA C;  4MTN A;  5KYV A;  3AF5 A;  3DAY A;  1T5D X;  4BCA A;  3FM7 A;  4JI8 C;  2ZZN A;  4PHT A;  4JI2 C;  1MKY A;  1RG9 A;  1PU1 A;  4DR4 C;  2UXB C;  1PG3 A;  3LNO A;  4I9F A;  1MDB A;  3J80 D;  3N2Q A;  4DCT A;  4FUT A;  3S82 A;  1UKK A;  4D4I A;  1XDX A;  1IBM C;  1RY2 A;  4DV5 C;  4OYC A;  2QW0 X;  1LCI A;  2ONF A;  1WH9 A;  5T8T A;  3J7A D;  3I08 A;  4R1L A;  5LMN C;  4B3T C;  1N34 C;  4FUQ A;  2YWC A;  4DV2 C;  2Y4O A;  4I9G A;  4PUG A;  3UEB A;  4WS9 A;  1FLO A;  3G7S A;  5A19 A;  1O9T A;  3K6R A;  4TPS B;  3RV2 A;  3VNQ A;  3TDE A;  3NYQ A;  3GKU A;  5BUQ A;  4X66 C;  2M5H A;  3TR3 A;  4HPV A;  3GR0 A;  4WV3 A;  4JI4 C;  2YX1 A;  2DHM A;  1T5H X;  1N36 C;  2VQE C;  5E7Q A;  4RLF A;  4BC7 A;  3UX2 A;  2MM9 A;  3SO4 A;  1XMO C;  3R9W A;  3NPD A;  1HH2 P;  2HJG A;  1P7L A;  2OO4 A;  4L2Z A;  5BST A;  2D7V A;  1GPM A;  5BSU A;  4XX2 A;  3LAX A;  4D4G A;  4DR2 C;  4X65 C;  2P20 A;  1HNZ C;  4DV7 C;  5AE3 A;  4ODJ A;  2MMA B;  4GKK C;  5KEI A;  1YJ7 A;  5BUR A;  3AF6 A;  1M6X C;  4DCU A;  2OPL B;  1QM4 A;  2P2B A;  1V26 A;  4DR3 C;  2ZZM A;  4RVN A;  3O2E A;  2HHH C;  2E7G A;  3TQI A;  2PRO A;  3L8C A;  4AQY C;  1MXC A;  1P4E A;  1I94 C;  5FLX D;  3GR1 A;  1HR0 C;  2ASB A;  3A25 A;  4DG8 A;  3CQ3 A;  1ZB8 A;  3NI2 A;  3OTO C;  4EAT A;  5IFI A;  4KTV A;  3T1H C;  2CY1 A;  3I07 A;  4JI7 C;  4KHP C;  1XRA A;  2D1T A;  3IPL A;  2Z51 A;  4JI3 C;  1O93 A;  3J81 D;  2F4V C;  5AE2 A;  2PN2 A;  2D1Q A;  5JRH A;  2P2M A;  4LF6 C;  5GTD A;  1IBL C;  4PZP A;  2V7B A;  4JYA C;  3FCE A;  3TUF A;  4LF9 C;  4JI1 C;  4MH4 A;  2M5O A;  2Y4N A;  5KYT A;  4LFB C;  2VQF C;  2UUC C;  3A9U A;  2P2J A;  2EGT A;  4R1M A;  3R9X A;  1NYE A;  3E7X A;  4X64 C;  4K0K C;  4ZJZ A;  2E8C A;  2ATW A;  3CW9 A;  3PES A;  4ZLP A;  1TH5 A;  4GS5 A;  2QVX X;  5LMU C;  4DUY C;  4LF5 C;  4JI5 C;  4PRO C;  4LFC C;  3VNR A;  1VEH A;  2PT7 G;  4L4Q A;  2DPL A;  3EQ6 A;  4IR7 A;  4KTT A;  1HNW C;  2MCQ A;  3CQ1 A;  5BR8 C;  1O92 A;  1MXA A;  2E8F A;  4B3M C;  4JI6 C;  2KDN A;  3EER A;  2UXD C;  3IEV A;  4PUH A;  2WD9 A;  2UUB C;  4PUI A;  4GKJ C;  1HNX C;  4DV3 C;  4OX9 C;  4JV5 C;  2D27 A;  2CU6 A;  4NXM C;  5T8S A;  4YHH C;  1UWD A;  1JOS A;  2UU9 C;  3ETO A;  1QWI A;  2VSQ A;  2P2F A;  5AE1 A;  3JAM D;  1FUG A;  1WF3 A;  4G37 A;  4BSZ A;  4LF8 C;  1XNR C;  4B3S C;  5IT9 D;  5A1I A;  2UXC C;  4DR1 C;  5BSW A;  5K8F A;  4NXN C;  3IEU A;  1BA3 A;  1P4E C;  2VZE A;  1LQL A;  2D28 C;  5A2Q D;  3E7W A;  3LGX A;  3GPC A;  5BUS A;  3PRO C;  1AMU A;  3LUS A;  1J5E C;  1USP A;  3AY0 A;  1O90 A;  1IBK C;  3PBK A;  1MXB A;  2OBV A;  3CJE A;  4DR7 C;  4RVO A;  2ZM6 C;  4GXR A;  1EGA A;  3LNV A;  1XRC A;  2DYJ A;  2PG1 E;  5LCI A;  3CQ2 A;  2E0G A;  4U5Y D;  5K85 A;  2Y27 A;  1FJG C;  1ML8 A;  2WP0 C;  5CZV A;  3NYR A;  1WCJ A;  2AYA A;  2QVY X;  2JMP A;  3VNS A;  2E8E A;  2QL8 A;  1N32 C;  1XNQ C;  4RMN A;  3L95 X;  4DR6 C;  1V25 A;  3DLP X;  3RG2 A;  4IZ6 A;  1XS3 A;  4DCV A;  4D56 A;  4FTF A;  1NY8 A;  3A9V A;  4DV0 C;  4LF4 C;  2QVZ X;  3KXW A;  3FCC A;  1YGT A;  4DG9 A;  4DV1 C;  4OXI A;  3T1Y C;  1K0R A;  4D57 A;  4JM1 A;  4DV4 C;  3N54 B;  3UX3 A;  1L2F A;  5ADZ A;  2JNV A;  1ULT A;  2BJO A;  4RM2 A;  3CW8 X;  4LFA C;  5H9U A;  4RLQ A;  4DUZ C;  4LF7 C;  3H2T A;  4LE5 A;  2YCB A;  4DV6 C;  2KZ0 A;  2P2Q A;  4X62 C;  4B3R C;  5BSV A;  1VLA A;  4BC9 A;  1ZB9 A;  4K0B A;  5BSR A;  4ISB A; 
#chains in the Genus database with same CATH homology
 4BBY A;  4L7I A;  3A4I A;  1PA4 A;  2D1R A;  3UOW A;  2P02 A;  2D1S A;  5DV9 A;  4NDN A;  2E5L C;  3B7W A;  2YWB A;  1MDF A;  4RM3 A;  4YY3 C;  1KKG A;  3ETC A;  3IML A;  4NOZ A;  1XMQ C;  3C5E A;  2BH1 X;  4JI0 C;  5BSM A;  1XRB A;  4DCS A;  2CXC A;  2OPL A;  1USP B;  5A1G A;  4GXQ A;  1N2F A;  4DR5 C;  3DHV A;  1MD9 A;  3UZ0 A;  2KZF A;  2XR1 A;  4G36 A;  4G1I A;  1PG4 A;  2UUA C;  3R44 A;  4R0M A;  1N33 C;  5CZX A;  5IWA C;  4MTN A;  5KYV A;  3AF5 A;  3DAY A;  1T5D X;  4BCA A;  4JI8 C;  4PHT A;  4JI2 C;  1MKY A;  1RG9 A;  4DR4 C;  2UXB C;  1PG3 A;  4I9F A;  1MDB A;  3J80 D;  3N2Q A;  4DCT A;  4FUT A;  3S82 A;  1UKK A;  4D4I A;  1IBM C;  1RY2 A;  4DV5 C;  4OYC A;  2QW0 X;  1LCI A;  2ONF A;  1WH9 A;  5T8T A;  3J7A D;  3I08 A;  4R1L A;  5LMN C;  4B3T C;  1N34 C;  4FUQ A;  2YWC A;  4DV2 C;  2Y4O A;  4I9G A;  4WS9 A;  3G7S A;  5A19 A;  1O9T A;  4TPS B;  3RV2 A;  3VNQ A;  3TDE A;  3NYQ A;  3GKU A;  5BUQ A;  4X66 C;  4HPV A;  3GR0 A;  4WV3 A;  4JI4 C;  1T5H X;  1N36 C;  2VQE C;  5E7Q A;  4RLF A;  4BC7 A;  3SO4 A;  1XMO C;  3R9W A;  3NPD A;  1HH2 P;  2HJG A;  1P7L A;  2OO4 A;  4L2Z A;  5BST A;  2D7V A;  1GPM A;  5BSU A;  4XX2 A;  3LAX A;  4D4G A;  4DR2 C;  4X65 C;  2P20 A;  1HNZ C;  4DV7 C;  5AE3 A;  4ODJ A;  4GKK C;  5KEI A;  1YJ7 A;  5BUR A;  3AF6 A;  4DCU A;  2OPL B;  1QM4 A;  2P2B A;  1V26 A;  4DR3 C;  4RVN A;  2HHH C;  2E7G A;  3TQI A;  2PRO A;  3L8C A;  4AQY C;  1MXC A;  1I94 C;  5FLX D;  3GR1 A;  1HR0 C;  2ASB A;  4DG8 A;  1ZB8 A;  3NI2 A;  3OTO C;  4EAT A;  5IFI A;  4KTV A;  3T1H C;  2CY1 A;  3I07 A;  4JI7 C;  4KHP C;  1XRA A;  2D1T A;  3IPL A;  4JI3 C;  1O93 A;  3J81 D;  2F4V C;  5AE2 A;  2PN2 A;  2D1Q A;  5JRH A;  2P2M A;  4LF6 C;  5GTD A;  1IBL C;  4PZP A;  2V7B A;  4JYA C;  3FCE A;  3TUF A;  4LF9 C;  4JI1 C;  4MH4 A;  2Y4N A;  5KYT A;  4LFB C;  2VQF C;  2UUC C;  3A9U A;  2P2J A;  2EGT A;  4R1M A;  3R9X A;  1NYE A;  3E7X A;  4X64 C;  4K0K C;  4ZJZ A;  2E8C A;  2ATW A;  3CW9 A;  3PES A;  4ZLP A;  4GS5 A;  2QVX X;  5LMU C;  4DUY C;  4LF5 C;  4JI5 C;  4PRO C;  4LFC C;  3VNR A;  2PT7 G;  4L4Q A;  2DPL A;  3EQ6 A;  4IR7 A;  4KTT A;  1HNW C;  5BR8 C;  1O92 A;  1MXA A;  2E8F A;  4B3M C;  4JI6 C;  3EER A;  2UXD C;  3IEV A;  2WD9 A;  2UUB C;  4GKJ C;  1HNX C;  4DV3 C;  4OX9 C;  4JV5 C;  2D27 A;  4NXM C;  5T8S A;  4YHH C;  1JOS A;  2UU9 C;  3ETO A;  1QWI A;  2VSQ A;  2P2F A;  5AE1 A;  3JAM D;  1FUG A;  1WF3 A;  4G37 A;  4BSZ A;  4LF8 C;  1XNR C;  4B3S C;  5IT9 D;  5A1I A;  2UXC C;  4DR1 C;  5BSW A;  5K8F A;  4NXN C;  3IEU A;  1BA3 A;  2VZE A;  1LQL A;  2D28 C;  5A2Q D;  3E7W A;  3LGX A;  3GPC A;  5BUS A;  3PRO C;  1AMU A;  3LUS A;  1J5E C;  1USP A;  1O90 A;  1IBK C;  3PBK A;  1MXB A;  2OBV A;  3CJE A;  4DR7 C;  4RVO A;  2ZM6 C;  4GXR A;  1EGA A;  3LNV A;  1XRC A;  2DYJ A;  2E0G A;  4U5Y D;  5K85 A;  2Y27 A;  1FJG C;  1ML8 A;  2WP0 C;  5CZV A;  3NYR A;  2AYA A;  2QVY X;  2JMP A;  3VNS A;  2E8E A;  2QL8 A;  1N32 C;  1XNQ C;  4RMN A;  3L95 X;  4DR6 C;  1V25 A;  3DLP X;  3RG2 A;  4IZ6 A;  4DCV A;  4D56 A;  4FTF A;  3A9V A;  4DV0 C;  4LF4 C;  2QVZ X;  3KXW A;  3FCC A;  4DG9 A;  4DV1 C;  4OXI A;  3T1Y C;  1K0R A;  4D57 A;  4JM1 A;  4DV4 C;  3N54 B;  1L2F A;  5ADZ A;  1ULT A;  2BJO A;  4RM2 A;  3CW8 X;  4LFA C;  5H9U A;  4RLQ A;  4DUZ C;  4LF7 C;  3H2T A;  4LE5 A;  2YCB A;  4DV6 C;  2P2Q A;  4X62 C;  4B3R C;  5BSV A;  1VLA A;  4BC9 A;  1ZB9 A;  4K0B A;  5BSR A;  4ISB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...