4DR2C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 52
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr2C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr2C02
4DR6C 4DV1C 4JV5C 4LF5C 4DCTA 4DV2C 2E5LC 2UXCC 4X66C 2VQEC 1XMOC 4DR5C 4B3MC 1QWIA 1FJGC 4JI2C 4LF4C 2UXBC 1N34C 2E8EA 3AF5A 4NXNC 1USPA 4DR7C 3CJEA 2CXCA 4LF7C 4DV7C 1N32C 4DV3C 2QL8A 4JI5C 4LFBC 1HNZC 3R9XA 5LMUC 1MKYA 4DUZC 1XNRC 4AQYC 1HH2P 2UU9C 4LF9C 4DV0C 1IBMC 4DV4C 4LFAC 2OPLA 4GKJC 5IT9D 4NXMC 4JI7C 2UXDC 1USPB 1WH9A 3J81D 3T1HC 5IWAC 5BR8C 4NOZA 2PT7G 2VQFC 1IBKC 1L2FA 1EGAA 4LF6C 4DUYC 4DV6C 1IBLC 2CY1A 4LF8C 2JMPA 1HNWC 3IEVA 4B3RC 4JI8C 1XNQC 4DCSA 4X62C 3R9WA 3J7AD 1XMQC 2HHHC 3IEUA 4K0KC 1ZB8A 2DYJA 4JI3C 1K0RA 4LFCC 4MTNA 1WF3A 2E8FA 1PA4A 4B3TC 3EERA 5FLXD 5A2QD 2E8CA 2E7GA 1ML8A 1JOSA 3LUSA 1NYEA 2UUCC 2EGTA 2UUBC 4OX9C 2ZM6C 4DR1C 2ONFA 2PN2A 4BSZA 4DR2C 3J80D 3JAMD 4B3SC 1KKGA 2KZFA 3T1YC 2F4VC 4DCVA 1UKKA 2D7VA 1I94C 1VLAA 2XR1A 4JI4C 1N2FA 4JI0C 2BJOA 2OPLB 4YY3C 4DV5C 2HJGA 3I07A 4DR3C 1N36C 1HNXC 4DR4C 4JI1C 4MH4A 1N33C 4JYAC 3GKUA 2UUAC 4GKKC 4KHPC 4YHHC 4DCUA 1J5EC 2ATWA 2ASBA 5LMNC 4JI6C 3OTOC 4X64C 2YCBA 3AF6A 4XX2A 4X65C 1ZB9A 1HR0C 1LQLA
chains in the Genus database with same CATH superfamily
3AY0A 5E7QA 1P4EC 4DCTA 4DV2C 4X66C 2VQEC 4U5YD 1XMOC 4DR5C 4ZJZA 1VEHA 3GPCA 2UXBC 1XRCA 4BBYA 3L8CA 3AF5A 2D1QA 4DG8A 5A1GA 3SO4A 4LF7C 4RVOA 1N32C 1RY2A 5BSMA 5GTDA 1MKYA 4L7IA 4DUZC 4NDNA 1HH2P 2UU9C 5JRHA 2M5OA 3CQ1A 3DAYA 3TDEA 4NXMC 3K6RA 4PROC 3UEBA 1LCIA 3T1HC 4NOZA 2PT7G 5IFIA 2P2FA 3A25A 4GS5A 5CZVA 4DV6C 4TPSB 4RLFA 4BC9A 4K0KC 2WD9A 4LFCC 4MTNA 4KTVA 4GXQA 2E8FA 3EQ6A 5A1IA 5FLXD 2E8CA 2E7GA 1YJ7A 3LUSA 5BUSA 1XHJA 2EGTA 2PROA 4BCAA 3ETOA 4OX9C 4PUHA 2PN2A 3CW8X 3GR0A 1KKGA 1UKKA 1PG3A 2XR1A 1HNXC 2BJOA 2OPLB 4DV5C 3DHVA 4DR3C 4D57A 4DR4C 4YHHC 2ASBA 5LMNC 4X64C 4X65C 1ZB9A 1HR0C 4LF8C 3E7WA 1YGTA 3PBKA 4EATA 4JV5C 1XDXA 4ISBA 4DG9A 3IPLA 3NYRA 1XS3A 3ETCA 4JI2C 3NYQA 2E8EA 1USPA 5BSRA 2CXCA 2OBVA 3UZ0A 3E7XA 4FTFA 2QL8A 4JI5C 5AE3A 5LMUC 4D56A 1XNRC 4LF9C 2D27A 3A9UA 3DLPX 4I9FA 4GKJC 2UXDC 2OO4A 3J81D 2QVZX 3FCCA 5BUQA 4L4QA 1PG4A 5BURA 4GXRA 1T5HX 1GPMA 1HNWC 4B3RC 1XNQC 2AYAA 2P2MA 4R1LA 3J7AD 1XMQC 2P2JA 2HHHC 2DYJA 4JI3C 1XRAA 3FCEA 4WV3A 4B3TC 3N54B 3O2EA 5DV9A 2QW0X 2QVXX 1ML8A 2MCQA 4FUQA 2UUBC 2M5HA 4LE5A 4HPVA 4BSZA 1WCJA 3J80D 2ZZMA 1V26A 3T1YC 3LNVA 4DCVA 2D7VA 4RLQA 1VLAA 1N2FA 4JI0C 2QVYX 2HJGA 3PESA 4IR7A 3S82A 2YWCA 5AE1A 1N33C 4G36A 4JYAC 3VNQA 5AE2A 4DCUA 1J5EC 3TQIA 2YWBA 1FUGA 1UWDA 2P02A 2Y4OA 1BA3A 1LQLA 4DV1C 4RVNA 4D4IA 2E5LC 1O9TA 4B3MC 2D1TA 2E0GA 4G37A 5K8FA 4NXNC 4DR7C 3CJEA 4L2ZA 3B7WA 5H9UA 4DV3C 1QM4A 5LCIA 1RG9A 1HNZC 5KEIA 5BSUA 2KZ0A 2VZEA 1IBMC 4RMNA 4DV4C 4LFAC 2OPLA 1MXBA 1USPB 3I08A 5IWAC 5BR8C 2VQFC 1IBKC 1MD9A 1O90A 1L2FA 1O92A 3UOWA 4RM2A 4DUYC 2CY1A 2D28C 2V7BA 2JMPA 3IEVA 1M6XA 4JI8C 1T5DX 3IEUA 1ZB8A 2JNVA 5CZXA 2P2BA 3EERA 2Y27A 3UX3A 1JOSA 4D4GA 4ZLPA 2P2QA 2ZM6C 3NI2A 2Z51A 5BSVA 4DR1C 1FLOA 2ONFA 4G1IA 4DR2C 3N2QA 1O93A 3PROC 2KZFA 2F4VC 1P4EA 1I94C 5T8SA 3RV2A 5T8TA 1AMUA 2D1RA 4RM3A 3VNSA 2UUAC 5BSWA 4JI6C 2WP0C 1P7LA 3AF6A 3KXWA 5A19A 1IB8A 2VSQA 1N34C 3R9XA 1TH5A 3TUFA 4DR6C 3CQ2A 1NY8A 5KYVA 4LF5C 2UXCC 3VNRA 3C5EA 1QWIA 1FJGC 4LF4C 4R1MA 4PUIA 2D1SA 3RG2A 5BSTA 3LGXA 2ZTBA 3FM7A 2DPLA 3NPDA 4DV7C 5K85A 3IMLA 4BC7A 2P20A 4LFBC 3R44A 4JM1A 4AQYC 4PHTA 4IZ6A 4KTTA 4DV0C 3LAXA 5IT9D 1MXCA 1MXAA 2ZZNA 3A26A 1ULTA 4JI7C 1WH9A 3TR3A 3A9VA 3UX2A 2PG1E 5KYTA 1EGAA 4LF6C 1IBLC 2KDNA 2CU6A 4DCSA 4ODJA 4X62C 3LNOA 3R9WA 4WS9A 1K0RA 2NCLA 1WF3A 2MMAB 1PA4A 5A2QD 4R0MA 3G7SA 4K0BA 3A4IA 1NYEA 2UUCC 2BH1X 2Y4NA 2MM9A 1MDBA 1M6XC 3H2TA 3JAMD 4B3SC 4I9GA 4OYCA 1MDFA 3CW9A 1V25A 4JI4C 2DHMA 3L95X 4YY3C 1N36C 1XRBA 3I07A 3CQ3A 4OXIA 3GR1A 4JI1C 4MH4A 1V60A 3GKUA 4GKKC 4KHPC 4FUTA 2ATWA 2YX1A 4PUGA 1PU1A 3OTOC 2YCBA 4XX2A 4PZPA 5ADZA
chains in the Genus database with same CATH topology
5E7QA 4DCTA 4DV2C 4X66C 2VQEC 4U5YD 1XMOC 4DR5C 4ZJZA 3GPCA 2UXBC 1XRCA 4BBYA 3L8CA 3AF5A 2D1QA 4DG8A 5A1GA 3SO4A 4LF7C 4RVOA 1N32C 1RY2A 5BSMA 5GTDA 1MKYA 4L7IA 4DUZC 4NDNA 1HH2P 2UU9C 5JRHA 3DAYA 3TDEA 4NXMC 4PROC 3T1HC 1LCIA 4NOZA 2PT7G 5IFIA 2P2FA 4GS5A 5CZVA 4DV6C 4TPSB 4RLFA 4BC9A 4K0KC 2WD9A 4LFCC 4MTNA 4KTVA 4GXQA 2E8FA 3EQ6A 5A1IA 5FLXD 2E8CA 2E7GA 1YJ7A 3LUSA 5BUSA 2EGTA 2PROA 4BCAA 3ETOA 4OX9C 2PN2A 3CW8X 3GR0A 1KKGA 1UKKA 1PG3A 2XR1A 1HNXC 2BJOA 2OPLB 4DV5C 3DHVA 4DR3C 4D57A 4DR4C 4YHHC 2ASBA 5LMNC 4X64C 4X65C 1ZB9A 1HR0C 4LF8C 3E7WA 3PBKA 4EATA 4JV5C 4ISBA 4DG9A 3IPLA 3NYRA 3ETCA 4JI2C 3NYQA 2E8EA 1USPA 5BSRA 2CXCA 2OBVA 3UZ0A 3E7XA 4FTFA 2QL8A 4JI5C 5AE3A 5LMUC 4D56A 1XNRC 4LF9C 2D27A 3A9UA 3DLPX 4I9FA 4GKJC 2UXDC 2OO4A 3J81D 2QVZX 3FCCA 5BUQA 4L4QA 1PG4A 5BURA 4GXRA 1T5HX 1GPMA 1HNWC 4B3RC 1XNQC 2AYAA 2P2MA 4R1LA 3J7AD 1XMQC 2P2JA 2HHHC 2DYJA 4JI3C 1XRAA 3FCEA 4WV3A 4B3TC 3N54B 5DV9A 2QW0X 2QVXX 1ML8A 4FUQA 2UUBC 4LE5A 4HPVA 4BSZA 3J80D 3T1YC 1V26A 3LNVA 4DCVA 2D7VA 4RLQA 1VLAA 1N2FA 4JI0C 2QVYX 2HJGA 3PESA 4IR7A 3S82A 2YWCA 5AE1A 1N33C 4G36A 4JYAC 3VNQA 5AE2A 4DCUA 1J5EC 3TQIA 2YWBA 1FUGA 2P02A 2Y4OA 1BA3A 1LQLA 4DV1C 4RVNA 4D4IA 2E5LC 1O9TA 4B3MC 2D1TA 2E0GA 4G37A 5K8FA 4NXNC 4DR7C 3CJEA 4L2ZA 3B7WA 5H9UA 4DV3C 1QM4A 1RG9A 1HNZC 5KEIA 5BSUA 2VZEA 1IBMC 4RMNA 4DV4C 4LFAC 2OPLA 1MXBA 1USPB 3I08A 5IWAC 5BR8C 2VQFC 1IBKC 1MD9A 1O90A 1L2FA 1O92A 3UOWA 4RM2A 4DUYC 2CY1A 2D28C 2V7BA 2JMPA 3IEVA 4JI8C 1T5DX 3IEUA 1ZB8A 5CZXA 2P2BA 3EERA 2Y27A 1JOSA 4D4GA 4ZLPA 2P2QA 2ZM6C 3NI2A 5BSVA 4DR1C 2ONFA 4G1IA 4DR2C 3N2QA 1O93A 3PROC 2KZFA 2F4VC 1I94C 5T8SA 3RV2A 5T8TA 1AMUA 2D1RA 4RM3A 3VNSA 2UUAC 5BSWA 4JI6C 2WP0C 1P7LA 3AF6A 3KXWA 5A19A 2VSQA 1N34C 3R9XA 3TUFA 4DR6C 5KYVA 4LF5C 2UXCC 3VNRA 3C5EA 1QWIA 1FJGC 4LF4C 4R1MA 2D1SA 3RG2A 5BSTA 3LGXA 2DPLA 3NPDA 4DV7C 5K85A 3IMLA 4BC7A 2P20A 4LFBC 3R44A 4JM1A 4AQYC 4PHTA 4IZ6A 4KTTA 4DV0C 3LAXA 5IT9D 1MXCA 1MXAA 1ULTA 4JI7C 1WH9A 3A9VA 5KYTA 1EGAA 4LF6C 1IBLC 4DCSA 4ODJA 4X62C 3R9WA 4WS9A 1K0RA 1WF3A 1PA4A 5A2QD 4R0MA 3G7SA 4K0BA 3A4IA 1NYEA 2UUCC 2BH1X 2Y4NA 1MDBA 3H2TA 3JAMD 4B3SC 4I9GA 4OYCA 1MDFA 3CW9A 1V25A 4JI4C 3L95X 4YY3C 1N36C 1XRBA 3I07A 4OXIA 3GR1A 4JI1C 4MH4A 3GKUA 4GKKC 4KHPC 4FUTA 2ATWA 3OTOC 2YCBA 4XX2A 4PZPA 5ADZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 C;  4DV1 C;  4JV5 C;  4LF5 C;  4DCT A;  4DV2 C;  2E5L C;  2UXC C;  4X66 C;  2VQE C;  1XMO C;  4DR5 C;  4B3M C;  1QWI A;  1FJG C;  4JI2 C;  4LF4 C;  2UXB C;  1N34 C;  2E8E A;  3AF5 A;  4NXN C;  1USP A;  4DR7 C;  3CJE A;  2CXC A;  4LF7 C;  4DV7 C;  1N32 C;  4DV3 C;  2QL8 A;  4JI5 C;  4LFB C;  1HNZ C;  3R9X A;  5LMU C;  1MKY A;  4DUZ C;  1XNR C;  4AQY C;  1HH2 P;  2UU9 C;  4LF9 C;  4DV0 C;  1IBM C;  4DV4 C;  4LFA C;  2OPL A;  4GKJ C;  5IT9 D;  4NXM C;  4JI7 C;  2UXD C;  1USP B;  1WH9 A;  3J81 D;  3T1H C;  5IWA C;  5BR8 C;  4NOZ A;  2PT7 G;  2VQF C;  1IBK C;  1L2F A;  1EGA A;  4LF6 C;  4DUY C;  4DV6 C;  1IBL C;  2CY1 A;  4LF8 C;  2JMP A;  1HNW C;  3IEV A;  4B3R C;  4JI8 C;  1XNQ C;  4DCS A;  4X62 C;  3R9W A;  3J7A D;  1XMQ C;  2HHH C;  3IEU A;  4K0K C;  1ZB8 A;  2DYJ A;  4JI3 C;  1K0R A;  4LFC C;  4MTN A;  1WF3 A;  2E8F A;  1PA4 A;  4B3T C;  3EER A;  5FLX D;  5A2Q D;  2E8C A;  2E7G A;  1ML8 A;  1JOS A;  3LUS A;  1NYE A;  2UUC C;  2EGT A;  2UUB C;  4OX9 C;  2ZM6 C;  4DR1 C;  2ONF A;  2PN2 A;  4BSZ A;  4DR2 C;  3J80 D;  3JAM D;  4B3S C;  1KKG A;  2KZF A;  3T1Y C;  2F4V C;  4DCV A;  1UKK A;  2D7V A;  1I94 C;  1VLA A;  2XR1 A;  4JI4 C;  1N2F A;  4JI0 C;  2BJO A;  2OPL B;  4YY3 C;  4DV5 C;  2HJG A;  3I07 A;  4DR3 C;  1N36 C;  1HNX C;  4DR4 C;  4JI1 C;  4MH4 A;  1N33 C;  4JYA C;  3GKU A;  2UUA C;  4GKK C;  4KHP C;  4YHH C;  4DCU A;  1J5E C;  2ATW A;  2ASB A;  5LMN C;  4JI6 C;  3OTO C;  4X64 C;  2YCB A;  3AF6 A;  4XX2 A;  4X65 C;  1ZB9 A;  1HR0 C;  1LQL A; 
#chains in the Genus database with same CATH topology
 3AY0 A;  5E7Q A;  1P4E C;  4DCT A;  4DV2 C;  4X66 C;  2VQE C;  4U5Y D;  1XMO C;  4DR5 C;  4ZJZ A;  1VEH A;  3GPC A;  2UXB C;  1XRC A;  4BBY A;  3L8C A;  3AF5 A;  2D1Q A;  4DG8 A;  5A1G A;  3SO4 A;  4LF7 C;  4RVO A;  1N32 C;  1RY2 A;  5BSM A;  5GTD A;  1MKY A;  4L7I A;  4DUZ C;  4NDN A;  1HH2 P;  2UU9 C;  5JRH A;  2M5O A;  3CQ1 A;  3DAY A;  3TDE A;  4NXM C;  3K6R A;  4PRO C;  3UEB A;  1LCI A;  3T1H C;  4NOZ A;  2PT7 G;  5IFI A;  2P2F A;  3A25 A;  4GS5 A;  5CZV A;  4DV6 C;  4TPS B;  4RLF A;  4BC9 A;  4K0K C;  2WD9 A;  4LFC C;  4MTN A;  4KTV A;  4GXQ A;  2E8F A;  3EQ6 A;  5A1I A;  5FLX D;  2E8C A;  2E7G A;  1YJ7 A;  3LUS A;  5BUS A;  1XHJ A;  2EGT A;  2PRO A;  4BCA A;  3ETO A;  4OX9 C;  4PUH A;  2PN2 A;  3CW8 X;  3GR0 A;  1KKG A;  1UKK A;  1PG3 A;  2XR1 A;  1HNX C;  2BJO A;  2OPL B;  4DV5 C;  3DHV A;  4DR3 C;  4D57 A;  4DR4 C;  4YHH C;  2ASB A;  5LMN C;  4X64 C;  4X65 C;  1ZB9 A;  1HR0 C;  4LF8 C;  3E7W A;  1YGT A;  3PBK A;  4EAT A;  4JV5 C;  1XDX A;  4ISB A;  4DG9 A;  3IPL A;  3NYR A;  1XS3 A;  3ETC A;  4JI2 C;  3NYQ A;  2E8E A;  1USP A;  5BSR A;  2CXC A;  2OBV A;  3UZ0 A;  3E7X A;  4FTF A;  2QL8 A;  4JI5 C;  5AE3 A;  5LMU C;  4D56 A;  1XNR C;  4LF9 C;  2D27 A;  3A9U A;  3DLP X;  4I9F A;  4GKJ C;  2UXD C;  2OO4 A;  3J81 D;  2QVZ X;  3FCC A;  5BUQ A;  4L4Q A;  1PG4 A;  5BUR A;  4GXR A;  1T5H X;  1GPM A;  1HNW C;  4B3R C;  1XNQ C;  2AYA A;  2P2M A;  4R1L A;  3J7A D;  1XMQ C;  2P2J A;  2HHH C;  2DYJ A;  4JI3 C;  1XRA A;  3FCE A;  4WV3 A;  4B3T C;  3N54 B;  3O2E A;  5DV9 A;  2QW0 X;  2QVX X;  1ML8 A;  2MCQ A;  4FUQ A;  2UUB C;  2M5H A;  4LE5 A;  4HPV A;  4BSZ A;  1WCJ A;  3J80 D;  2ZZM A;  1V26 A;  3T1Y C;  3LNV A;  4DCV A;  2D7V A;  4RLQ A;  1VLA A;  1N2F A;  4JI0 C;  2QVY X;  2HJG A;  3PES A;  4IR7 A;  3S82 A;  2YWC A;  5AE1 A;  1N33 C;  4G36 A;  4JYA C;  3VNQ A;  5AE2 A;  4DCU A;  1J5E C;  3TQI A;  2YWB A;  1FUG A;  1UWD A;  2P02 A;  2Y4O A;  1BA3 A;  1LQL A;  4DV1 C;  4RVN A;  4D4I A;  2E5L C;  1O9T A;  4B3M C;  2D1T A;  2E0G A;  4G37 A;  5K8F A;  4NXN C;  4DR7 C;  3CJE A;  4L2Z A;  3B7W A;  5H9U A;  4DV3 C;  1QM4 A;  5LCI A;  1RG9 A;  1HNZ C;  5KEI A;  5BSU A;  2KZ0 A;  2VZE A;  1IBM C;  4RMN A;  4DV4 C;  4LFA C;  2OPL A;  1MXB A;  1USP B;  3I08 A;  5IWA C;  5BR8 C;  2VQF C;  1IBK C;  1MD9 A;  1O90 A;  1L2F A;  1O92 A;  3UOW A;  4RM2 A;  4DUY C;  2CY1 A;  2D28 C;  2V7B A;  2JMP A;  3IEV A;  1M6X A;  4JI8 C;  1T5D X;  3IEU A;  1ZB8 A;  2JNV A;  5CZX A;  2P2B A;  3EER A;  2Y27 A;  3UX3 A;  1JOS A;  4D4G A;  4ZLP A;  2P2Q A;  2ZM6 C;  3NI2 A;  2Z51 A;  5BSV A;  4DR1 C;  1FLO A;  2ONF A;  4G1I A;  4DR2 C;  3N2Q A;  1O93 A;  3PRO C;  2KZF A;  2F4V C;  1P4E A;  1I94 C;  5T8S A;  3RV2 A;  5T8T A;  1AMU A;  2D1R A;  4RM3 A;  3VNS A;  2UUA C;  5BSW A;  4JI6 C;  2WP0 C;  1P7L A;  3AF6 A;  3KXW A;  5A19 A;  1IB8 A;  2VSQ A;  1N34 C;  3R9X A;  1TH5 A;  3TUF A;  4DR6 C;  3CQ2 A;  1NY8 A;  5KYV A;  4LF5 C;  2UXC C;  3VNR A;  3C5E A;  1QWI A;  1FJG C;  4LF4 C;  4R1M A;  4PUI A;  2D1S A;  3RG2 A;  5BST A;  3LGX A;  2ZTB A;  3FM7 A;  2DPL A;  3NPD A;  4DV7 C;  5K85 A;  3IML A;  4BC7 A;  2P20 A;  4LFB C;  3R44 A;  4JM1 A;  4AQY C;  4PHT A;  4IZ6 A;  4KTT A;  4DV0 C;  3LAX A;  5IT9 D;  1MXC A;  1MXA A;  2ZZN A;  3A26 A;  1ULT A;  4JI7 C;  1WH9 A;  3TR3 A;  3A9V A;  3UX2 A;  2PG1 E;  5KYT A;  1EGA A;  4LF6 C;  1IBL C;  2KDN A;  2CU6 A;  4DCS A;  4ODJ A;  4X62 C;  3LNO A;  3R9W A;  4WS9 A;  1K0R A;  2NCL A;  1WF3 A;  2MMA B;  1PA4 A;  5A2Q D;  4R0M A;  3G7S A;  4K0B A;  3A4I A;  1NYE A;  2UUC C;  2BH1 X;  2Y4N A;  2MM9 A;  1MDB A;  1M6X C;  3H2T A;  3JAM D;  4B3S C;  4I9G A;  4OYC A;  1MDF A;  3CW9 A;  1V25 A;  4JI4 C;  2DHM A;  3L95 X;  4YY3 C;  1N36 C;  1XRB A;  3I07 A;  3CQ3 A;  4OXI A;  3GR1 A;  4JI1 C;  4MH4 A;  1V60 A;  3GKU A;  4GKK C;  4KHP C;  4FUT A;  2ATW A;  2YX1 A;  4PUG A;  1PU1 A;  3OTO C;  2YCB A;  4XX2 A;  4PZP A;  5ADZ A; 
#chains in the Genus database with same CATH homology
 5E7Q A;  4DCT A;  4DV2 C;  4X66 C;  2VQE C;  4U5Y D;  1XMO C;  4DR5 C;  4ZJZ A;  3GPC A;  2UXB C;  1XRC A;  4BBY A;  3L8C A;  3AF5 A;  2D1Q A;  4DG8 A;  5A1G A;  3SO4 A;  4LF7 C;  4RVO A;  1N32 C;  1RY2 A;  5BSM A;  5GTD A;  1MKY A;  4L7I A;  4DUZ C;  4NDN A;  1HH2 P;  2UU9 C;  5JRH A;  3DAY A;  3TDE A;  4NXM C;  4PRO C;  3T1H C;  1LCI A;  4NOZ A;  2PT7 G;  5IFI A;  2P2F A;  4GS5 A;  5CZV A;  4DV6 C;  4TPS B;  4RLF A;  4BC9 A;  4K0K C;  2WD9 A;  4LFC C;  4MTN A;  4KTV A;  4GXQ A;  2E8F A;  3EQ6 A;  5A1I A;  5FLX D;  2E8C A;  2E7G A;  1YJ7 A;  3LUS A;  5BUS A;  2EGT A;  2PRO A;  4BCA A;  3ETO A;  4OX9 C;  2PN2 A;  3CW8 X;  3GR0 A;  1KKG A;  1UKK A;  1PG3 A;  2XR1 A;  1HNX C;  2BJO A;  2OPL B;  4DV5 C;  3DHV A;  4DR3 C;  4D57 A;  4DR4 C;  4YHH C;  2ASB A;  5LMN C;  4X64 C;  4X65 C;  1ZB9 A;  1HR0 C;  4LF8 C;  3E7W A;  3PBK A;  4EAT A;  4JV5 C;  4ISB A;  4DG9 A;  3IPL A;  3NYR A;  3ETC A;  4JI2 C;  3NYQ A;  2E8E A;  1USP A;  5BSR A;  2CXC A;  2OBV A;  3UZ0 A;  3E7X A;  4FTF A;  2QL8 A;  4JI5 C;  5AE3 A;  5LMU C;  4D56 A;  1XNR C;  4LF9 C;  2D27 A;  3A9U A;  3DLP X;  4I9F A;  4GKJ C;  2UXD C;  2OO4 A;  3J81 D;  2QVZ X;  3FCC A;  5BUQ A;  4L4Q A;  1PG4 A;  5BUR A;  4GXR A;  1T5H X;  1GPM A;  1HNW C;  4B3R C;  1XNQ C;  2AYA A;  2P2M A;  4R1L A;  3J7A D;  1XMQ C;  2P2J A;  2HHH C;  2DYJ A;  4JI3 C;  1XRA A;  3FCE A;  4WV3 A;  4B3T C;  3N54 B;  5DV9 A;  2QW0 X;  2QVX X;  1ML8 A;  4FUQ A;  2UUB C;  4LE5 A;  4HPV A;  4BSZ A;  3J80 D;  3T1Y C;  1V26 A;  3LNV A;  4DCV A;  2D7V A;  4RLQ A;  1VLA A;  1N2F A;  4JI0 C;  2QVY X;  2HJG A;  3PES A;  4IR7 A;  3S82 A;  2YWC A;  5AE1 A;  1N33 C;  4G36 A;  4JYA C;  3VNQ A;  5AE2 A;  4DCU A;  1J5E C;  3TQI A;  2YWB A;  1FUG A;  2P02 A;  2Y4O A;  1BA3 A;  1LQL A;  4DV1 C;  4RVN A;  4D4I A;  2E5L C;  1O9T A;  4B3M C;  2D1T A;  2E0G A;  4G37 A;  5K8F A;  4NXN C;  4DR7 C;  3CJE A;  4L2Z A;  3B7W A;  5H9U A;  4DV3 C;  1QM4 A;  1RG9 A;  1HNZ C;  5KEI A;  5BSU A;  2VZE A;  1IBM C;  4RMN A;  4DV4 C;  4LFA C;  2OPL A;  1MXB A;  1USP B;  3I08 A;  5IWA C;  5BR8 C;  2VQF C;  1IBK C;  1MD9 A;  1O90 A;  1L2F A;  1O92 A;  3UOW A;  4RM2 A;  4DUY C;  2CY1 A;  2D28 C;  2V7B A;  2JMP A;  3IEV A;  4JI8 C;  1T5D X;  3IEU A;  1ZB8 A;  5CZX A;  2P2B A;  3EER A;  2Y27 A;  1JOS A;  4D4G A;  4ZLP A;  2P2Q A;  2ZM6 C;  3NI2 A;  5BSV A;  4DR1 C;  2ONF A;  4G1I A;  4DR2 C;  3N2Q A;  1O93 A;  3PRO C;  2KZF A;  2F4V C;  1I94 C;  5T8S A;  3RV2 A;  5T8T A;  1AMU A;  2D1R A;  4RM3 A;  3VNS A;  2UUA C;  5BSW A;  4JI6 C;  2WP0 C;  1P7L A;  3AF6 A;  3KXW A;  5A19 A;  2VSQ A;  1N34 C;  3R9X A;  3TUF A;  4DR6 C;  5KYV A;  4LF5 C;  2UXC C;  3VNR A;  3C5E A;  1QWI A;  1FJG C;  4LF4 C;  4R1M A;  2D1S A;  3RG2 A;  5BST A;  3LGX A;  2DPL A;  3NPD A;  4DV7 C;  5K85 A;  3IML A;  4BC7 A;  2P20 A;  4LFB C;  3R44 A;  4JM1 A;  4AQY C;  4PHT A;  4IZ6 A;  4KTT A;  4DV0 C;  3LAX A;  5IT9 D;  1MXC A;  1MXA A;  1ULT A;  4JI7 C;  1WH9 A;  3A9V A;  5KYT A;  1EGA A;  4LF6 C;  1IBL C;  4DCS A;  4ODJ A;  4X62 C;  3R9W A;  4WS9 A;  1K0R A;  1WF3 A;  1PA4 A;  5A2Q D;  4R0M A;  3G7S A;  4K0B A;  3A4I A;  1NYE A;  2UUC C;  2BH1 X;  2Y4N A;  1MDB A;  3H2T A;  3JAM D;  4B3S C;  4I9G A;  4OYC A;  1MDF A;  3CW9 A;  1V25 A;  4JI4 C;  3L95 X;  4YY3 C;  1N36 C;  1XRB A;  3I07 A;  4OXI A;  3GR1 A;  4JI1 C;  4MH4 A;  3GKU A;  4GKK C;  4KHP C;  4FUT A;  2ATW A;  3OTO C;  2YCB A;  4XX2 A;  4PZP A;  5ADZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...