4JI5C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 55
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji5C02
2E8FA 4JI0C 5IWAC 1WH9A 2E8EA 2ONFA 1XMQC 4DV0C 2E5LC 1LQLA 5BR8C 4JYAC 4X64C 4DR6C 2UU9C 4DV1C 2OPLB 1N2FA 4MH4A 2KZFA 3LUSA 1HNZC 4LF7C 4YY3C 4MTNA 3EERA 4DCSA 2DYJA 4LF8C 2PT7G 4NXMC 1IBKC 4JI3C 1USPB 2PN2A 2VQEC 1N33C 2CXCA 1XNRC 3R9WA 1KKGA 3CJEA 4JI4C 3AF5A 4JI2C 4B3RC 3I07A 4LFBC 4DV5C 3T1YC 2BJOA 5FLXD 1N34C 2UUCC 4DV4C 1I94C 2OPLA 4JI1C 2YCBA 4LFAC 4JI8C 3IEVA 2VQFC 4DV2C 4GKJC 1K0RA 3IEUA 4DCVA 4BSZA 3J80D 5LMNC 5A2QD 2CY1A 3T1HC 4DV3C 4DR4C 1VLAA 4K0KC 1FJGC 4DR7C 1USPA 1ZB9A 4X62C 1N36C 4JV5C 2JMPA 1UKKA 3GKUA 2UXBC 1JOSA 1ZB8A 1XMOC 3OTOC 2HHHC 2QL8A 2ATWA 2E8CA 4JI5C 3JAMD 4DCUA 4B3SC 5IT9D 1HH2P 1HNWC 4DUYC 2E7GA 4NXNC 4B3TC 1EGAA 1ML8A 4AQYC 1NYEA 3R9XA 3AF6A 2ZM6C 2UUBC 2XR1A 1IBLC 4DR5C 4DUZC 2HJGA 4LFCC 3J7AD 1PA4A 3J81D 4GKKC 2UXDC 1HNXC 2UXCC 4YHHC 1WF3A 4DR1C 4JI7C 4X65C 4LF5C 1HR0C 1L2FA 4JI6C 2EGTA 4B3MC 1QWIA 4DR2C 1IBMC 4LF6C 4DR3C 4DCTA 2D7VA 1MKYA 4LF4C 4LF9C 4XX2A 4OX9C 4DV7C 4DV6C 1XNQC 4NOZA 1J5EC 5LMUC 2F4VC 4X66C 4KHPC 2UUAC 1N32C 2ASBA
chains in the Genus database with same CATH superfamily
2E8FA 3FM7A 2E8EA 3UEBA 2E5LC 5K8FA 4G37A 3LNVA 1V60A 1PG3A 2UU9C 3S82A 1MXCA 2OPLB 2Y27A 1HNZC 4MTNA 5IFIA 2D1SA 3TUFA 4LF8C 5CZVA 2PT7G 1IBKC 3FCCA 1FUGA 2VZEA 2CXCA 3K6RA 2MCQA 5A1GA 1XRAA 4JI4C 3R9WA 3N2QA 4DV5C 1RY2A 4DV4C 2OPLA 1P4EA 4JI1C 2CY1A 3T1HC 3G7SA 4DV3C 2QVYX 3A9UA 4X62C 1N36C 3TQIA 4L2ZA 2UXBC 1JOSA 3RV2A 4ZLPA 1PG4A 2HHHC 3UOWA 2QL8A 4JI5C 2KZ0A 3FCEA 4B3SC 4NXNC 4B3TC 1EGAA 3CQ1A 3AF6A 1XRBA 1XDXA 4BC7A 4TPSB 1IBLC 1YJ7A 2UXDC 2UXCC 3TR3A 4JI7C 4LF5C 4G36A 2EGTA 5BSTA 5KYVA 1MXBA 5A19A 2QVZX 4DR3C 2Z51A 4LF4C 4D57A 3SO4A 4DG9A 4DV6C 3NYQA 2F4VC 5LMUC 2UUAC 1N32C 5AE1A 4JI0C 3LAXA 3UX2A 5BR8C 1XRCA 4DR6C 4RVOA 4MH4A 2Y4NA 4LF7C 4I9GA 4YY3C 3EERA 1XHJA 2PROA 4IZ6A 5KEIA 4G1IA 4PZPA 1N33C 1XNRC 2OBVA 3I07A 3T1YC 4ISBA 4L7IA 2UUCC 2D1RA 4PHTA 4DV2C 4GKJC 5LMNC 5A2QD 5BSMA 4DR4C 4K0KC 3N54B 4LE5A 1GPMA 3L95X 5LCIA 2MMAB 4RM3A 4BC9A 2V7BA 3EQ6A 2NCLA 3PROC 2BH1X 4RVNA 3OTOC 2ZZNA 2E8CA 4L4QA 3DAYA 3NPDA 4OYCA 1V25A 3VNQA 4DUYC 4EATA 3UX3A 4PUIA 4AQYC 5BSRA 3R9XA 3GPCA 2ZM6C 2DHMA 2UUBC 1RG9A 1XS3A 4FTFA 5AE3A 4LFCC 3J7AD 4JM1A 1PA4A 5AE2A 5T8SA 5GTDA 1PU1A 1HNXC 2D1TA 5E7QA 3E7XA 4DR1C 4X65C 4D4IA 1L2FA 4WS9A 4JI6C 4IR7A 3R44A 5H9UA 3TDEA 3B7WA 2P2QA 1MKYA 3DLPX 1ULTA 3O2EA 4XX2A 4BBYA 4DV7C 1AMUA 4X66C 2P2JA 1WH9A 1WCJA 4X64C 1IB8A 4GXQA 1N2FA 2KZFA 4DCSA 2DYJA 4K0BA 4NXMC 2AYAA 1USPB 3UZ0A 1KKGA 3AF5A 4JI2C 1LCIA 2JNVA 3C5EA 5BUQA 2YCBA 3CQ2A 3IEVA 5BURA 3A25A 3IEUA 5JRHA 3J80D 1V26A 4RLFA 1O9TA 1USPA 4JV5C 1UKKA 3GKUA 1T5DX 3AY0A 5BSVA 1XMOC 5T8TA 3H2TA 2ATWA 5KYTA 3JAMD 4DCUA 1M6XC 2M5OA 5IT9D 1HH2P 1NY8A 2MM9A 1ML8A 3NYRA 4U5YD 3RG2A 5K85A 2E0GA 5BSWA 2D28C 4FUTA 3LGXA 2XR1A 3J81D 2YX1A 4I9FA 3DHVA 4YHHC 1WF3A 4KTVA 1HR0C 1T5HX 1BA3A 1QWIA 4GXRA 4DR2C 4RMNA 2PG1E 5CZXA 1O93A 1P4EC 4DCTA 2P2MA 4LF9C 4ODJA 2CU6A 3IMLA 3A26A 4NOZA 1J5EC 2ASBA 3A9VA 2VSQA 5A1IA 5IWAC 2ONFA 1XMQC 4DV0C 1O90A 2KDNA 2YWCA 1LQLA 2WP0C 2P02A 5BUSA 4JYAC 4RLQA 1O92A 4DV1C 3A4IA 3E7WA 1YGTA 3LUSA 1P7LA 3VNSA 2P2BA 4JI3C 2PN2A 3IPLA 2VQEC 3CJEA 4FUQA 4B3RC 4LFBC 1MDFA 2BJOA 5FLXD 1N34C 3GR1A 4NDNA 1I94C 4LFAC 2OO4A 4JI8C 2VQFC 1K0RA 5ADZA 4D56A 1MD9A 2WD9A 4BSZA 3VNRA 4DCVA 3ETCA 1FLOA 4PUHA 4PROC 1VLAA 5DV9A 1FJGC 2P20A 4DR7C 4R1MA 1ZB9A 4R0MA 1UWDA 1TH5A 3I08A 2JMPA 2Y4OA 3PBKA 1QM4A 3LNOA 2ZTBA 4PUGA 2D27A 1ZB8A 2D1QA 1MXAA 3ETOA 4R1LA 3L8CA 4RM2A 2M5HA 3PESA 2DPLA 4GS5A 1HNWC 2E7GA 3CW9A 1NYEA 2QVXX 4DR5C 4DUZC 2HJGA 4GKKC 2P2FA 2QW0X 4D4GA 4DG8A 3KXWA 4B3MC 4BCAA 4OXIA 4ZJZA 1IBMC 4LF6C 1VEHA 1MDBA 2D7VA 3CW8X 4WV3A 3GR0A 5BSUA 3CQ3A 4KTTA 1M6XA 2YWBA 4HPVA 4OX9C 3NI2A 1XNQC 2ZZMA 4KHPC
chains in the Genus database with same CATH topology
2E8FA 2E8EA 2E5LC 5K8FA 4G37A 3LNVA 1PG3A 2UU9C 3S82A 1MXCA 2OPLB 2Y27A 1HNZC 4MTNA 5IFIA 2D1SA 3TUFA 4LF8C 5CZVA 2PT7G 1IBKC 3FCCA 1FUGA 2VZEA 2CXCA 5A1GA 3R9WA 1XRAA 4JI4C 3N2QA 4DV5C 1RY2A 4DV4C 2OPLA 4JI1C 2CY1A 3T1HC 3G7SA 4DV3C 2QVYX 3A9UA 4X62C 1N36C 3TQIA 4L2ZA 2UXBC 1JOSA 3RV2A 4ZLPA 1PG4A 2HHHC 3UOWA 2QL8A 4JI5C 3FCEA 4B3SC 4NXNC 4B3TC 1EGAA 3AF6A 1XRBA 4BC7A 4TPSB 1IBLC 1YJ7A 2UXDC 2UXCC 4JI7C 4LF5C 4G36A 2EGTA 5BSTA 5KYVA 1MXBA 5A19A 2QVZX 4DR3C 4LF4C 4D57A 3SO4A 4DG9A 4DV6C 3NYQA 2F4VC 5LMUC 2UUAC 1N32C 5AE1A 4JI0C 3LAXA 5BR8C 1XRCA 4DR6C 4RVOA 4MH4A 2Y4NA 4LF7C 4I9GA 4YY3C 3EERA 2PROA 4IZ6A 5KEIA 4G1IA 4PZPA 1N33C 1XNRC 2OBVA 3I07A 3T1YC 4ISBA 4L7IA 2UUCC 2D1RA 4PHTA 4DV2C 4GKJC 5LMNC 5A2QD 5BSMA 4DR4C 4K0KC 3N54B 4LE5A 1GPMA 3L95X 4RM3A 4BC9A 2V7BA 3EQ6A 3PROC 2BH1X 4RVNA 3OTOC 2E8CA 4L4QA 3DAYA 3NPDA 4OYCA 1V25A 3VNQA 4DUYC 4EATA 4AQYC 5BSRA 3R9XA 3GPCA 2ZM6C 2UUBC 1RG9A 4FTFA 5AE3A 4LFCC 3J7AD 4JM1A 1PA4A 5AE2A 5T8SA 5GTDA 1HNXC 2D1TA 5E7QA 3E7XA 4DR1C 4X65C 4D4IA 1L2FA 4WS9A 4JI6C 4IR7A 3R44A 5H9UA 3TDEA 3B7WA 2P2QA 1MKYA 3DLPX 1ULTA 4XX2A 4BBYA 4DV7C 1AMUA 4X66C 2P2JA 1WH9A 4X64C 4GXQA 1N2FA 2KZFA 4DCSA 2DYJA 4K0BA 4NXMC 2AYAA 1USPB 3UZ0A 1KKGA 3AF5A 4JI2C 1LCIA 3C5EA 5BUQA 2YCBA 3IEVA 5BURA 3IEUA 5JRHA 3J80D 1V26A 4RLFA 1O9TA 1USPA 4JV5C 1UKKA 3GKUA 1T5DX 5BSVA 1XMOC 5T8TA 3H2TA 2ATWA 5KYTA 3JAMD 4DCUA 5IT9D 1HH2P 1ML8A 3NYRA 4U5YD 3RG2A 5K85A 2E0GA 5BSWA 2D28C 4FUTA 3LGXA 2XR1A 3J81D 4I9FA 3DHVA 4YHHC 1WF3A 4KTVA 1HR0C 1T5HX 1BA3A 1QWIA 4GXRA 4DR2C 4RMNA 5CZXA 1O93A 4DCTA 2P2MA 4LF9C 4ODJA 3IMLA 4NOZA 1J5EC 2ASBA 3A9VA 2VSQA 5A1IA 5IWAC 2ONFA 1XMQC 4DV0C 1O90A 2YWCA 1LQLA 2WP0C 2P02A 5BUSA 4JYAC 4RLQA 1O92A 4DV1C 3A4IA 3E7WA 3LUSA 1P7LA 3VNSA 2P2BA 4JI3C 2PN2A 3IPLA 2VQEC 3CJEA 4FUQA 4B3RC 4LFBC 1MDFA 2BJOA 5FLXD 1N34C 3GR1A 4NDNA 1I94C 4LFAC 2OO4A 4JI8C 2VQFC 1K0RA 5ADZA 4D56A 1MD9A 2WD9A 4BSZA 3VNRA 4DCVA 3ETCA 4PROC 1VLAA 5DV9A 1FJGC 2P20A 4DR7C 4R1MA 1ZB9A 4R0MA 3I08A 3PBKA 2JMPA 2Y4OA 1QM4A 2D27A 1ZB8A 2D1QA 1MXAA 3ETOA 4R1LA 3L8CA 4RM2A 3PESA 2DPLA 4GS5A 1HNWC 2E7GA 3CW9A 1NYEA 2QVXX 4DR5C 4DUZC 2HJGA 4GKKC 2P2FA 2QW0X 4D4GA 4DG8A 3KXWA 4B3MC 4BCAA 4OXIA 4ZJZA 1IBMC 4LF6C 1MDBA 2D7VA 3CW8X 4WV3A 3GR0A 5BSUA 4KTTA 2YWBA 4HPVA 4OX9C 3NI2A 1XNQC 4KHPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8F A;  4JI0 C;  5IWA C;  1WH9 A;  2E8E A;  2ONF A;  1XMQ C;  4DV0 C;  2E5L C;  1LQL A;  5BR8 C;  4JYA C;  4X64 C;  4DR6 C;  2UU9 C;  4DV1 C;  2OPL B;  1N2F A;  4MH4 A;  2KZF A;  3LUS A;  1HNZ C;  4LF7 C;  4YY3 C;  4MTN A;  3EER A;  4DCS A;  2DYJ A;  4LF8 C;  2PT7 G;  4NXM C;  1IBK C;  4JI3 C;  1USP B;  2PN2 A;  2VQE C;  1N33 C;  2CXC A;  1XNR C;  3R9W A;  1KKG A;  3CJE A;  4JI4 C;  3AF5 A;  4JI2 C;  4B3R C;  3I07 A;  4LFB C;  4DV5 C;  3T1Y C;  2BJO A;  5FLX D;  1N34 C;  2UUC C;  4DV4 C;  1I94 C;  2OPL A;  4JI1 C;  2YCB A;  4LFA C;  4JI8 C;  3IEV A;  2VQF C;  4DV2 C;  4GKJ C;  1K0R A;  3IEU A;  4DCV A;  4BSZ A;  3J80 D;  5LMN C;  5A2Q D;  2CY1 A;  3T1H C;  4DV3 C;  4DR4 C;  1VLA A;  4K0K C;  1FJG C;  4DR7 C;  1USP A;  1ZB9 A;  4X62 C;  1N36 C;  4JV5 C;  2JMP A;  1UKK A;  3GKU A;  2UXB C;  1JOS A;  1ZB8 A;  1XMO C;  3OTO C;  2HHH C;  2QL8 A;  2ATW A;  2E8C A;  4JI5 C;  3JAM D;  4DCU A;  4B3S C;  5IT9 D;  1HH2 P;  1HNW C;  4DUY C;  2E7G A;  4NXN C;  4B3T C;  1EGA A;  1ML8 A;  4AQY C;  1NYE A;  3R9X A;  3AF6 A;  2ZM6 C;  2UUB C;  2XR1 A;  1IBL C;  4DR5 C;  4DUZ C;  2HJG A;  4LFC C;  3J7A D;  1PA4 A;  3J81 D;  4GKK C;  2UXD C;  1HNX C;  2UXC C;  4YHH C;  1WF3 A;  4DR1 C;  4JI7 C;  4X65 C;  4LF5 C;  1HR0 C;  1L2F A;  4JI6 C;  2EGT A;  4B3M C;  1QWI A;  4DR2 C;  1IBM C;  4LF6 C;  4DR3 C;  4DCT A;  2D7V A;  1MKY A;  4LF4 C;  4LF9 C;  4XX2 A;  4OX9 C;  4DV7 C;  4DV6 C;  1XNQ C;  4NOZ A;  1J5E C;  5LMU C;  2F4V C;  4X66 C;  4KHP C;  2UUA C;  1N32 C;  2ASB A; 
#chains in the Genus database with same CATH topology
 2E8F A;  3FM7 A;  2E8E A;  3UEB A;  2E5L C;  5K8F A;  4G37 A;  3LNV A;  1V60 A;  1PG3 A;  2UU9 C;  3S82 A;  1MXC A;  2OPL B;  2Y27 A;  1HNZ C;  4MTN A;  5IFI A;  2D1S A;  3TUF A;  4LF8 C;  5CZV A;  2PT7 G;  1IBK C;  3FCC A;  1FUG A;  2VZE A;  2CXC A;  3K6R A;  2MCQ A;  5A1G A;  1XRA A;  4JI4 C;  3R9W A;  3N2Q A;  4DV5 C;  1RY2 A;  4DV4 C;  2OPL A;  1P4E A;  4JI1 C;  2CY1 A;  3T1H C;  3G7S A;  4DV3 C;  2QVY X;  3A9U A;  4X62 C;  1N36 C;  3TQI A;  4L2Z A;  2UXB C;  1JOS A;  3RV2 A;  4ZLP A;  1PG4 A;  2HHH C;  3UOW A;  2QL8 A;  4JI5 C;  2KZ0 A;  3FCE A;  4B3S C;  4NXN C;  4B3T C;  1EGA A;  3CQ1 A;  3AF6 A;  1XRB A;  1XDX A;  4BC7 A;  4TPS B;  1IBL C;  1YJ7 A;  2UXD C;  2UXC C;  3TR3 A;  4JI7 C;  4LF5 C;  4G36 A;  2EGT A;  5BST A;  5KYV A;  1MXB A;  5A19 A;  2QVZ X;  4DR3 C;  2Z51 A;  4LF4 C;  4D57 A;  3SO4 A;  4DG9 A;  4DV6 C;  3NYQ A;  2F4V C;  5LMU C;  2UUA C;  1N32 C;  5AE1 A;  4JI0 C;  3LAX A;  3UX2 A;  5BR8 C;  1XRC A;  4DR6 C;  4RVO A;  4MH4 A;  2Y4N A;  4LF7 C;  4I9G A;  4YY3 C;  3EER A;  1XHJ A;  2PRO A;  4IZ6 A;  5KEI A;  4G1I A;  4PZP A;  1N33 C;  1XNR C;  2OBV A;  3I07 A;  3T1Y C;  4ISB A;  4L7I A;  2UUC C;  2D1R A;  4PHT A;  4DV2 C;  4GKJ C;  5LMN C;  5A2Q D;  5BSM A;  4DR4 C;  4K0K C;  3N54 B;  4LE5 A;  1GPM A;  3L95 X;  5LCI A;  2MMA B;  4RM3 A;  4BC9 A;  2V7B A;  3EQ6 A;  2NCL A;  3PRO C;  2BH1 X;  4RVN A;  3OTO C;  2ZZN A;  2E8C A;  4L4Q A;  3DAY A;  3NPD A;  4OYC A;  1V25 A;  3VNQ A;  4DUY C;  4EAT A;  3UX3 A;  4PUI A;  4AQY C;  5BSR A;  3R9X A;  3GPC A;  2ZM6 C;  2DHM A;  2UUB C;  1RG9 A;  1XS3 A;  4FTF A;  5AE3 A;  4LFC C;  3J7A D;  4JM1 A;  1PA4 A;  5AE2 A;  5T8S A;  5GTD A;  1PU1 A;  1HNX C;  2D1T A;  5E7Q A;  3E7X A;  4DR1 C;  4X65 C;  4D4I A;  1L2F A;  4WS9 A;  4JI6 C;  4IR7 A;  3R44 A;  5H9U A;  3TDE A;  3B7W A;  2P2Q A;  1MKY A;  3DLP X;  1ULT A;  3O2E A;  4XX2 A;  4BBY A;  4DV7 C;  1AMU A;  4X66 C;  2P2J A;  1WH9 A;  1WCJ A;  4X64 C;  1IB8 A;  4GXQ A;  1N2F A;  2KZF A;  4DCS A;  2DYJ A;  4K0B A;  4NXM C;  2AYA A;  1USP B;  3UZ0 A;  1KKG A;  3AF5 A;  4JI2 C;  1LCI A;  2JNV A;  3C5E A;  5BUQ A;  2YCB A;  3CQ2 A;  3IEV A;  5BUR A;  3A25 A;  3IEU A;  5JRH A;  3J80 D;  1V26 A;  4RLF A;  1O9T A;  1USP A;  4JV5 C;  1UKK A;  3GKU A;  1T5D X;  3AY0 A;  5BSV A;  1XMO C;  5T8T A;  3H2T A;  2ATW A;  5KYT A;  3JAM D;  4DCU A;  1M6X C;  2M5O A;  5IT9 D;  1HH2 P;  1NY8 A;  2MM9 A;  1ML8 A;  3NYR A;  4U5Y D;  3RG2 A;  5K85 A;  2E0G A;  5BSW A;  2D28 C;  4FUT A;  3LGX A;  2XR1 A;  3J81 D;  2YX1 A;  4I9F A;  3DHV A;  4YHH C;  1WF3 A;  4KTV A;  1HR0 C;  1T5H X;  1BA3 A;  1QWI A;  4GXR A;  4DR2 C;  4RMN A;  2PG1 E;  5CZX A;  1O93 A;  1P4E C;  4DCT A;  2P2M A;  4LF9 C;  4ODJ A;  2CU6 A;  3IML A;  3A26 A;  4NOZ A;  1J5E C;  2ASB A;  3A9V A;  2VSQ A;  5A1I A;  5IWA C;  2ONF A;  1XMQ C;  4DV0 C;  1O90 A;  2KDN A;  2YWC A;  1LQL A;  2WP0 C;  2P02 A;  5BUS A;  4JYA C;  4RLQ A;  1O92 A;  4DV1 C;  3A4I A;  3E7W A;  1YGT A;  3LUS A;  1P7L A;  3VNS A;  2P2B A;  4JI3 C;  2PN2 A;  3IPL A;  2VQE C;  3CJE A;  4FUQ A;  4B3R C;  4LFB C;  1MDF A;  2BJO A;  5FLX D;  1N34 C;  3GR1 A;  4NDN A;  1I94 C;  4LFA C;  2OO4 A;  4JI8 C;  2VQF C;  1K0R A;  5ADZ A;  4D56 A;  1MD9 A;  2WD9 A;  4BSZ A;  3VNR A;  4DCV A;  3ETC A;  1FLO A;  4PUH A;  4PRO C;  1VLA A;  5DV9 A;  1FJG C;  2P20 A;  4DR7 C;  4R1M A;  1ZB9 A;  4R0M A;  1UWD A;  1TH5 A;  3I08 A;  2JMP A;  2Y4O A;  3PBK A;  1QM4 A;  3LNO A;  2ZTB A;  4PUG A;  2D27 A;  1ZB8 A;  2D1Q A;  1MXA A;  3ETO A;  4R1L A;  3L8C A;  4RM2 A;  2M5H A;  3PES A;  2DPL A;  4GS5 A;  1HNW C;  2E7G A;  3CW9 A;  1NYE A;  2QVX X;  4DR5 C;  4DUZ C;  2HJG A;  4GKK C;  2P2F A;  2QW0 X;  4D4G A;  4DG8 A;  3KXW A;  4B3M C;  4BCA A;  4OXI A;  4ZJZ A;  1IBM C;  4LF6 C;  1VEH A;  1MDB A;  2D7V A;  3CW8 X;  4WV3 A;  3GR0 A;  5BSU A;  3CQ3 A;  4KTT A;  1M6X A;  2YWB A;  4HPV A;  4OX9 C;  3NI2 A;  1XNQ C;  2ZZM A;  4KHP C; 
#chains in the Genus database with same CATH homology
 2E8F A;  2E8E A;  2E5L C;  5K8F A;  4G37 A;  3LNV A;  1PG3 A;  2UU9 C;  3S82 A;  1MXC A;  2OPL B;  2Y27 A;  1HNZ C;  4MTN A;  5IFI A;  2D1S A;  3TUF A;  4LF8 C;  5CZV A;  2PT7 G;  1IBK C;  3FCC A;  1FUG A;  2VZE A;  2CXC A;  5A1G A;  3R9W A;  1XRA A;  4JI4 C;  3N2Q A;  4DV5 C;  1RY2 A;  4DV4 C;  2OPL A;  4JI1 C;  2CY1 A;  3T1H C;  3G7S A;  4DV3 C;  2QVY X;  3A9U A;  4X62 C;  1N36 C;  3TQI A;  4L2Z A;  2UXB C;  1JOS A;  3RV2 A;  4ZLP A;  1PG4 A;  2HHH C;  3UOW A;  2QL8 A;  4JI5 C;  3FCE A;  4B3S C;  4NXN C;  4B3T C;  1EGA A;  3AF6 A;  1XRB A;  4BC7 A;  4TPS B;  1IBL C;  1YJ7 A;  2UXD C;  2UXC C;  4JI7 C;  4LF5 C;  4G36 A;  2EGT A;  5BST A;  5KYV A;  1MXB A;  5A19 A;  2QVZ X;  4DR3 C;  4LF4 C;  4D57 A;  3SO4 A;  4DG9 A;  4DV6 C;  3NYQ A;  2F4V C;  5LMU C;  2UUA C;  1N32 C;  5AE1 A;  4JI0 C;  3LAX A;  5BR8 C;  1XRC A;  4DR6 C;  4RVO A;  4MH4 A;  2Y4N A;  4LF7 C;  4I9G A;  4YY3 C;  3EER A;  2PRO A;  4IZ6 A;  5KEI A;  4G1I A;  4PZP A;  1N33 C;  1XNR C;  2OBV A;  3I07 A;  3T1Y C;  4ISB A;  4L7I A;  2UUC C;  2D1R A;  4PHT A;  4DV2 C;  4GKJ C;  5LMN C;  5A2Q D;  5BSM A;  4DR4 C;  4K0K C;  3N54 B;  4LE5 A;  1GPM A;  3L95 X;  4RM3 A;  4BC9 A;  2V7B A;  3EQ6 A;  3PRO C;  2BH1 X;  4RVN A;  3OTO C;  2E8C A;  4L4Q A;  3DAY A;  3NPD A;  4OYC A;  1V25 A;  3VNQ A;  4DUY C;  4EAT A;  4AQY C;  5BSR A;  3R9X A;  3GPC A;  2ZM6 C;  2UUB C;  1RG9 A;  4FTF A;  5AE3 A;  4LFC C;  3J7A D;  4JM1 A;  1PA4 A;  5AE2 A;  5T8S A;  5GTD A;  1HNX C;  2D1T A;  5E7Q A;  3E7X A;  4DR1 C;  4X65 C;  4D4I A;  1L2F A;  4WS9 A;  4JI6 C;  4IR7 A;  3R44 A;  5H9U A;  3TDE A;  3B7W A;  2P2Q A;  1MKY A;  3DLP X;  1ULT A;  4XX2 A;  4BBY A;  4DV7 C;  1AMU A;  4X66 C;  2P2J A;  1WH9 A;  4X64 C;  4GXQ A;  1N2F A;  2KZF A;  4DCS A;  2DYJ A;  4K0B A;  4NXM C;  2AYA A;  1USP B;  3UZ0 A;  1KKG A;  3AF5 A;  4JI2 C;  1LCI A;  3C5E A;  5BUQ A;  2YCB A;  3IEV A;  5BUR A;  3IEU A;  5JRH A;  3J80 D;  1V26 A;  4RLF A;  1O9T A;  1USP A;  4JV5 C;  1UKK A;  3GKU A;  1T5D X;  5BSV A;  1XMO C;  5T8T A;  3H2T A;  2ATW A;  5KYT A;  3JAM D;  4DCU A;  5IT9 D;  1HH2 P;  1ML8 A;  3NYR A;  4U5Y D;  3RG2 A;  5K85 A;  2E0G A;  5BSW A;  2D28 C;  4FUT A;  3LGX A;  2XR1 A;  3J81 D;  4I9F A;  3DHV A;  4YHH C;  1WF3 A;  4KTV A;  1HR0 C;  1T5H X;  1BA3 A;  1QWI A;  4GXR A;  4DR2 C;  4RMN A;  5CZX A;  1O93 A;  4DCT A;  2P2M A;  4LF9 C;  4ODJ A;  3IML A;  4NOZ A;  1J5E C;  2ASB A;  3A9V A;  2VSQ A;  5A1I A;  5IWA C;  2ONF A;  1XMQ C;  4DV0 C;  1O90 A;  2YWC A;  1LQL A;  2WP0 C;  2P02 A;  5BUS A;  4JYA C;  4RLQ A;  1O92 A;  4DV1 C;  3A4I A;  3E7W A;  3LUS A;  1P7L A;  3VNS A;  2P2B A;  4JI3 C;  2PN2 A;  3IPL A;  2VQE C;  3CJE A;  4FUQ A;  4B3R C;  4LFB C;  1MDF A;  2BJO A;  5FLX D;  1N34 C;  3GR1 A;  4NDN A;  1I94 C;  4LFA C;  2OO4 A;  4JI8 C;  2VQF C;  1K0R A;  5ADZ A;  4D56 A;  1MD9 A;  2WD9 A;  4BSZ A;  3VNR A;  4DCV A;  3ETC A;  4PRO C;  1VLA A;  5DV9 A;  1FJG C;  2P20 A;  4DR7 C;  4R1M A;  1ZB9 A;  4R0M A;  3I08 A;  3PBK A;  2JMP A;  2Y4O A;  1QM4 A;  2D27 A;  1ZB8 A;  2D1Q A;  1MXA A;  3ETO A;  4R1L A;  3L8C A;  4RM2 A;  3PES A;  2DPL A;  4GS5 A;  1HNW C;  2E7G A;  3CW9 A;  1NYE A;  2QVX X;  4DR5 C;  4DUZ C;  2HJG A;  4GKK C;  2P2F A;  2QW0 X;  4D4G A;  4DG8 A;  3KXW A;  4B3M C;  4BCA A;  4OXI A;  4ZJZ A;  1IBM C;  4LF6 C;  1MDB A;  2D7V A;  3CW8 X;  4WV3 A;  3GR0 A;  5BSU A;  4KTT A;  2YWB A;  4HPV A;  4OX9 C;  3NI2 A;  1XNQ C;  4KHP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...