4JI5C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 55
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji5C02
1ML8A 1IBLC 4DR4C 5LMNC 2E8FA 1L2FA 4XX2A 4LF6C 2BJOA 5IWAC 4DV6C 4DV1C 3R9XA 1ZB8A 5LMUC 4B3MC 4LF9C 4DUYC 1UKKA 4JI6C 2VQEC 4DR5C 4LFAC 3AF5A 4JI1C 4MH4A 3IEUA 4NOZA 1EGAA 4LF5C 1N33C 4GKKC 4DV7C 2ONFA 2UXBC 4NXMC 4DCUA 2ASBA 1FJGC 4X66C 4JI0C 3J80D 4JYAC 4LF7C 2ZM6C 4JI5C 4DV4C 1XMOC 3R9WA 4B3SC 3IEVA 4KHPC 1WF3A 3T1HC 1LQLA 1N34C 2UUCC 3CJEA 2UXCC 1IBKC 1QWIA 3T1YC 1JOSA 3J7AD 3J81D 1VLAA 1J5EC 4DV2C 4DR7C 4B3RC 1XNQC 4AQYC 1HR0C 2CY1A 2KZFA 4DUZC 1ZB9A 4JI3C 1HNXC 1K0RA 4LF4C 4DV0C 4DR6C 2HJGA 1MKYA 4X64C 2EGTA 1NYEA 3EERA 4LFCC 2VQFC 2E8CA 1HH2P 4BSZA 4DCSA 4B3TC 1N32C 1HNWC 4GKJC 4JV5C 2F4VC 2UU9C 4JI8C 1I94C 2HHHC 2E8EA 2JMPA 3LUSA 1KKGA 4MTNA 1IBMC 1N36C 3GKUA 2E7GA 4LFBC 4DR1C 1USPA 4DR2C 4DCTA 5IT9D 3AF6A 2OPLA 4YHHC 2ATWA 2OPLB 2UXDC 3I07A 4JI4C 2PN2A 4NXNC 3JAMD 2D7VA 2PT7G 2UUBC 2E5LC 4X62C 5A2QD 1XMQC 2YCBA 4YY3C 5BR8C 4DR3C 2UUAC 2CXCA 1XNRC 4JI2C 4LF8C 1N2FA 1WH9A 5FLXD 4DCVA 3OTOC 4OX9C 4X65C 2QL8A 2DYJA 4DV5C 1HNZC 4JI7C 4DV3C 1PA4A 1USPB 4K0KC 2XR1A
chains in the Genus database with same CATH superfamily
4D4GA 2E8FA 4LF6C 2D1TA 2Y4NA 3KXWA 1MD9A 4BC9A 3CW8X 4B3MC 2OBVA 4JI6C 5A19A 4FTFA 4DR5C 3AF5A 4ISBA 3I08A 4MH4A 4IR7A 1EGAA 2PROA 1N33C 4GKKC 1XHJA 1XS3A 4D57A 4JI0C 4RMNA 3GPCA 2ZM6C 1XMOC 2AYAA 4DG9A 1FUGA 2MCQA 3R9WA 4OYCA 3PBKA 3DLPX 2JNVA 2UXCC 1QWIA 1XDXA 1JOSA 3DAYA 1J5EC 4RLFA 4D56A 2M5OA 5JRHA 1XNQC 4I9FA 3LGXA 3UX3A 4DUZC 1ZB9A 2BH1X 4ODJA 4R0MA 2EGTA 5BURA 3EERA 2VQFC 2E8CA 3AY0A 3C5EA 2UU9C 1KKGA 4RM3A 2DHMA 3IMLA 5DV9A 4PUHA 4DCTA 3TR3A 1T5HX 4YHHC 2QVZX 3NI2A 2PN2A 3NYRA 4ZJZA 1QM4A 1RY2A 2D1RA 2D1SA 1PU1A 5BR8C 2CXCA 1GPMA 4R1MA 1O92A 1N2FA 4DCVA 4OX9C 2QL8A 4ZLPA 1USPB 5CZVA 2D28C 4OXIA 1T5DX 3FCCA 5T8TA 1IBLC 1VEHA 1L2FA 5IWAC 4DV6C 4DV1C 4PHTA 4PUIA 5LMUC 4LF9C 3ETOA 1UKKA 1O93A 1UWDA 2P2BA 2VQEC 3CQ2A 5BUSA 2QVXX 1ULTA 3A25A 4PROC 2ASBA 1FJGC 1PG3A 5CZXA 4LF7C 4DG8A 4JI5C 3CQ3A 4DV4C 4NDNA 2Y4OA 5BSMA 1WF3A 3T1HC 1N34C 2UUCC 2WP0C 1IBKC 3LNVA 3T1YC 5KYTA 5AE2A 4DR7C 4B3RC 4AQYC 1HR0C 4BC7A 3NPDA 2YWBA 3PROC 1XRCA 4JI3C 1K0RA 2CU6A 1HNXC 4LF4C 2HJGA 1MKYA 1NYEA 5AE3A 1HH2P 1P7LA 4BSZA 5T8SA 4GKJC 2KZ0A 4JI8C 3A9VA 2E8EA 2HHHC 1MXBA 3H2TA 3R44A 4RLQA 5IT9D 3E7WA 3A26A 3DHVA 2YWCA 2OO4A 1V25A 4NXNC 1O9TA 1MDBA 4G1IA 4PUGA 4K0BA 2D7VA 5BSUA 4X62C 5A2QD 5BSWA 5A1IA 3L8CA 1XNRC 2MMAB 4JI2C 2P2FA 4LF8C 3OTOC 4X65C 2VZEA 4L4QA 5BSVA 1HNZC 4JI7C 1P4EA 3CW9A 3E7XA 1ML8A 4G36A 3SO4A 4XX2A 2M5HA 2BJOA 2VSQA 3R9XA 1RG9A 1M6XA 2D27A 3B7WA 1O90A 2V7BA 3IEUA 5K8FA 4DV7C 2UXBC 1BA3A 4KTTA 4JM1A 5BSRA 4JYAC 3RV2A 5IFIA 2ZTBA 4B3SC 4KHPC 1LQLA 4BCAA 5ADZA 3J7AD 4DV2C 2CY1A 3LNOA 2KDNA 2WD9A 4RVNA 2QVYX 1V60A 4X64C 3PESA 1WCJA 2P02A 1MXCA 3VNSA 4LFCC 4DCSA 2F4VC 2PG1E 1I94C 1MXAA 3LUSA 3VNQA 3GR1A 1IBMC 1N36C 2E7GA 4LFBC 4KTVA 4DR1C 3O2EA 4FUTA 3UZ0A 4DR2C 2OPLA 5GTDA 2OPLB 4BBYA 1YGTA 4LE5A 5LCIA 3TQIA 4R1LA 3EQ6A 4L2ZA 2E5LC 2NCLA 4YY3C 4DR3C 1FLOA 1XRAA 2Y27A 1P4EC 5FLXD 3RG2A 2DYJA 1PG4A 4DV5C 3GR0A 4DV3C 1PA4A 4K0KC 4WV3A 2XR1A 1AMUA 4DR4C 5LMNC 1M6XC 5AE1A 3N2QA 3FCEA 1ZB8A 1XRBA 1YJ7A 3K6RA 4G37A 1LCIA 4DUYC 4WS9A 2ZZMA 2QW0X 4HPVA 3NYQA 4LFAC 4JI1C 4L7IA 4U5YD 3IPLA 4NOZA 4LF5C 2ONFA 4NXMC 4DCUA 2D1QA 4X66C 2P2MA 3J80D 3LAXA 4PZPA 4GS5A 3A9UA 3IEVA 3CJEA 4RVOA 5KYVA 3J81D 1VLAA 2P2JA 5A1GA 2KZFA 3S82A 3UEBA 2E0GA 2P2QA 4DV0C 4DR6C 1TH5A 4EATA 5K85A 5BSTA 4B3TC 1N32C 1HNWC 4JV5C 2JMPA 4MTNA 4IZ6A 3A4IA 3G7SA 1MDFA 1V26A 3GKUA 5H9UA 3FM7A 4FUQA 3UX2A 1USPA 3CQ1A 3AF6A 2ATWA 2DPLA 4TPSB 2P20A 4GXQA 2UXDC 2YX1A 2ZZNA 3I07A 4JI4C 3UOWA 3JAMD 1NY8A 2PT7G 2UUBC 4GXRA 1IB8A 1XMQC 2YCBA 4D4IA 5KEIA 2UUAC 3VNRA 1WH9A 2MM9A 3TDEA 5BUQA 5E7QA 4I9GA 3ETCA 3TUFA 3N54B 3L95X 4RM2A 2Z51A
chains in the Genus database with same CATH topology
4D4GA 2E8FA 4LF6C 2D1TA 2Y4NA 3KXWA 1MD9A 4BC9A 3CW8X 4B3MC 2OBVA 4JI6C 5A19A 4FTFA 4DR5C 3AF5A 4ISBA 3I08A 4MH4A 4IR7A 1EGAA 2PROA 1N33C 4GKKC 4D57A 4JI0C 4RMNA 3GPCA 2ZM6C 1XMOC 2AYAA 4DG9A 1FUGA 3R9WA 4OYCA 3PBKA 3DLPX 2UXCC 1QWIA 1JOSA 3DAYA 1J5EC 4RLFA 4D56A 5JRHA 1XNQC 4I9FA 3LGXA 4DUZC 1ZB9A 2BH1X 4ODJA 4R0MA 2EGTA 5BURA 3EERA 2VQFC 2E8CA 3C5EA 2UU9C 1KKGA 4RM3A 3IMLA 5DV9A 4DCTA 1T5HX 4YHHC 2QVZX 3NI2A 2PN2A 3NYRA 4ZJZA 1QM4A 1RY2A 2D1RA 2D1SA 5BR8C 2CXCA 1GPMA 4R1MA 1O92A 1N2FA 4DCVA 4OX9C 2QL8A 4ZLPA 1USPB 5CZVA 2D28C 4OXIA 1T5DX 3FCCA 5T8TA 1IBLC 1L2FA 5IWAC 4DV6C 4DV1C 4PHTA 5LMUC 4LF9C 3ETOA 1UKKA 1O93A 2P2BA 2VQEC 5BUSA 2QVXX 1ULTA 4PROC 2ASBA 1FJGC 1PG3A 5CZXA 4LF7C 4DG8A 4JI5C 4DV4C 4NDNA 2Y4OA 5BSMA 1WF3A 3T1HC 1N34C 2UUCC 2WP0C 1IBKC 3LNVA 3T1YC 5KYTA 5AE2A 4DR7C 4B3RC 4AQYC 1HR0C 4BC7A 3NPDA 2YWBA 3PROC 1XRCA 4JI3C 1K0RA 1HNXC 4LF4C 2HJGA 1MKYA 1NYEA 5AE3A 1HH2P 1P7LA 4BSZA 5T8SA 4GKJC 4JI8C 3A9VA 2E8EA 2HHHC 1MXBA 3H2TA 3R44A 4RLQA 5IT9D 3E7WA 3DHVA 2YWCA 2OO4A 1V25A 4NXNC 1O9TA 1MDBA 4G1IA 4K0BA 2D7VA 5BSUA 4X62C 5A2QD 5BSWA 5A1IA 3L8CA 1XNRC 4JI2C 2P2FA 4LF8C 3OTOC 4X65C 2VZEA 4L4QA 5BSVA 1HNZC 4JI7C 3CW9A 3E7XA 1ML8A 4G36A 3SO4A 4XX2A 2BJOA 2VSQA 3R9XA 1RG9A 2D27A 3B7WA 1O90A 2V7BA 3IEUA 5K8FA 4DV7C 2UXBC 1BA3A 4KTTA 4JM1A 5BSRA 4JYAC 3RV2A 5IFIA 4B3SC 4KHPC 1LQLA 4BCAA 5ADZA 3J7AD 4DV2C 2CY1A 2WD9A 4RVNA 2QVYX 4X64C 3PESA 2P02A 1MXCA 3VNSA 4LFCC 4DCSA 2F4VC 1I94C 1MXAA 3LUSA 3VNQA 3GR1A 1IBMC 1N36C 2E7GA 4LFBC 4KTVA 4DR1C 4FUTA 4DR2C 3UZ0A 2OPLA 5GTDA 2OPLB 4BBYA 4LE5A 3TQIA 4R1LA 3EQ6A 4L2ZA 2E5LC 4YY3C 4DR3C 1XRAA 2Y27A 5FLXD 3RG2A 4DV5C 2DYJA 1PG4A 3GR0A 4DV3C 1PA4A 4K0KC 4WV3A 2XR1A 1AMUA 4DR4C 5LMNC 5AE1A 3N2QA 3FCEA 1ZB8A 1XRBA 1YJ7A 4G37A 1LCIA 4DUYC 4WS9A 2QW0X 4HPVA 3NYQA 4LFAC 4JI1C 4L7IA 4U5YD 3IPLA 4NOZA 4LF5C 2ONFA 4NXMC 4DCUA 2D1QA 4X66C 2P2MA 3J80D 3LAXA 4PZPA 4GS5A 3A9UA 3IEVA 3CJEA 4RVOA 5KYVA 3J81D 1VLAA 2P2JA 5A1GA 2KZFA 3S82A 2E0GA 2P2QA 4DV0C 4DR6C 4EATA 5K85A 5BSTA 4B3TC 1N32C 1HNWC 4JV5C 2JMPA 4MTNA 4IZ6A 3A4IA 3G7SA 1MDFA 1V26A 3GKUA 5H9UA 4FUQA 1USPA 3AF6A 2ATWA 2DPLA 4TPSB 2P20A 4GXQA 2UXDC 3I07A 4JI4C 3UOWA 3JAMD 2PT7G 2UUBC 4GXRA 1XMQC 2YCBA 4D4IA 5KEIA 2UUAC 3VNRA 1WH9A 3TDEA 5BUQA 5E7QA 4I9GA 3ETCA 3TUFA 3N54B 3L95X 4RM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML8 A;  1IBL C;  4DR4 C;  5LMN C;  2E8F A;  1L2F A;  4XX2 A;  4LF6 C;  2BJO A;  5IWA C;  4DV6 C;  4DV1 C;  3R9X A;  1ZB8 A;  5LMU C;  4B3M C;  4LF9 C;  4DUY C;  1UKK A;  4JI6 C;  2VQE C;  4DR5 C;  4LFA C;  3AF5 A;  4JI1 C;  4MH4 A;  3IEU A;  4NOZ A;  1EGA A;  4LF5 C;  1N33 C;  4GKK C;  4DV7 C;  2ONF A;  2UXB C;  4NXM C;  4DCU A;  2ASB A;  1FJG C;  4X66 C;  4JI0 C;  3J80 D;  4JYA C;  4LF7 C;  2ZM6 C;  4JI5 C;  4DV4 C;  1XMO C;  3R9W A;  4B3S C;  3IEV A;  4KHP C;  1WF3 A;  3T1H C;  1LQL A;  1N34 C;  2UUC C;  3CJE A;  2UXC C;  1IBK C;  1QWI A;  3T1Y C;  1JOS A;  3J7A D;  3J81 D;  1VLA A;  1J5E C;  4DV2 C;  4DR7 C;  4B3R C;  1XNQ C;  4AQY C;  1HR0 C;  2CY1 A;  2KZF A;  4DUZ C;  1ZB9 A;  4JI3 C;  1HNX C;  1K0R A;  4LF4 C;  4DV0 C;  4DR6 C;  2HJG A;  1MKY A;  4X64 C;  2EGT A;  1NYE A;  3EER A;  4LFC C;  2VQF C;  2E8C A;  1HH2 P;  4BSZ A;  4DCS A;  4B3T C;  1N32 C;  1HNW C;  4GKJ C;  4JV5 C;  2F4V C;  2UU9 C;  4JI8 C;  1I94 C;  2HHH C;  2E8E A;  2JMP A;  3LUS A;  1KKG A;  4MTN A;  1IBM C;  1N36 C;  3GKU A;  2E7G A;  4LFB C;  4DR1 C;  1USP A;  4DR2 C;  4DCT A;  5IT9 D;  3AF6 A;  2OPL A;  4YHH C;  2ATW A;  2OPL B;  2UXD C;  3I07 A;  4JI4 C;  2PN2 A;  4NXN C;  3JAM D;  2D7V A;  2PT7 G;  2UUB C;  2E5L C;  4X62 C;  5A2Q D;  1XMQ C;  2YCB A;  4YY3 C;  5BR8 C;  4DR3 C;  2UUA C;  2CXC A;  1XNR C;  4JI2 C;  4LF8 C;  1N2F A;  1WH9 A;  5FLX D;  4DCV A;  3OTO C;  4OX9 C;  4X65 C;  2QL8 A;  2DYJ A;  4DV5 C;  1HNZ C;  4JI7 C;  4DV3 C;  1PA4 A;  1USP B;  4K0K C;  2XR1 A; 
#chains in the Genus database with same CATH topology
 4D4G A;  2E8F A;  4LF6 C;  2D1T A;  2Y4N A;  3KXW A;  1MD9 A;  4BC9 A;  3CW8 X;  4B3M C;  2OBV A;  4JI6 C;  5A19 A;  4FTF A;  4DR5 C;  3AF5 A;  4ISB A;  3I08 A;  4MH4 A;  4IR7 A;  1EGA A;  2PRO A;  1N33 C;  4GKK C;  1XHJ A;  1XS3 A;  4D57 A;  4JI0 C;  4RMN A;  3GPC A;  2ZM6 C;  1XMO C;  2AYA A;  4DG9 A;  1FUG A;  2MCQ A;  3R9W A;  4OYC A;  3PBK A;  3DLP X;  2JNV A;  2UXC C;  1QWI A;  1XDX A;  1JOS A;  3DAY A;  1J5E C;  4RLF A;  4D56 A;  2M5O A;  5JRH A;  1XNQ C;  4I9F A;  3LGX A;  3UX3 A;  4DUZ C;  1ZB9 A;  2BH1 X;  4ODJ A;  4R0M A;  2EGT A;  5BUR A;  3EER A;  2VQF C;  2E8C A;  3AY0 A;  3C5E A;  2UU9 C;  1KKG A;  4RM3 A;  2DHM A;  3IML A;  5DV9 A;  4PUH A;  4DCT A;  3TR3 A;  1T5H X;  4YHH C;  2QVZ X;  3NI2 A;  2PN2 A;  3NYR A;  4ZJZ A;  1QM4 A;  1RY2 A;  2D1R A;  2D1S A;  1PU1 A;  5BR8 C;  2CXC A;  1GPM A;  4R1M A;  1O92 A;  1N2F A;  4DCV A;  4OX9 C;  2QL8 A;  4ZLP A;  1USP B;  5CZV A;  2D28 C;  4OXI A;  1T5D X;  3FCC A;  5T8T A;  1IBL C;  1VEH A;  1L2F A;  5IWA C;  4DV6 C;  4DV1 C;  4PHT A;  4PUI A;  5LMU C;  4LF9 C;  3ETO A;  1UKK A;  1O93 A;  1UWD A;  2P2B A;  2VQE C;  3CQ2 A;  5BUS A;  2QVX X;  1ULT A;  3A25 A;  4PRO C;  2ASB A;  1FJG C;  1PG3 A;  5CZX A;  4LF7 C;  4DG8 A;  4JI5 C;  3CQ3 A;  4DV4 C;  4NDN A;  2Y4O A;  5BSM A;  1WF3 A;  3T1H C;  1N34 C;  2UUC C;  2WP0 C;  1IBK C;  3LNV A;  3T1Y C;  5KYT A;  5AE2 A;  4DR7 C;  4B3R C;  4AQY C;  1HR0 C;  4BC7 A;  3NPD A;  2YWB A;  3PRO C;  1XRC A;  4JI3 C;  1K0R A;  2CU6 A;  1HNX C;  4LF4 C;  2HJG A;  1MKY A;  1NYE A;  5AE3 A;  1HH2 P;  1P7L A;  4BSZ A;  5T8S A;  4GKJ C;  2KZ0 A;  4JI8 C;  3A9V A;  2E8E A;  2HHH C;  1MXB A;  3H2T A;  3R44 A;  4RLQ A;  5IT9 D;  3E7W A;  3A26 A;  3DHV A;  2YWC A;  2OO4 A;  1V25 A;  4NXN C;  1O9T A;  1MDB A;  4G1I A;  4PUG A;  4K0B A;  2D7V A;  5BSU A;  4X62 C;  5A2Q D;  5BSW A;  5A1I A;  3L8C A;  1XNR C;  2MMA B;  4JI2 C;  2P2F A;  4LF8 C;  3OTO C;  4X65 C;  2VZE A;  4L4Q A;  5BSV A;  1HNZ C;  4JI7 C;  1P4E A;  3CW9 A;  3E7X A;  1ML8 A;  4G36 A;  3SO4 A;  4XX2 A;  2M5H A;  2BJO A;  2VSQ A;  3R9X A;  1RG9 A;  1M6X A;  2D27 A;  3B7W A;  1O90 A;  2V7B A;  3IEU A;  5K8F A;  4DV7 C;  2UXB C;  1BA3 A;  4KTT A;  4JM1 A;  5BSR A;  4JYA C;  3RV2 A;  5IFI A;  2ZTB A;  4B3S C;  4KHP C;  1LQL A;  4BCA A;  5ADZ A;  3J7A D;  4DV2 C;  2CY1 A;  3LNO A;  2KDN A;  2WD9 A;  4RVN A;  2QVY X;  1V60 A;  4X64 C;  3PES A;  1WCJ A;  2P02 A;  1MXC A;  3VNS A;  4LFC C;  4DCS A;  2F4V C;  2PG1 E;  1I94 C;  1MXA A;  3LUS A;  3VNQ A;  3GR1 A;  1IBM C;  1N36 C;  2E7G A;  4LFB C;  4KTV A;  4DR1 C;  3O2E A;  4FUT A;  3UZ0 A;  4DR2 C;  2OPL A;  5GTD A;  2OPL B;  4BBY A;  1YGT A;  4LE5 A;  5LCI A;  3TQI A;  4R1L A;  3EQ6 A;  4L2Z A;  2E5L C;  2NCL A;  4YY3 C;  4DR3 C;  1FLO A;  1XRA A;  2Y27 A;  1P4E C;  5FLX D;  3RG2 A;  2DYJ A;  1PG4 A;  4DV5 C;  3GR0 A;  4DV3 C;  1PA4 A;  4K0K C;  4WV3 A;  2XR1 A;  1AMU A;  4DR4 C;  5LMN C;  1M6X C;  5AE1 A;  3N2Q A;  3FCE A;  1ZB8 A;  1XRB A;  1YJ7 A;  3K6R A;  4G37 A;  1LCI A;  4DUY C;  4WS9 A;  2ZZM A;  2QW0 X;  4HPV A;  3NYQ A;  4LFA C;  4JI1 C;  4L7I A;  4U5Y D;  3IPL A;  4NOZ A;  4LF5 C;  2ONF A;  4NXM C;  4DCU A;  2D1Q A;  4X66 C;  2P2M A;  3J80 D;  3LAX A;  4PZP A;  4GS5 A;  3A9U A;  3IEV A;  3CJE A;  4RVO A;  5KYV A;  3J81 D;  1VLA A;  2P2J A;  5A1G A;  2KZF A;  3S82 A;  3UEB A;  2E0G A;  2P2Q A;  4DV0 C;  4DR6 C;  1TH5 A;  4EAT A;  5K85 A;  5BST A;  4B3T C;  1N32 C;  1HNW C;  4JV5 C;  2JMP A;  4MTN A;  4IZ6 A;  3A4I A;  3G7S A;  1MDF A;  1V26 A;  3GKU A;  5H9U A;  3FM7 A;  4FUQ A;  3UX2 A;  1USP A;  3CQ1 A;  3AF6 A;  2ATW A;  2DPL A;  4TPS B;  2P20 A;  4GXQ A;  2UXD C;  2YX1 A;  2ZZN A;  3I07 A;  4JI4 C;  3UOW A;  3JAM D;  1NY8 A;  2PT7 G;  2UUB C;  4GXR A;  1IB8 A;  1XMQ C;  2YCB A;  4D4I A;  5KEI A;  2UUA C;  3VNR A;  1WH9 A;  2MM9 A;  3TDE A;  5BUQ A;  5E7Q A;  4I9G A;  3ETC A;  3TUF A;  3N54 B;  3L95 X;  4RM2 A;  2Z51 A; 
#chains in the Genus database with same CATH homology
 4D4G A;  2E8F A;  4LF6 C;  2D1T A;  2Y4N A;  3KXW A;  1MD9 A;  4BC9 A;  3CW8 X;  4B3M C;  2OBV A;  4JI6 C;  5A19 A;  4FTF A;  4DR5 C;  3AF5 A;  4ISB A;  3I08 A;  4MH4 A;  4IR7 A;  1EGA A;  2PRO A;  1N33 C;  4GKK C;  4D57 A;  4JI0 C;  4RMN A;  3GPC A;  2ZM6 C;  1XMO C;  2AYA A;  4DG9 A;  1FUG A;  3R9W A;  4OYC A;  3PBK A;  3DLP X;  2UXC C;  1QWI A;  1JOS A;  3DAY A;  1J5E C;  4RLF A;  4D56 A;  5JRH A;  1XNQ C;  4I9F A;  3LGX A;  4DUZ C;  1ZB9 A;  2BH1 X;  4ODJ A;  4R0M A;  2EGT A;  5BUR A;  3EER A;  2VQF C;  2E8C A;  3C5E A;  2UU9 C;  1KKG A;  4RM3 A;  3IML A;  5DV9 A;  4DCT A;  1T5H X;  4YHH C;  2QVZ X;  3NI2 A;  2PN2 A;  3NYR A;  4ZJZ A;  1QM4 A;  1RY2 A;  2D1R A;  2D1S A;  5BR8 C;  2CXC A;  1GPM A;  4R1M A;  1O92 A;  1N2F A;  4DCV A;  4OX9 C;  2QL8 A;  4ZLP A;  1USP B;  5CZV A;  2D28 C;  4OXI A;  1T5D X;  3FCC A;  5T8T A;  1IBL C;  1L2F A;  5IWA C;  4DV6 C;  4DV1 C;  4PHT A;  5LMU C;  4LF9 C;  3ETO A;  1UKK A;  1O93 A;  2P2B A;  2VQE C;  5BUS A;  2QVX X;  1ULT A;  4PRO C;  2ASB A;  1FJG C;  1PG3 A;  5CZX A;  4LF7 C;  4DG8 A;  4JI5 C;  4DV4 C;  4NDN A;  2Y4O A;  5BSM A;  1WF3 A;  3T1H C;  1N34 C;  2UUC C;  2WP0 C;  1IBK C;  3LNV A;  3T1Y C;  5KYT A;  5AE2 A;  4DR7 C;  4B3R C;  4AQY C;  1HR0 C;  4BC7 A;  3NPD A;  2YWB A;  3PRO C;  1XRC A;  4JI3 C;  1K0R A;  1HNX C;  4LF4 C;  2HJG A;  1MKY A;  1NYE A;  5AE3 A;  1HH2 P;  1P7L A;  4BSZ A;  5T8S A;  4GKJ C;  4JI8 C;  3A9V A;  2E8E A;  2HHH C;  1MXB A;  3H2T A;  3R44 A;  4RLQ A;  5IT9 D;  3E7W A;  3DHV A;  2YWC A;  2OO4 A;  1V25 A;  4NXN C;  1O9T A;  1MDB A;  4G1I A;  4K0B A;  2D7V A;  5BSU A;  4X62 C;  5A2Q D;  5BSW A;  5A1I A;  3L8C A;  1XNR C;  4JI2 C;  2P2F A;  4LF8 C;  3OTO C;  4X65 C;  2VZE A;  4L4Q A;  5BSV A;  1HNZ C;  4JI7 C;  3CW9 A;  3E7X A;  1ML8 A;  4G36 A;  3SO4 A;  4XX2 A;  2BJO A;  2VSQ A;  3R9X A;  1RG9 A;  2D27 A;  3B7W A;  1O90 A;  2V7B A;  3IEU A;  5K8F A;  4DV7 C;  2UXB C;  1BA3 A;  4KTT A;  4JM1 A;  5BSR A;  4JYA C;  3RV2 A;  5IFI A;  4B3S C;  4KHP C;  1LQL A;  4BCA A;  5ADZ A;  3J7A D;  4DV2 C;  2CY1 A;  2WD9 A;  4RVN A;  2QVY X;  4X64 C;  3PES A;  2P02 A;  1MXC A;  3VNS A;  4LFC C;  4DCS A;  2F4V C;  1I94 C;  1MXA A;  3LUS A;  3VNQ A;  3GR1 A;  1IBM C;  1N36 C;  2E7G A;  4LFB C;  4KTV A;  4DR1 C;  4FUT A;  4DR2 C;  3UZ0 A;  2OPL A;  5GTD A;  2OPL B;  4BBY A;  4LE5 A;  3TQI A;  4R1L A;  3EQ6 A;  4L2Z A;  2E5L C;  4YY3 C;  4DR3 C;  1XRA A;  2Y27 A;  5FLX D;  3RG2 A;  4DV5 C;  2DYJ A;  1PG4 A;  3GR0 A;  4DV3 C;  1PA4 A;  4K0K C;  4WV3 A;  2XR1 A;  1AMU A;  4DR4 C;  5LMN C;  5AE1 A;  3N2Q A;  3FCE A;  1ZB8 A;  1XRB A;  1YJ7 A;  4G37 A;  1LCI A;  4DUY C;  4WS9 A;  2QW0 X;  4HPV A;  3NYQ A;  4LFA C;  4JI1 C;  4L7I A;  4U5Y D;  3IPL A;  4NOZ A;  4LF5 C;  2ONF A;  4NXM C;  4DCU A;  2D1Q A;  4X66 C;  2P2M A;  3J80 D;  3LAX A;  4PZP A;  4GS5 A;  3A9U A;  3IEV A;  3CJE A;  4RVO A;  5KYV A;  3J81 D;  1VLA A;  2P2J A;  5A1G A;  2KZF A;  3S82 A;  2E0G A;  2P2Q A;  4DV0 C;  4DR6 C;  4EAT A;  5K85 A;  5BST A;  4B3T C;  1N32 C;  1HNW C;  4JV5 C;  2JMP A;  4MTN A;  4IZ6 A;  3A4I A;  3G7S A;  1MDF A;  1V26 A;  3GKU A;  5H9U A;  4FUQ A;  1USP A;  3AF6 A;  2ATW A;  2DPL A;  4TPS B;  2P20 A;  4GXQ A;  2UXD C;  3I07 A;  4JI4 C;  3UOW A;  3JAM D;  2PT7 G;  2UUB C;  4GXR A;  1XMQ C;  2YCB A;  4D4I A;  5KEI A;  2UUA C;  3VNR A;  1WH9 A;  3TDE A;  5BUQ A;  5E7Q A;  4I9G A;  3ETC A;  3TUF A;  3N54 B;  3L95 X;  4RM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...