4DR2C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 52
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr2C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr2C02
4DR6C 3AF5A 2UXDC 1L2FA 1IBLC 1K0RA 4LF6C 3J80D 2ONFA 1XMQC 3GKUA 2OPLB 4DR7C 1EGAA 1N2FA 4LFCC 1N32C 3T1YC 1N33C 4JI1C 1HH2P 1N34C 4JI6C 2YCBA 1ZB9A 1N36C 2ATWA 4X64C 4B3SC 5LMUC 2JMPA 2F4VC 2BJOA 1MKYA 4DUYC 4DV3C 5FLXD 4DR1C 4YHHC 1XMOC 4JI3C 2ZM6C 2XR1A 2PT7G 4JI0C 4MH4A 1ML8A 4X65C 2UXCC 4B3RC 4LFBC 4JI4C 2UUCC 4OX9C 4LFAC 3J81D 2E8EA 3JAMD 1I94C 2D7VA 4DV4C 1LQLA 1UKKA 2ASBA 4NXMC 4AQYC 4DV2C 3EERA 4DCVA 4DV0C 1HR0C 2E7GA 1PA4A 5IT9D 4LF7C 2UU9C 4K0KC 4DCUA 4YY3C 4JI7C 2KZFA 4BSZA 1IBMC 5LMNC 2E8CA 2CY1A 1WF3A 1IBKC 4LF4C 1USPA 5A2QD 2QL8A 2PN2A 4DV5C 2E8FA 2UXBC 4NOZA 1KKGA 4X66C 4JYAC 4LF5C 5BR8C 2VQFC 2EGTA 2DYJA 3LUSA 4KHPC 4JI8C 1XNQC 3AF6A 4DR4C 5IWAC 4DR5C 3T1HC 3CJEA 1QWIA 2UUBC 4DCTA 1XNRC 1HNZC 3I07A 1HNXC 2HHHC 4XX2A 4MTNA 1VLAA 4GKJC 1USPB 2E5LC 1WH9A 3OTOC 1JOSA 4DUZC 4GKKC 4NXNC 4JV5C 1FJGC 4DV7C 1J5EC 2HJGA 4DCSA 4B3MC 3IEUA 2VQEC 3R9XA 4X62C 2OPLA 2CXCA 4LF8C 4B3TC 2UUAC 1ZB8A 3IEVA 1NYEA 4LF9C 4DR2C 4DV6C 1HNWC 3J7AD 4JI2C 4JI5C 4DV1C 4DR3C 3R9WA
chains in the Genus database with same CATH superfamily
2Y4OA 2D1TA 5E7QA 3J80D 2ONFA 5KYVA 3L95X 3UX2A 1T5HX 4L7IA 1IB8A 4GXRA 1N34C 4R1MA 1N36C 3S82A 2M5HA 4RVOA 2QVXX 4BBYA 4DV3C 5FLXD 3B7WA 4RLFA 2DPLA 4PROC 1MXCA 1XRBA 3TUFA 3VNRA 4PUIA 2WD9A 4MH4A 1V26A 5BSMA 4JI4C 2UUCC 2E8EA 5BSVA 4ODJA 2ASBA 4GXQA 1MXBA 5BUSA 1V25A 2UU9C 4G37A 3AY0A 4YY3C 1VEHA 2CY1A 1IBKC 5A2QD 2P2BA 5A1IA 4NOZA 4DG9A 4JYAC 2NCLA 2EGTA 2P2QA 1FUGA 3EQ6A 4DR4C 3AF6A 1P4EC 2JNVA 3T1HC 5LCIA 2UUBC 1XNRC 3TR3A 5A1GA 1XS3A 2HHHC 1PG4A 4KTVA 1VLAA 1WH9A 4DUZC 1JOSA 3PBKA 4I9FA 4D57A 2Y27A 1J5EC 3FCCA 4DCSA 2D1RA 2VQEC 4X62C 2QVYX 4LF8C 2UUAC 1XRAA 5T8SA 5ADZA 4GS5A 4JI2C 4DR6C 4OYCA 4OXIA 2DHMA 5A19A 4LF6C 4U5YD 3GKUA 1UWDA 4LFCC 1N33C 1HH2P 4JI6C 2YCBA 2VZEA 2D28C 2ATWA 2JMPA 2F4VC 2BJOA 4DUYC 4DR1C 1XMOC 1GPMA 1MDFA 2QVZX 3DLPX 2ZM6C 3PESA 3DHVA 4BC9A 3E7XA 5AE2A 2UXCC 3GPCA 3A9UA 3G7SA 3CQ3A 2WP0C 4LFAC 3JAMD 4R0MA 1T5DX 4DV4C 1LQLA 5BURA 1HR0C 4DCVA 4DV0C 4HPVA 2E0GA 1PA4A 4LF7C 3LNOA 2KZFA 1IBMC 3LNVA 1USPA 2VSQA 2QL8A 5T8TA 4DV5C 4K0BA 2OBVA 4X66C 1ULTA 5BR8C 4ISBA 3A4IA 5BSTA 3LUSA 5K8FA 4DR5C 3RG2A 2KDNA 3CJEA 4PHTA 4DCTA 3IMLA 3UOWA 1HNZC 2ZZNA 3I07A 4GKJC 5GTDA 1USPB 1FLOA 3I08A 3K6RA 3R44A 2ZZMA 3C5EA 4JV5C 1FJGC 4KTTA 4ZJZA 2HJGA 3NI2A 3RV2A 2OPLA 2CXCA 1TH5A 4B3TC 1P4EA 2M5OA 2QW0X 4LF9C 4DV6C 4JI5C 3IPLA 4DR3C 1RG9A 2UXDC 3AF5A 2MMAB 1YJ7A 4DG8A 2Z51A 2OPLB 4DR7C 4EATA 4RVNA 1N2FA 5KEIA 1N32C 1LCIA 4B3SC 1O92A 4RM2A 1MDBA 3A9VA 2XR1A 1PG3A 4D4GA 2V7BA 3UZ0A 4IR7A 4B3RC 3GR1A 2P2JA 3N54B 1I94C 2D7VA 4G1IA 5BUQA 3TDEA 4NXMC 3CQ1A 4FTFA 4DV2C 2MM9A 2E7GA 3UX3A 5IT9D 4DCUA 3L8CA 5BSWA 3O2EA 4NDNA 5AE1A 3KXWA 5LMNC 4G36A 1WF3A 2PN2A 2E8FA 1BA3A 5CZVA 2YWBA 5IFIA 2VQFC 1V60A 4BCAA 4WV3A 2D1QA 5CZXA 2DYJA 1NY8A 1XNQC 2OO4A 2P2FA 3CW9A 1P7LA 1AMUA 1HNXC 4FUQA 2MCQA 1MXAA 4MTNA 5AE3A 1M6XC 2E5LC 3OTOC 1O90A 3PROC 3SO4A 3A26A 4D4IA 2Y4NA 2D1SA 3N2QA 4DV7C 4D56A 2P02A 2CU6A 4RM3A 3TQIA 2YX1A 3FM7A 1ZB8A 1NYEA 3DAYA 2P20A 4DR2C 4PUGA 1HNWC 3E7WA 4DV1C 1L2FA 1IBLC 3ETCA 1K0RA 1XMQC 1XHJA 5BSRA 1EGAA 3NYRA 1MD9A 4TPSB 3CW8X 4WS9A 3T1YC 4JI1C 1ZB9A 4X64C 5LMUC 1MKYA 3UEBA 2ZTBA 4YHHC 4JI3C 3LAXA 4PUHA 3LGXA 1QM4A 3H2TA 2PT7G 4JI0C 1ML8A 4X65C 4JM1A 2BH1X 4LFBC 4OX9C 3J81D 1O9TA 2AYAA 3ETOA 1UKKA 1XRCA 4ZLPA 1RY2A 3VNQA 4AQYC 3EERA 4LE5A 4K0KC 2PG1E 4JI7C 3FCEA 4BSZA 2E8CA 4LF4C 4L2ZA 3VNSA 5K85A 3CQ2A 4RMNA 2UXBC 1KKGA 4RLQA 4LF5C 2KZ0A 1XDXA 4R1LA 3GR0A 4KHPC 4I9GA 4PZPA 4JI8C 1YGTA 5KYTA 5IWAC 5JRHA 4L4QA 2D27A 5H9UA 1QWIA 3NPDA 4XX2A 4GKKC 4IZ6A 2PROA 4NXNC 2YWCA 4B3MC 3A25A 3IEUA 3R9XA 5DV9A 2P2MA 3NYQA 4FUTA 3IEVA 1WCJA 3J7AD 1O93A 4BC7A 1PU1A 1M6XA 3R9WA 5BSUA
chains in the Genus database with same CATH topology
2Y4OA 2D1TA 5E7QA 3J80D 2ONFA 5KYVA 3L95X 1T5HX 4L7IA 4GXRA 1N34C 4R1MA 1N36C 3S82A 4RVOA 2QVXX 4BBYA 4DV3C 5FLXD 3B7WA 4RLFA 2DPLA 4PROC 1MXCA 1XRBA 3TUFA 3VNRA 2WD9A 4MH4A 1V26A 5BSMA 4JI4C 2UUCC 2E8EA 5BSVA 4ODJA 2ASBA 4GXQA 1MXBA 5BUSA 1V25A 2UU9C 4G37A 4YY3C 2CY1A 1IBKC 5A2QD 2P2BA 5A1IA 4NOZA 4DG9A 4JYAC 2EGTA 2P2QA 1FUGA 3EQ6A 4DR4C 3AF6A 3T1HC 2UUBC 1XNRC 5A1GA 2HHHC 1PG4A 4KTVA 1VLAA 1WH9A 4DUZC 1JOSA 3PBKA 4I9FA 4D57A 2Y27A 1J5EC 3FCCA 4DCSA 2D1RA 2VQEC 4X62C 2QVYX 4LF8C 2UUAC 1XRAA 5T8SA 5ADZA 4GS5A 4JI2C 4DR6C 4OYCA 4OXIA 5A19A 4LF6C 4U5YD 3GKUA 4LFCC 1N33C 1HH2P 4JI6C 2YCBA 2VZEA 2D28C 2ATWA 2JMPA 2F4VC 2BJOA 4DUYC 4DR1C 1XMOC 1GPMA 1MDFA 2QVZX 3DLPX 2ZM6C 3PESA 3DHVA 4BC9A 3E7XA 5AE2A 2UXCC 3GPCA 3A9UA 3G7SA 2WP0C 4LFAC 3JAMD 4R0MA 1T5DX 4DV4C 1LQLA 5BURA 1HR0C 4DCVA 4DV0C 4HPVA 2E0GA 1PA4A 4LF7C 2KZFA 1IBMC 3LNVA 1USPA 2VSQA 2QL8A 5T8TA 4DV5C 4K0BA 2OBVA 4X66C 1ULTA 5BR8C 4ISBA 3A4IA 5BSTA 3LUSA 5K8FA 4DR5C 3RG2A 3CJEA 4PHTA 4DCTA 3IMLA 3UOWA 1HNZC 3I07A 4GKJC 5GTDA 1USPB 3I08A 3R44A 3C5EA 4JV5C 1FJGC 4KTTA 4ZJZA 2HJGA 3NI2A 3RV2A 2OPLA 2CXCA 4B3TC 2QW0X 4LF9C 4DV6C 4JI5C 3IPLA 4DR3C 1RG9A 2UXDC 3AF5A 1YJ7A 4DG8A 2OPLB 4DR7C 4EATA 4RVNA 1N2FA 5KEIA 1N32C 1LCIA 4B3SC 1O92A 4RM2A 1MDBA 3A9VA 2XR1A 1PG3A 4D4GA 2V7BA 3UZ0A 4IR7A 4B3RC 3GR1A 2P2JA 3N54B 1I94C 2D7VA 4G1IA 5BUQA 3TDEA 4NXMC 4FTFA 4DV2C 2E7GA 5IT9D 4DCUA 3L8CA 5BSWA 4NDNA 5AE1A 3KXWA 5LMNC 4G36A 1WF3A 2PN2A 2E8FA 1BA3A 5CZVA 2YWBA 5IFIA 2VQFC 4BCAA 4WV3A 2D1QA 5CZXA 2DYJA 1XNQC 2OO4A 2P2FA 3CW9A 1P7LA 1AMUA 1HNXC 4FUQA 1MXAA 4MTNA 5AE3A 2E5LC 3OTOC 1O90A 3PROC 3SO4A 4D4IA 2Y4NA 2D1SA 3N2QA 4DV7C 4D56A 2P02A 4RM3A 3TQIA 1ZB8A 1NYEA 3DAYA 2P20A 4DR2C 1HNWC 3E7WA 4DV1C 1L2FA 1IBLC 3ETCA 1K0RA 1XMQC 5BSRA 1EGAA 3NYRA 1MD9A 4TPSB 3CW8X 4WS9A 3T1YC 4JI1C 1ZB9A 4X64C 5LMUC 1MKYA 4YHHC 4JI3C 3LAXA 3LGXA 1QM4A 3H2TA 2PT7G 4JI0C 1ML8A 4X65C 4JM1A 2BH1X 4LFBC 4OX9C 3J81D 1O9TA 2AYAA 3ETOA 1UKKA 1XRCA 1RY2A 4ZLPA 3VNQA 4AQYC 3EERA 4LE5A 4K0KC 4JI7C 3FCEA 4BSZA 2E8CA 4LF4C 4L2ZA 3VNSA 5K85A 4RMNA 2UXBC 1KKGA 4RLQA 4LF5C 4R1LA 3GR0A 4KHPC 4I9GA 4PZPA 4JI8C 5KYTA 5IWAC 5JRHA 4L4QA 2D27A 5H9UA 1QWIA 3NPDA 4XX2A 4GKKC 4IZ6A 2PROA 4NXNC 2YWCA 4B3MC 3IEUA 3R9XA 5DV9A 2P2MA 3NYQA 4FUTA 3IEVA 3J7AD 1O93A 4BC7A 3R9WA 5BSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 C;  3AF5 A;  2UXD C;  1L2F A;  1IBL C;  1K0R A;  4LF6 C;  3J80 D;  2ONF A;  1XMQ C;  3GKU A;  2OPL B;  4DR7 C;  1EGA A;  1N2F A;  4LFC C;  1N32 C;  3T1Y C;  1N33 C;  4JI1 C;  1HH2 P;  1N34 C;  4JI6 C;  2YCB A;  1ZB9 A;  1N36 C;  2ATW A;  4X64 C;  4B3S C;  5LMU C;  2JMP A;  2F4V C;  2BJO A;  1MKY A;  4DUY C;  4DV3 C;  5FLX D;  4DR1 C;  4YHH C;  1XMO C;  4JI3 C;  2ZM6 C;  2XR1 A;  2PT7 G;  4JI0 C;  4MH4 A;  1ML8 A;  4X65 C;  2UXC C;  4B3R C;  4LFB C;  4JI4 C;  2UUC C;  4OX9 C;  4LFA C;  3J81 D;  2E8E A;  3JAM D;  1I94 C;  2D7V A;  4DV4 C;  1LQL A;  1UKK A;  2ASB A;  4NXM C;  4AQY C;  4DV2 C;  3EER A;  4DCV A;  4DV0 C;  1HR0 C;  2E7G A;  1PA4 A;  5IT9 D;  4LF7 C;  2UU9 C;  4K0K C;  4DCU A;  4YY3 C;  4JI7 C;  2KZF A;  4BSZ A;  1IBM C;  5LMN C;  2E8C A;  2CY1 A;  1WF3 A;  1IBK C;  4LF4 C;  1USP A;  5A2Q D;  2QL8 A;  2PN2 A;  4DV5 C;  2E8F A;  2UXB C;  4NOZ A;  1KKG A;  4X66 C;  4JYA C;  4LF5 C;  5BR8 C;  2VQF C;  2EGT A;  2DYJ A;  3LUS A;  4KHP C;  4JI8 C;  1XNQ C;  3AF6 A;  4DR4 C;  5IWA C;  4DR5 C;  3T1H C;  3CJE A;  1QWI A;  2UUB C;  4DCT A;  1XNR C;  1HNZ C;  3I07 A;  1HNX C;  2HHH C;  4XX2 A;  4MTN A;  1VLA A;  4GKJ C;  1USP B;  2E5L C;  1WH9 A;  3OTO C;  1JOS A;  4DUZ C;  4GKK C;  4NXN C;  4JV5 C;  1FJG C;  4DV7 C;  1J5E C;  2HJG A;  4DCS A;  4B3M C;  3IEU A;  2VQE C;  3R9X A;  4X62 C;  2OPL A;  2CXC A;  4LF8 C;  4B3T C;  2UUA C;  1ZB8 A;  3IEV A;  1NYE A;  4LF9 C;  4DR2 C;  4DV6 C;  1HNW C;  3J7A D;  4JI2 C;  4JI5 C;  4DV1 C;  4DR3 C;  3R9W A; 
#chains in the Genus database with same CATH topology
 2Y4O A;  2D1T A;  5E7Q A;  3J80 D;  2ONF A;  5KYV A;  3L95 X;  3UX2 A;  1T5H X;  4L7I A;  1IB8 A;  4GXR A;  1N34 C;  4R1M A;  1N36 C;  3S82 A;  2M5H A;  4RVO A;  2QVX X;  4BBY A;  4DV3 C;  5FLX D;  3B7W A;  4RLF A;  2DPL A;  4PRO C;  1MXC A;  1XRB A;  3TUF A;  3VNR A;  4PUI A;  2WD9 A;  4MH4 A;  1V26 A;  5BSM A;  4JI4 C;  2UUC C;  2E8E A;  5BSV A;  4ODJ A;  2ASB A;  4GXQ A;  1MXB A;  5BUS A;  1V25 A;  2UU9 C;  4G37 A;  3AY0 A;  4YY3 C;  1VEH A;  2CY1 A;  1IBK C;  5A2Q D;  2P2B A;  5A1I A;  4NOZ A;  4DG9 A;  4JYA C;  2NCL A;  2EGT A;  2P2Q A;  1FUG A;  3EQ6 A;  4DR4 C;  3AF6 A;  1P4E C;  2JNV A;  3T1H C;  5LCI A;  2UUB C;  1XNR C;  3TR3 A;  5A1G A;  1XS3 A;  2HHH C;  1PG4 A;  4KTV A;  1VLA A;  1WH9 A;  4DUZ C;  1JOS A;  3PBK A;  4I9F A;  4D57 A;  2Y27 A;  1J5E C;  3FCC A;  4DCS A;  2D1R A;  2VQE C;  4X62 C;  2QVY X;  4LF8 C;  2UUA C;  1XRA A;  5T8S A;  5ADZ A;  4GS5 A;  4JI2 C;  4DR6 C;  4OYC A;  4OXI A;  2DHM A;  5A19 A;  4LF6 C;  4U5Y D;  3GKU A;  1UWD A;  4LFC C;  1N33 C;  1HH2 P;  4JI6 C;  2YCB A;  2VZE A;  2D28 C;  2ATW A;  2JMP A;  2F4V C;  2BJO A;  4DUY C;  4DR1 C;  1XMO C;  1GPM A;  1MDF A;  2QVZ X;  3DLP X;  2ZM6 C;  3PES A;  3DHV A;  4BC9 A;  3E7X A;  5AE2 A;  2UXC C;  3GPC A;  3A9U A;  3G7S A;  3CQ3 A;  2WP0 C;  4LFA C;  3JAM D;  4R0M A;  1T5D X;  4DV4 C;  1LQL A;  5BUR A;  1HR0 C;  4DCV A;  4DV0 C;  4HPV A;  2E0G A;  1PA4 A;  4LF7 C;  3LNO A;  2KZF A;  1IBM C;  3LNV A;  1USP A;  2VSQ A;  2QL8 A;  5T8T A;  4DV5 C;  4K0B A;  2OBV A;  4X66 C;  1ULT A;  5BR8 C;  4ISB A;  3A4I A;  5BST A;  3LUS A;  5K8F A;  4DR5 C;  3RG2 A;  2KDN A;  3CJE A;  4PHT A;  4DCT A;  3IML A;  3UOW A;  1HNZ C;  2ZZN A;  3I07 A;  4GKJ C;  5GTD A;  1USP B;  1FLO A;  3I08 A;  3K6R A;  3R44 A;  2ZZM A;  3C5E A;  4JV5 C;  1FJG C;  4KTT A;  4ZJZ A;  2HJG A;  3NI2 A;  3RV2 A;  2OPL A;  2CXC A;  1TH5 A;  4B3T C;  1P4E A;  2M5O A;  2QW0 X;  4LF9 C;  4DV6 C;  4JI5 C;  3IPL A;  4DR3 C;  1RG9 A;  2UXD C;  3AF5 A;  2MMA B;  1YJ7 A;  4DG8 A;  2Z51 A;  2OPL B;  4DR7 C;  4EAT A;  4RVN A;  1N2F A;  5KEI A;  1N32 C;  1LCI A;  4B3S C;  1O92 A;  4RM2 A;  1MDB A;  3A9V A;  2XR1 A;  1PG3 A;  4D4G A;  2V7B A;  3UZ0 A;  4IR7 A;  4B3R C;  3GR1 A;  2P2J A;  3N54 B;  1I94 C;  2D7V A;  4G1I A;  5BUQ A;  3TDE A;  4NXM C;  3CQ1 A;  4FTF A;  4DV2 C;  2MM9 A;  2E7G A;  3UX3 A;  5IT9 D;  4DCU A;  3L8C A;  5BSW A;  3O2E A;  4NDN A;  5AE1 A;  3KXW A;  5LMN C;  4G36 A;  1WF3 A;  2PN2 A;  2E8F A;  1BA3 A;  5CZV A;  2YWB A;  5IFI A;  2VQF C;  1V60 A;  4BCA A;  4WV3 A;  2D1Q A;  5CZX A;  2DYJ A;  1NY8 A;  1XNQ C;  2OO4 A;  2P2F A;  3CW9 A;  1P7L A;  1AMU A;  1HNX C;  4FUQ A;  2MCQ A;  1MXA A;  4MTN A;  5AE3 A;  1M6X C;  2E5L C;  3OTO C;  1O90 A;  3PRO C;  3SO4 A;  3A26 A;  4D4I A;  2Y4N A;  2D1S A;  3N2Q A;  4DV7 C;  4D56 A;  2P02 A;  2CU6 A;  4RM3 A;  3TQI A;  2YX1 A;  3FM7 A;  1ZB8 A;  1NYE A;  3DAY A;  2P20 A;  4DR2 C;  4PUG A;  1HNW C;  3E7W A;  4DV1 C;  1L2F A;  1IBL C;  3ETC A;  1K0R A;  1XMQ C;  1XHJ A;  5BSR A;  1EGA A;  3NYR A;  1MD9 A;  4TPS B;  3CW8 X;  4WS9 A;  3T1Y C;  4JI1 C;  1ZB9 A;  4X64 C;  5LMU C;  1MKY A;  3UEB A;  2ZTB A;  4YHH C;  4JI3 C;  3LAX A;  4PUH A;  3LGX A;  1QM4 A;  3H2T A;  2PT7 G;  4JI0 C;  1ML8 A;  4X65 C;  4JM1 A;  2BH1 X;  4LFB C;  4OX9 C;  3J81 D;  1O9T A;  2AYA A;  3ETO A;  1UKK A;  1XRC A;  4ZLP A;  1RY2 A;  3VNQ A;  4AQY C;  3EER A;  4LE5 A;  4K0K C;  2PG1 E;  4JI7 C;  3FCE A;  4BSZ A;  2E8C A;  4LF4 C;  4L2Z A;  3VNS A;  5K85 A;  3CQ2 A;  4RMN A;  2UXB C;  1KKG A;  4RLQ A;  4LF5 C;  2KZ0 A;  1XDX A;  4R1L A;  3GR0 A;  4KHP C;  4I9G A;  4PZP A;  4JI8 C;  1YGT A;  5KYT A;  5IWA C;  5JRH A;  4L4Q A;  2D27 A;  5H9U A;  1QWI A;  3NPD A;  4XX2 A;  4GKK C;  4IZ6 A;  2PRO A;  4NXN C;  2YWC A;  4B3M C;  3A25 A;  3IEU A;  3R9X A;  5DV9 A;  2P2M A;  3NYQ A;  4FUT A;  3IEV A;  1WCJ A;  3J7A D;  1O93 A;  4BC7 A;  1PU1 A;  1M6X A;  3R9W A;  5BSU A; 
#chains in the Genus database with same CATH homology
 2Y4O A;  2D1T A;  5E7Q A;  3J80 D;  2ONF A;  5KYV A;  3L95 X;  1T5H X;  4L7I A;  4GXR A;  1N34 C;  4R1M A;  1N36 C;  3S82 A;  4RVO A;  2QVX X;  4BBY A;  4DV3 C;  5FLX D;  3B7W A;  4RLF A;  2DPL A;  4PRO C;  1MXC A;  1XRB A;  3TUF A;  3VNR A;  2WD9 A;  4MH4 A;  1V26 A;  5BSM A;  4JI4 C;  2UUC C;  2E8E A;  5BSV A;  4ODJ A;  2ASB A;  4GXQ A;  1MXB A;  5BUS A;  1V25 A;  2UU9 C;  4G37 A;  4YY3 C;  2CY1 A;  1IBK C;  5A2Q D;  2P2B A;  5A1I A;  4NOZ A;  4DG9 A;  4JYA C;  2EGT A;  2P2Q A;  1FUG A;  3EQ6 A;  4DR4 C;  3AF6 A;  3T1H C;  2UUB C;  1XNR C;  5A1G A;  2HHH C;  1PG4 A;  4KTV A;  1VLA A;  1WH9 A;  4DUZ C;  1JOS A;  3PBK A;  4I9F A;  4D57 A;  2Y27 A;  1J5E C;  3FCC A;  4DCS A;  2D1R A;  2VQE C;  4X62 C;  2QVY X;  4LF8 C;  2UUA C;  1XRA A;  5T8S A;  5ADZ A;  4GS5 A;  4JI2 C;  4DR6 C;  4OYC A;  4OXI A;  5A19 A;  4LF6 C;  4U5Y D;  3GKU A;  4LFC C;  1N33 C;  1HH2 P;  4JI6 C;  2YCB A;  2VZE A;  2D28 C;  2ATW A;  2JMP A;  2F4V C;  2BJO A;  4DUY C;  4DR1 C;  1XMO C;  1GPM A;  1MDF A;  2QVZ X;  3DLP X;  2ZM6 C;  3PES A;  3DHV A;  4BC9 A;  3E7X A;  5AE2 A;  2UXC C;  3GPC A;  3A9U A;  3G7S A;  2WP0 C;  4LFA C;  3JAM D;  4R0M A;  1T5D X;  4DV4 C;  1LQL A;  5BUR A;  1HR0 C;  4DCV A;  4DV0 C;  4HPV A;  2E0G A;  1PA4 A;  4LF7 C;  2KZF A;  1IBM C;  3LNV A;  1USP A;  2VSQ A;  2QL8 A;  5T8T A;  4DV5 C;  4K0B A;  2OBV A;  4X66 C;  1ULT A;  5BR8 C;  4ISB A;  3A4I A;  5BST A;  3LUS A;  5K8F A;  4DR5 C;  3RG2 A;  3CJE A;  4PHT A;  4DCT A;  3IML A;  3UOW A;  1HNZ C;  3I07 A;  4GKJ C;  5GTD A;  1USP B;  3I08 A;  3R44 A;  3C5E A;  4JV5 C;  1FJG C;  4KTT A;  4ZJZ A;  2HJG A;  3NI2 A;  3RV2 A;  2OPL A;  2CXC A;  4B3T C;  2QW0 X;  4LF9 C;  4DV6 C;  4JI5 C;  3IPL A;  4DR3 C;  1RG9 A;  2UXD C;  3AF5 A;  1YJ7 A;  4DG8 A;  2OPL B;  4DR7 C;  4EAT A;  4RVN A;  1N2F A;  5KEI A;  1N32 C;  1LCI A;  4B3S C;  1O92 A;  4RM2 A;  1MDB A;  3A9V A;  2XR1 A;  1PG3 A;  4D4G A;  2V7B A;  3UZ0 A;  4IR7 A;  4B3R C;  3GR1 A;  2P2J A;  3N54 B;  1I94 C;  2D7V A;  4G1I A;  5BUQ A;  3TDE A;  4NXM C;  4FTF A;  4DV2 C;  2E7G A;  5IT9 D;  4DCU A;  3L8C A;  5BSW A;  4NDN A;  5AE1 A;  3KXW A;  5LMN C;  4G36 A;  1WF3 A;  2PN2 A;  2E8F A;  1BA3 A;  5CZV A;  2YWB A;  5IFI A;  2VQF C;  4BCA A;  4WV3 A;  2D1Q A;  5CZX A;  2DYJ A;  1XNQ C;  2OO4 A;  2P2F A;  3CW9 A;  1P7L A;  1AMU A;  1HNX C;  4FUQ A;  1MXA A;  4MTN A;  5AE3 A;  2E5L C;  3OTO C;  1O90 A;  3PRO C;  3SO4 A;  4D4I A;  2Y4N A;  2D1S A;  3N2Q A;  4DV7 C;  4D56 A;  2P02 A;  4RM3 A;  3TQI A;  1ZB8 A;  1NYE A;  3DAY A;  2P20 A;  4DR2 C;  1HNW C;  3E7W A;  4DV1 C;  1L2F A;  1IBL C;  3ETC A;  1K0R A;  1XMQ C;  5BSR A;  1EGA A;  3NYR A;  1MD9 A;  4TPS B;  3CW8 X;  4WS9 A;  3T1Y C;  4JI1 C;  1ZB9 A;  4X64 C;  5LMU C;  1MKY A;  4YHH C;  4JI3 C;  3LAX A;  3LGX A;  1QM4 A;  3H2T A;  2PT7 G;  4JI0 C;  1ML8 A;  4X65 C;  4JM1 A;  2BH1 X;  4LFB C;  4OX9 C;  3J81 D;  1O9T A;  2AYA A;  3ETO A;  1UKK A;  1XRC A;  1RY2 A;  4ZLP A;  3VNQ A;  4AQY C;  3EER A;  4LE5 A;  4K0K C;  4JI7 C;  3FCE A;  4BSZ A;  2E8C A;  4LF4 C;  4L2Z A;  3VNS A;  5K85 A;  4RMN A;  2UXB C;  1KKG A;  4RLQ A;  4LF5 C;  4R1L A;  3GR0 A;  4KHP C;  4I9G A;  4PZP A;  4JI8 C;  5KYT A;  5IWA C;  5JRH A;  4L4Q A;  2D27 A;  5H9U A;  1QWI A;  3NPD A;  4XX2 A;  4GKK C;  4IZ6 A;  2PRO A;  4NXN C;  2YWC A;  4B3M C;  3IEU A;  3R9X A;  5DV9 A;  2P2M A;  3NYQ A;  4FUT A;  3IEV A;  3J7A D;  1O93 A;  4BC7 A;  3R9W A;  5BSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...