4DR7C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 49
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr7C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr7C02
3OTOC 1ML8A 4JI2C 4JYAC 2ATWA 4JI4C 2CY1A 4B3MC 4NXNC 4OX9C 1USPB 1N36C 4DCVA 1I94C 2E5LC 4K0KC 2OPLA 1HNZC 2JMPA 3GKUA 5FLXD 1VLAA 4LFAC 1JOSA 4YHHC 1XMOC 3R9XA 2UUBC 2YCBA 2VQEC 2BJOA 4DCTA 4JI5C 3AF6A 1N2FA 1L2FA 4B3RC 3CJEA 4LF8C 2E8FA 4JI1C 2QL8A 2HHHC 1WH9A 3AF5A 2CXCA 4DR2C 2EGTA 1HNXC 5IT9D 2ASBA 4JI8C 1EGAA 4DV1C 4DR5C 4DR3C 5LMUC 1HH2P 4LF7C 1K0RA 4DUYC 4LFBC 4KHPC 2UU9C 2E7GA 1XMQC 2UXDC 4DV5C 4JI0C 5LMNC 1MKYA 4LF6C 4GKKC 1KKGA 1N33C 3I07A 1QWIA 4DR1C 1N32C 2KZFA 1ZB9A 1NYEA 4LF9C 2UUCC 2UXBC 4MTNA 2E8CA 3JAMD 1J5EC 4LFCC 5IWAC 4NXMC 4DR7C 4X65C 4JI6C 1ZB8A 4DV6C 4B3TC 4DR4C 4JI7C 4NOZA 3J81D 4GKJC 4YY3C 1LQLA 1FJGC 4XX2A 2ONFA 4B3SC 4X62C 1IBLC 4BSZA 4JI3C 1IBKC 2HJGA 1HNWC 3IEUA 4X66C 4DCSA 4DV7C 4AQYC 2UUAC 2PN2A 3IEVA 4DUZC 1XNRC 1HR0C 2PT7G 3EERA 1N34C 1USPA 1XNQC 2OPLB 5BR8C 3R9WA 4JV5C 4DV4C 1PA4A 5A2QD 2ZM6C 3T1YC 4X64C 2UXCC 4DV0C 3T1HC 4LF4C 2D7VA 1UKKA 3J80D 2VQFC 4DV2C 1WF3A 4DCUA 3LUSA 4DR6C 4DV3C 2E8EA 2F4VC 4LF5C 3J7AD 4MH4A 2XR1A 1IBMC 2DYJA
chains in the Genus database with same CATH superfamily
5JRHA 2P2QA 4FUQA 4ZJZA 3A25A 1WCJA 5AE3A 1USPB 3LAXA 2V7BA 1I94C 2E5LC 3NYQA 3CW8X 1VLAA 5DV9A 2WD9A 2BJOA 3VNSA 4DCTA 1P7LA 2KZ0A 3PROC 5A19A 2QW0X 4BBYA 2CXCA 2EGTA 2P2MA 5BSUA 1P4EC 3UZ0A 1QM4A 3H2TA 4DR3C 4FTFA 3S82A 1V26A 4DG9A 3PESA 4PUHA 4JI0C 5LMNC 4GKKC 1O92A 3LNVA 4GXQA 2M5OA 1N33C 3I07A 4NDNA 2MM9A 4DR1C 2P02A 5KYVA 2WP0C 1ZB9A 3CQ3A 2VSQA 1YJ7A 4R1LA 1O90A 2D1QA 4D56A 4GS5A 5BSMA 4ISBA 2BH1X 3E7WA 4XX2A 4G1IA 2P2FA 3VNQA 3B7WA 1IBLC 4JI3C 4DV7C 2CU6A 2PN2A 2MMAB 4L2ZA 4DUZC 1XNRC 1HR0C 4PUIA 1XNQC 1USPA 1XDXA 2OPLB 4ODJA 3G7SA 4DV4C 1PA4A 2OO4A 1XRBA 3A9VA 3AY0A 3NYRA 2UXCC 4LF4C 4DCUA 3L8CA 2DHMA 1V25A 1PU1A 3FCCA 4LF5C 4TPSB 2DYJA 3OTOC 5K8FA 4PUGA 4NXNC 5BUSA 5CZXA 2ZTBA 4DCVA 2OPLA 1HNZC 2MCQA 5FLXD 1BA3A 1MXBA 1NY8A 4LFAC 4D4IA 4I9GA 4RVOA 3L95X 4RLQA 5A1IA 4LF8C 2E8FA 2HHHC 2Y27A 4DR2C 1HNXC 1UWDA 2ASBA 4RVNA 4JI8C 3RV2A 4DR5C 2DPLA 3A9UA 3O2EA 4DUYC 2UU9C 1MDBA 3UOWA 3I08A 4R0MA 3KXWA 4RMNA 4BC9A 1TH5A 4LF6C 1KKGA 1XS3A 1FLOA 2ZZNA 2UUCC 2UXBC 3TR3A 5GTDA 5T8SA 4X65C 4KTTA 4DR4C 4JI7C 5E7QA 4GKJC 4YY3C 2Y4NA 3GPCA 3EQ6A 4B3SC 4ZLPA 4LE5A 4BSZA 1LCIA 3TQIA 3NPDA 1IBKC 2QVYX 4X66C 4DCSA 2UUAC 4HPVA 4K0BA 2PT7G 3N54B 5BR8C 1VEHA 3CW9A 3K6RA 3CQ2A 4L4QA 1T5DX 4U5YD 3ETOA 5H9UA 4DV0C 3T1HC 3J80D 2D7VA 2VQFC 4DV2C 1UKKA 4PHTA 3LUSA 3UEBA 3J7AD 5ADZA 4MH4A 3DHVA 4WV3A 2ATWA 4JI4C 2CY1A 3DAYA 4B3MC 3N2QA 4OX9C 1O93A 4IZ6A 2D1RA 2QVZX 4FUTA 2P2BA 4PROC 4K0KC 2JMPA 3GKUA 1JOSA 3R9XA 3LNOA 2UUBC 2YCBA 1O9TA 2YWCA 1GPMA 4JI5C 3TDEA 1L2FA 1PG3A 3CJEA 2JNVA 3A26A 3IMLA 4BCAA 4JI1C 3NI2A 2QL8A 3AF5A 4WS9A 3IPLA 1XHJA 2ZZMA 5IT9D 5LCIA 4D57A 2M5HA 1V60A 2PG1E 1HH2P 4LFBC 4KHPC 3VNRA 1XMQC 4DV5C 1QWIA 3R44A 2PROA 1MXCA 2OBVA 4JM1A 2KZFA 1NYEA 4GXRA 2KDNA 4I9FA 5CZVA 3JAMD 1J5EC 4LFCC 5IWAC 5KEIA 1ZB8A 4NOZA 3TUFA 3J81D 1FJGC 4EATA 4L7IA 2YX1A 2HJGA 3IEUA 3DLPX 2P2JA 5AE2A 3EERA 1M6XA 2D27A 4PZPA 3R9WA 4RM2A 4JV5C 2ZM6C 3T1YC 1FUGA 4KTVA 4OXIA 4DR6C 3GR1A 1MDFA 2VZEA 3UX3A 5AE1A 2XR1A 1IBMC 5K85A 2D1TA 1ML8A 4JI2C 4JYAC 1XRAA 5A1GA 3C5EA 1IB8A 1N36C 1PG4A 3PBKA 5T8TA 3UX2A 4YHHC 1XMOC 2P20A 2VQEC 4IR7A 3AF6A 1N2FA 1AMUA 4B3RC 2D1SA 2YWBA 5BUQA 1WH9A 3FM7A 1P4EA 1EGAA 4DV1C 4DG8A 5LMUC 4RLFA 1K0RA 1ULTA 4LF7C 5BSTA 3A4IA 4D4GA 2E7GA 2UXDC 3LGXA 1MKYA 2NCLA 3RG2A 1YGTA 1N32C 4OYCA 4LF9C 4R1MA 4MTNA 2E8CA 1MXAA 5IFIA 2AYAA 4NXMC 4DR7C 4JI6C 4DV6C 4B3TC 3E7XA 5BSRA 1LQLA 5BURA 3ETCA 2QVXX 2ONFA 5BSVA 4X62C 2Z51A 1HNWC 3GR0A 1T5HX 4AQYC 5KYTA 4G36A 2E0GA 3IEVA 1N34C 1M6XC 1MD9A 5A2QD 3CQ1A 2D28C 5BSWA 4X64C 1XRCA 3FCEA 1RY2A 1WF3A 4G37A 4DV3C 1RG9A 4RM3A 4BC7A 2E8EA 2F4VC 3SO4A 2Y4OA
chains in the Genus database with same CATH topology
5JRHA 2P2QA 4FUQA 4ZJZA 5AE3A 1USPB 3LAXA 2V7BA 1I94C 2E5LC 3NYQA 3CW8X 1VLAA 5DV9A 2WD9A 2BJOA 3VNSA 4DCTA 1P7LA 3PROC 5A19A 2QW0X 4BBYA 2CXCA 2EGTA 2P2MA 5BSUA 3UZ0A 1QM4A 3H2TA 4DR3C 4FTFA 3S82A 1V26A 4DG9A 3PESA 4JI0C 5LMNC 4GKKC 1O92A 3LNVA 4GXQA 1N33C 3I07A 4NDNA 4DR1C 2P02A 5KYVA 2WP0C 1ZB9A 2VSQA 1YJ7A 4R1LA 1O90A 2D1QA 4D56A 4GS5A 5BSMA 4ISBA 2BH1X 3E7WA 4XX2A 4G1IA 2P2FA 3VNQA 3B7WA 1IBLC 4JI3C 4DV7C 2PN2A 4L2ZA 4DUZC 1XNRC 1HR0C 1XNQC 1USPA 2OPLB 4ODJA 3G7SA 4DV4C 1PA4A 2OO4A 1XRBA 3A9VA 3NYRA 2UXCC 4LF4C 4DCUA 3L8CA 1V25A 3FCCA 4LF5C 4TPSB 2DYJA 3OTOC 5K8FA 4NXNC 5BUSA 5CZXA 4DCVA 2OPLA 1HNZC 5FLXD 1BA3A 1MXBA 4LFAC 4D4IA 4I9GA 4RVOA 3L95X 4RLQA 5A1IA 4LF8C 2E8FA 2HHHC 2Y27A 4DR2C 1HNXC 2ASBA 4RVNA 4JI8C 3RV2A 4DR5C 2DPLA 3A9UA 4DUYC 2UU9C 1MDBA 3UOWA 3I08A 4R0MA 3KXWA 4RMNA 4BC9A 4LF6C 1KKGA 2UUCC 2UXBC 5GTDA 5T8SA 4X65C 4KTTA 4DR4C 4JI7C 5E7QA 4GKJC 4YY3C 2Y4NA 3GPCA 3EQ6A 4B3SC 4ZLPA 4LE5A 4BSZA 1LCIA 3TQIA 3NPDA 1IBKC 2QVYX 4X66C 4DCSA 2UUAC 4HPVA 4K0BA 2PT7G 3N54B 5BR8C 3CW9A 4L4QA 1T5DX 4U5YD 3ETOA 5H9UA 4DV0C 3T1HC 3J80D 2D7VA 1UKKA 4DV2C 4PHTA 2VQFC 3LUSA 3J7AD 5ADZA 4MH4A 3DHVA 4WV3A 2ATWA 4JI4C 2CY1A 3DAYA 4B3MC 3N2QA 4OX9C 1O93A 4IZ6A 2D1RA 2QVZX 4FUTA 2P2BA 4PROC 4K0KC 2JMPA 3GKUA 1JOSA 3R9XA 2UUBC 2YCBA 1O9TA 2YWCA 1GPMA 4JI5C 3TDEA 1L2FA 1PG3A 3CJEA 4BCAA 3IMLA 4JI1C 3NI2A 2QL8A 3AF5A 4WS9A 3IPLA 5IT9D 4D57A 1HH2P 4LFBC 4KHPC 3VNRA 1XMQC 4DV5C 1QWIA 3R44A 2PROA 1MXCA 2OBVA 4JM1A 2KZFA 1NYEA 4GXRA 4I9FA 5CZVA 3JAMD 1J5EC 4LFCC 5IWAC 5KEIA 1ZB8A 4NOZA 3TUFA 3J81D 1FJGC 4EATA 4L7IA 2HJGA 3IEUA 3DLPX 2P2JA 5AE2A 3EERA 2D27A 4PZPA 3R9WA 4RM2A 4JV5C 2ZM6C 3T1YC 1FUGA 4KTVA 4OXIA 4DR6C 3GR1A 1MDFA 2VZEA 5AE1A 2XR1A 1IBMC 5K85A 2D1TA 1ML8A 4JI2C 4JYAC 1XRAA 5A1GA 3C5EA 1N36C 1PG4A 3PBKA 5T8TA 4YHHC 1XMOC 2P20A 2VQEC 4IR7A 3AF6A 1N2FA 1AMUA 4B3RC 2D1SA 2YWBA 5BUQA 1WH9A 1EGAA 4DV1C 4DG8A 5LMUC 4RLFA 1K0RA 1ULTA 4LF7C 5BSTA 3A4IA 4D4GA 2E7GA 2UXDC 3LGXA 1MKYA 3RG2A 1N32C 4OYCA 4LF9C 4R1MA 4MTNA 2E8CA 1MXAA 5IFIA 2AYAA 4NXMC 4DR7C 4JI6C 4DV6C 4B3TC 3E7XA 5BSRA 1LQLA 5BURA 3ETCA 2QVXX 2ONFA 5BSVA 4X62C 1HNWC 3GR0A 1T5HX 4AQYC 5KYTA 4G36A 2E0GA 3IEVA 1N34C 1MD9A 5A2QD 2D28C 5BSWA 4X64C 1XRCA 3FCEA 1RY2A 1WF3A 4G37A 4DV3C 1RG9A 4RM3A 4BC7A 2E8EA 2F4VC 3SO4A 2Y4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO C;  1ML8 A;  4JI2 C;  4JYA C;  2ATW A;  4JI4 C;  2CY1 A;  4B3M C;  4NXN C;  4OX9 C;  1USP B;  1N36 C;  4DCV A;  1I94 C;  2E5L C;  4K0K C;  2OPL A;  1HNZ C;  2JMP A;  3GKU A;  5FLX D;  1VLA A;  4LFA C;  1JOS A;  4YHH C;  1XMO C;  3R9X A;  2UUB C;  2YCB A;  2VQE C;  2BJO A;  4DCT A;  4JI5 C;  3AF6 A;  1N2F A;  1L2F A;  4B3R C;  3CJE A;  4LF8 C;  2E8F A;  4JI1 C;  2QL8 A;  2HHH C;  1WH9 A;  3AF5 A;  2CXC A;  4DR2 C;  2EGT A;  1HNX C;  5IT9 D;  2ASB A;  4JI8 C;  1EGA A;  4DV1 C;  4DR5 C;  4DR3 C;  5LMU C;  1HH2 P;  4LF7 C;  1K0R A;  4DUY C;  4LFB C;  4KHP C;  2UU9 C;  2E7G A;  1XMQ C;  2UXD C;  4DV5 C;  4JI0 C;  5LMN C;  1MKY A;  4LF6 C;  4GKK C;  1KKG A;  1N33 C;  3I07 A;  1QWI A;  4DR1 C;  1N32 C;  2KZF A;  1ZB9 A;  1NYE A;  4LF9 C;  2UUC C;  2UXB C;  4MTN A;  2E8C A;  3JAM D;  1J5E C;  4LFC C;  5IWA C;  4NXM C;  4DR7 C;  4X65 C;  4JI6 C;  1ZB8 A;  4DV6 C;  4B3T C;  4DR4 C;  4JI7 C;  4NOZ A;  3J81 D;  4GKJ C;  4YY3 C;  1LQL A;  1FJG C;  4XX2 A;  2ONF A;  4B3S C;  4X62 C;  1IBL C;  4BSZ A;  4JI3 C;  1IBK C;  2HJG A;  1HNW C;  3IEU A;  4X66 C;  4DCS A;  4DV7 C;  4AQY C;  2UUA C;  2PN2 A;  3IEV A;  4DUZ C;  1XNR C;  1HR0 C;  2PT7 G;  3EER A;  1N34 C;  1USP A;  1XNQ C;  2OPL B;  5BR8 C;  3R9W A;  4JV5 C;  4DV4 C;  1PA4 A;  5A2Q D;  2ZM6 C;  3T1Y C;  4X64 C;  2UXC C;  4DV0 C;  3T1H C;  4LF4 C;  2D7V A;  1UKK A;  3J80 D;  2VQF C;  4DV2 C;  1WF3 A;  4DCU A;  3LUS A;  4DR6 C;  4DV3 C;  2E8E A;  2F4V C;  4LF5 C;  3J7A D;  4MH4 A;  2XR1 A;  1IBM C;  2DYJ A; 
#chains in the Genus database with same CATH topology
 5JRH A;  2P2Q A;  4FUQ A;  4ZJZ A;  3A25 A;  1WCJ A;  5AE3 A;  1USP B;  3LAX A;  2V7B A;  1I94 C;  2E5L C;  3NYQ A;  3CW8 X;  1VLA A;  5DV9 A;  2WD9 A;  2BJO A;  3VNS A;  4DCT A;  1P7L A;  2KZ0 A;  3PRO C;  5A19 A;  2QW0 X;  4BBY A;  2CXC A;  2EGT A;  2P2M A;  5BSU A;  1P4E C;  3UZ0 A;  1QM4 A;  3H2T A;  4DR3 C;  4FTF A;  3S82 A;  1V26 A;  4DG9 A;  3PES A;  4PUH A;  4JI0 C;  5LMN C;  4GKK C;  1O92 A;  3LNV A;  4GXQ A;  2M5O A;  1N33 C;  3I07 A;  4NDN A;  2MM9 A;  4DR1 C;  2P02 A;  5KYV A;  2WP0 C;  1ZB9 A;  3CQ3 A;  2VSQ A;  1YJ7 A;  4R1L A;  1O90 A;  2D1Q A;  4D56 A;  4GS5 A;  5BSM A;  4ISB A;  2BH1 X;  3E7W A;  4XX2 A;  4G1I A;  2P2F A;  3VNQ A;  3B7W A;  1IBL C;  4JI3 C;  4DV7 C;  2CU6 A;  2PN2 A;  2MMA B;  4L2Z A;  4DUZ C;  1XNR C;  1HR0 C;  4PUI A;  1XNQ C;  1USP A;  1XDX A;  2OPL B;  4ODJ A;  3G7S A;  4DV4 C;  1PA4 A;  2OO4 A;  1XRB A;  3A9V A;  3AY0 A;  3NYR A;  2UXC C;  4LF4 C;  4DCU A;  3L8C A;  2DHM A;  1V25 A;  1PU1 A;  3FCC A;  4LF5 C;  4TPS B;  2DYJ A;  3OTO C;  5K8F A;  4PUG A;  4NXN C;  5BUS A;  5CZX A;  2ZTB A;  4DCV A;  2OPL A;  1HNZ C;  2MCQ A;  5FLX D;  1BA3 A;  1MXB A;  1NY8 A;  4LFA C;  4D4I A;  4I9G A;  4RVO A;  3L95 X;  4RLQ A;  5A1I A;  4LF8 C;  2E8F A;  2HHH C;  2Y27 A;  4DR2 C;  1HNX C;  1UWD A;  2ASB A;  4RVN A;  4JI8 C;  3RV2 A;  4DR5 C;  2DPL A;  3A9U A;  3O2E A;  4DUY C;  2UU9 C;  1MDB A;  3UOW A;  3I08 A;  4R0M A;  3KXW A;  4RMN A;  4BC9 A;  1TH5 A;  4LF6 C;  1KKG A;  1XS3 A;  1FLO A;  2ZZN A;  2UUC C;  2UXB C;  3TR3 A;  5GTD A;  5T8S A;  4X65 C;  4KTT A;  4DR4 C;  4JI7 C;  5E7Q A;  4GKJ C;  4YY3 C;  2Y4N A;  3GPC A;  3EQ6 A;  4B3S C;  4ZLP A;  4LE5 A;  4BSZ A;  1LCI A;  3TQI A;  3NPD A;  1IBK C;  2QVY X;  4X66 C;  4DCS A;  2UUA C;  4HPV A;  4K0B A;  2PT7 G;  3N54 B;  5BR8 C;  1VEH A;  3CW9 A;  3K6R A;  3CQ2 A;  4L4Q A;  1T5D X;  4U5Y D;  3ETO A;  5H9U A;  4DV0 C;  3T1H C;  3J80 D;  2D7V A;  2VQF C;  4DV2 C;  1UKK A;  4PHT A;  3LUS A;  3UEB A;  3J7A D;  5ADZ A;  4MH4 A;  3DHV A;  4WV3 A;  2ATW A;  4JI4 C;  2CY1 A;  3DAY A;  4B3M C;  3N2Q A;  4OX9 C;  1O93 A;  4IZ6 A;  2D1R A;  2QVZ X;  4FUT A;  2P2B A;  4PRO C;  4K0K C;  2JMP A;  3GKU A;  1JOS A;  3R9X A;  3LNO A;  2UUB C;  2YCB A;  1O9T A;  2YWC A;  1GPM A;  4JI5 C;  3TDE A;  1L2F A;  1PG3 A;  3CJE A;  2JNV A;  3A26 A;  3IML A;  4BCA A;  4JI1 C;  3NI2 A;  2QL8 A;  3AF5 A;  4WS9 A;  3IPL A;  1XHJ A;  2ZZM A;  5IT9 D;  5LCI A;  4D57 A;  2M5H A;  1V60 A;  2PG1 E;  1HH2 P;  4LFB C;  4KHP C;  3VNR A;  1XMQ C;  4DV5 C;  1QWI A;  3R44 A;  2PRO A;  1MXC A;  2OBV A;  4JM1 A;  2KZF A;  1NYE A;  4GXR A;  2KDN A;  4I9F A;  5CZV A;  3JAM D;  1J5E C;  4LFC C;  5IWA C;  5KEI A;  1ZB8 A;  4NOZ A;  3TUF A;  3J81 D;  1FJG C;  4EAT A;  4L7I A;  2YX1 A;  2HJG A;  3IEU A;  3DLP X;  2P2J A;  5AE2 A;  3EER A;  1M6X A;  2D27 A;  4PZP A;  3R9W A;  4RM2 A;  4JV5 C;  2ZM6 C;  3T1Y C;  1FUG A;  4KTV A;  4OXI A;  4DR6 C;  3GR1 A;  1MDF A;  2VZE A;  3UX3 A;  5AE1 A;  2XR1 A;  1IBM C;  5K85 A;  2D1T A;  1ML8 A;  4JI2 C;  4JYA C;  1XRA A;  5A1G A;  3C5E A;  1IB8 A;  1N36 C;  1PG4 A;  3PBK A;  5T8T A;  3UX2 A;  4YHH C;  1XMO C;  2P20 A;  2VQE C;  4IR7 A;  3AF6 A;  1N2F A;  1AMU A;  4B3R C;  2D1S A;  2YWB A;  5BUQ A;  1WH9 A;  3FM7 A;  1P4E A;  1EGA A;  4DV1 C;  4DG8 A;  5LMU C;  4RLF A;  1K0R A;  1ULT A;  4LF7 C;  5BST A;  3A4I A;  4D4G A;  2E7G A;  2UXD C;  3LGX A;  1MKY A;  2NCL A;  3RG2 A;  1YGT A;  1N32 C;  4OYC A;  4LF9 C;  4R1M A;  4MTN A;  2E8C A;  1MXA A;  5IFI A;  2AYA A;  4NXM C;  4DR7 C;  4JI6 C;  4DV6 C;  4B3T C;  3E7X A;  5BSR A;  1LQL A;  5BUR A;  3ETC A;  2QVX X;  2ONF A;  5BSV A;  4X62 C;  2Z51 A;  1HNW C;  3GR0 A;  1T5H X;  4AQY C;  5KYT A;  4G36 A;  2E0G A;  3IEV A;  1N34 C;  1M6X C;  1MD9 A;  5A2Q D;  3CQ1 A;  2D28 C;  5BSW A;  4X64 C;  1XRC A;  3FCE A;  1RY2 A;  1WF3 A;  4G37 A;  4DV3 C;  1RG9 A;  4RM3 A;  4BC7 A;  2E8E A;  2F4V C;  3SO4 A;  2Y4O A; 
#chains in the Genus database with same CATH homology
 5JRH A;  2P2Q A;  4FUQ A;  4ZJZ A;  5AE3 A;  1USP B;  3LAX A;  2V7B A;  1I94 C;  2E5L C;  3NYQ A;  3CW8 X;  1VLA A;  5DV9 A;  2WD9 A;  2BJO A;  3VNS A;  4DCT A;  1P7L A;  3PRO C;  5A19 A;  2QW0 X;  4BBY A;  2CXC A;  2EGT A;  2P2M A;  5BSU A;  3UZ0 A;  1QM4 A;  3H2T A;  4DR3 C;  4FTF A;  3S82 A;  1V26 A;  4DG9 A;  3PES A;  4JI0 C;  5LMN C;  4GKK C;  1O92 A;  3LNV A;  4GXQ A;  1N33 C;  3I07 A;  4NDN A;  4DR1 C;  2P02 A;  5KYV A;  2WP0 C;  1ZB9 A;  2VSQ A;  1YJ7 A;  4R1L A;  1O90 A;  2D1Q A;  4D56 A;  4GS5 A;  5BSM A;  4ISB A;  2BH1 X;  3E7W A;  4XX2 A;  4G1I A;  2P2F A;  3VNQ A;  3B7W A;  1IBL C;  4JI3 C;  4DV7 C;  2PN2 A;  4L2Z A;  4DUZ C;  1XNR C;  1HR0 C;  1XNQ C;  1USP A;  2OPL B;  4ODJ A;  3G7S A;  4DV4 C;  1PA4 A;  2OO4 A;  1XRB A;  3A9V A;  3NYR A;  2UXC C;  4LF4 C;  4DCU A;  3L8C A;  1V25 A;  3FCC A;  4LF5 C;  4TPS B;  2DYJ A;  3OTO C;  5K8F A;  4NXN C;  5BUS A;  5CZX A;  4DCV A;  2OPL A;  1HNZ C;  5FLX D;  1BA3 A;  1MXB A;  4LFA C;  4D4I A;  4I9G A;  4RVO A;  3L95 X;  4RLQ A;  5A1I A;  4LF8 C;  2E8F A;  2HHH C;  2Y27 A;  4DR2 C;  1HNX C;  2ASB A;  4RVN A;  4JI8 C;  3RV2 A;  4DR5 C;  2DPL A;  3A9U A;  4DUY C;  2UU9 C;  1MDB A;  3UOW A;  3I08 A;  4R0M A;  3KXW A;  4RMN A;  4BC9 A;  4LF6 C;  1KKG A;  2UUC C;  2UXB C;  5GTD A;  5T8S A;  4X65 C;  4KTT A;  4DR4 C;  4JI7 C;  5E7Q A;  4GKJ C;  4YY3 C;  2Y4N A;  3GPC A;  3EQ6 A;  4B3S C;  4ZLP A;  4LE5 A;  4BSZ A;  1LCI A;  3TQI A;  3NPD A;  1IBK C;  2QVY X;  4X66 C;  4DCS A;  2UUA C;  4HPV A;  4K0B A;  2PT7 G;  3N54 B;  5BR8 C;  3CW9 A;  4L4Q A;  1T5D X;  4U5Y D;  3ETO A;  5H9U A;  4DV0 C;  3T1H C;  3J80 D;  2D7V A;  1UKK A;  4DV2 C;  4PHT A;  2VQF C;  3LUS A;  3J7A D;  5ADZ A;  4MH4 A;  3DHV A;  4WV3 A;  2ATW A;  4JI4 C;  2CY1 A;  3DAY A;  4B3M C;  3N2Q A;  4OX9 C;  1O93 A;  4IZ6 A;  2D1R A;  2QVZ X;  4FUT A;  2P2B A;  4PRO C;  4K0K C;  2JMP A;  3GKU A;  1JOS A;  3R9X A;  2UUB C;  2YCB A;  1O9T A;  2YWC A;  1GPM A;  4JI5 C;  3TDE A;  1L2F A;  1PG3 A;  3CJE A;  4BCA A;  3IML A;  4JI1 C;  3NI2 A;  2QL8 A;  3AF5 A;  4WS9 A;  3IPL A;  5IT9 D;  4D57 A;  1HH2 P;  4LFB C;  4KHP C;  3VNR A;  1XMQ C;  4DV5 C;  1QWI A;  3R44 A;  2PRO A;  1MXC A;  2OBV A;  4JM1 A;  2KZF A;  1NYE A;  4GXR A;  4I9F A;  5CZV A;  3JAM D;  1J5E C;  4LFC C;  5IWA C;  5KEI A;  1ZB8 A;  4NOZ A;  3TUF A;  3J81 D;  1FJG C;  4EAT A;  4L7I A;  2HJG A;  3IEU A;  3DLP X;  2P2J A;  5AE2 A;  3EER A;  2D27 A;  4PZP A;  3R9W A;  4RM2 A;  4JV5 C;  2ZM6 C;  3T1Y C;  1FUG A;  4KTV A;  4OXI A;  4DR6 C;  3GR1 A;  1MDF A;  2VZE A;  5AE1 A;  2XR1 A;  1IBM C;  5K85 A;  2D1T A;  1ML8 A;  4JI2 C;  4JYA C;  1XRA A;  5A1G A;  3C5E A;  1N36 C;  1PG4 A;  3PBK A;  5T8T A;  4YHH C;  1XMO C;  2P20 A;  2VQE C;  4IR7 A;  3AF6 A;  1N2F A;  1AMU A;  4B3R C;  2D1S A;  2YWB A;  5BUQ A;  1WH9 A;  1EGA A;  4DV1 C;  4DG8 A;  5LMU C;  4RLF A;  1K0R A;  1ULT A;  4LF7 C;  5BST A;  3A4I A;  4D4G A;  2E7G A;  2UXD C;  3LGX A;  1MKY A;  3RG2 A;  1N32 C;  4OYC A;  4LF9 C;  4R1M A;  4MTN A;  2E8C A;  1MXA A;  5IFI A;  2AYA A;  4NXM C;  4DR7 C;  4JI6 C;  4DV6 C;  4B3T C;  3E7X A;  5BSR A;  1LQL A;  5BUR A;  3ETC A;  2QVX X;  2ONF A;  5BSV A;  4X62 C;  1HNW C;  3GR0 A;  1T5H X;  4AQY C;  5KYT A;  4G36 A;  2E0G A;  3IEV A;  1N34 C;  1MD9 A;  5A2Q D;  2D28 C;  5BSW A;  4X64 C;  1XRC A;  3FCE A;  1RY2 A;  1WF3 A;  4G37 A;  4DV3 C;  1RG9 A;  4RM3 A;  4BC7 A;  2E8E A;  2F4V C;  3SO4 A;  2Y4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...