4DR7C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 49
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr7C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr7C02
3J81D 1XNRC 4DCVA 1HH2P 3I07A 4DV0C 3J7AD 4X62C 3T1HC 1XMQC 5BR8C 1WF3A 1HNWC 1N33C 1USPA 4GKJC 2UXCC 2KZFA 2BJOA 4GKKC 1HNZC 4B3RC 2ATWA 1UKKA 3JAMD 4B3SC 2UXBC 2CY1A 2YCBA 4LF6C 4X66C 4JV5C 4YHHC 4XX2A 1NYEA 2PT7G 4LFAC 1LQLA 4LFCC 4DR5C 4LFBC 1VLAA 3OTOC 4DV3C 1ML8A 4NXNC 1FJGC 4DV5C 1N34C 1QWIA 2OPLA 3R9XA 4KHPC 1HR0C 4MTNA 4DV2C 4DR2C 2E8FA 2UUCC 4DV1C 3AF6A 4DR1C 4AQYC 2HJGA 2DYJA 4JI7C 4DR6C 2HHHC 3R9WA 4JI0C 4YY3C 2VQFC 4DUYC 1JOSA 1USPB 3T1YC 4JI1C 2VQEC 4K0KC 4X64C 2UXDC 1IBLC 1XNQC 4LF9C 2UU9C 3IEUA 4DR4C 4DR3C 2PN2A 2CXCA 1HNXC 1I94C 4JI3C 2ZM6C 2E8CA 1J5EC 5LMUC 1MKYA 1ZB9A 2UUBC 2E8EA 2ONFA 4DV6C 5A2QD 3LUSA 4BSZA 3CJEA 5LMNC 4DCUA 2QL8A 1KKGA 4OX9C 3EERA 2UUAC 2OPLB 4X65C 3AF5A 1XMOC 3J80D 1ZB8A 4DV7C 4NXMC 4LF7C 1WH9A 5IT9D 2EGTA 4JI4C 4JI6C 4LF5C 2ASBA 1N2FA 1EGAA 2E7GA 2JMPA 2XR1A 4MH4A 2F4VC 4JI2C 4LF8C 4JYAC 5IWAC 4DV4C 4JI8C 4LF4C 4DCTA 5FLXD 4DR7C 1K0RA 1N36C 4DUZC 2E5LC 1N32C 4DCSA 4B3MC 4B3TC 2D7VA 3GKUA 1L2FA 4NOZA 1IBMC 1PA4A 1IBKC 4JI5C 3IEVA
chains in the Genus database with same CATH superfamily
3J81D 3PESA 3UX2A 1XS3A 4DV0C 2JNVA 3LNVA 1NY8A 5BUSA 5BSMA 2KDNA 4I9GA 4GKKC 1P4EC 2UXBC 4YHHC 2D1TA 4D56A 1NYEA 4RM3A 2VZEA 3N54B 3FCEA 1LCIA 4DG8A 3OTOC 1N34C 4G1IA 2OPLA 1HR0C 2PG1E 4DV2C 1MXCA 4WS9A 5A1GA 4R0MA 3AF6A 3I08A 2OBVA 1UWDA 2VQFC 4YY3C 4DUYC 4JI1C 1USPB 4L7IA 4ZJZA 2CU6A 2YX1A 5KYVA 4LF9C 2AYAA 3UOWA 2QVYX 5LMUC 4EATA 2E8EA 2D27A 5K85A 3ETOA 3NPDA 2QL8A 2UUAC 1M6XA 3VNSA 4X65C 3AF5A 4PHTA 3J80D 4D4IA 2VSQA 5BUQA 4R1MA 5IT9D 2EGTA 4JI6C 1N2FA 1EGAA 4PZPA 4MH4A 4KTTA 2WP0C 4DV4C 2M5OA 1M6XC 3FCCA 2ZZNA 4B3TC 2D7VA 3CQ2A 4GS5A 2P2JA 4LE5A 4NOZA 4PUHA 2P2BA 3A25A 3GR1A 4HPVA 5BSTA 3J7AD 1FLOA 2PROA 1XMQC 3K6RA 1WF3A 2YWBA 4OXIA 4TPSB 5KYTA 5T8TA 2KZFA 1MD9A 2YCBA 4X66C 3A4IA 4JV5C 3RG2A 2QVZX 5DV9A 4BCAA 3S82A 5E7QA 5LCIA 1VLAA 3A26A 4PUIA 2MM9A 1QWIA 5AE2A 3LGXA 4MTNA 4DR2C 2UUCC 3H2TA 2DYJA 2BH1X 1YGTA 3DLPX 4K0BA 3DAYA 3B7WA 4ISBA 1P7LA 4X64C 1WCJA 5BSVA 3IEUA 2PN2A 4U5YD 4JI3C 4RVNA 3NI2A 5BSWA 1MKYA 1ZB9A 1V25A 1RG9A 1PG4A 4IR7A 4BSZA 1XHJA 3E7WA 4G36A 1MXBA 2E0GA 2QW0X 4I9FA 4DV7C 3AY0A 1O9TA 4WV3A 4NXMC 3GR0A 5AE3A 2ZZMA 4LF5C 4G37A 2D1QA 2E7GA 2D1SA 1IBKC 1IB8A 2JMPA 1XDXA 4GXRA 4JYAC 5IWAC 4LF4C 5FLXD 3L8CA 4DR7C 1K0RA 4DCSA 2D1RA 1PA4A 2KZ0A 4JM1A 2DHMA 1XNRC 4DCVA 2YWCA 4X62C 1XRCA 3L95X 2Y27A 5BSRA 1HNWC 4FTFA 1USPA 4PROC 4GKJC 2BJOA 1PG3A 1UKKA 4B3SC 1O90A 4BC7A 4RM2A 5KEIA 4LF6C 2P02A 1GPMA 5H9UA 3O2EA 2PT7G 3EQ6A 3PROC 4ODJA 5AE1A 4DV3C 1ML8A 4RVOA 4DV5C 2P2MA 3G7SA 4KHPC 2Z51A 3A9VA 2E8FA 4DV1C 4DR1C 3UEBA 4JI7C 3R9WA 4JI0C 3KXWA 4KTVA 1JOSA 5BSUA 2UXDC 2VQEC 1IBLC 3CW8X 4D4GA 2UU9C 1MDFA 1O93A 2NCLA 2E8CA 1J5EC 4GXQA 4DV6C 2ONFA 2OO4A 5T8SA 5A2QD 3LUSA 3TUFA 1ULTA 3CJEA 5CZXA 1XRAA 5LMNC 4DCUA 3IMLA 3VNQA 4RLFA 4DG9A 2OPLB 5IFIA 1ZB8A 2WD9A 1WH9A 2P2FA 5K8FA 5A1IA 2XR1A 4JI2C 4LF8C 3NYRA 2D28C 4ZLPA 1O92A 3NYQA 3VNRA 1N36C 2E5LC 4B3MC 1L2FA 3E7XA 1TH5A 1IBMC 2V7BA 3IEVA 1AMUA 1HH2P 3I07A 2Y4OA 3C5EA 1MDBA 3GPCA 3T1HC 1V60A 5BR8C 2MMAB 1T5HX 1N33C 2DPLA 1V26A 2UXCC 1HNZC 4B3RC 1XRBA 2ATWA 1RY2A 3LAXA 4FUQA 4BBYA 3JAMD 2CY1A 3R44A 4XX2A 1VEHA 4LFAC 1LQLA 4LFCC 4BC9A 4DR5C 4LFBC 3TDEA 3UZ0A 1FJGC 1FUGA 3SO4A 3IPLA 4NXNC 3LNOA 3A9UA 4NDNA 5GTDA 3R9XA 2MCQA 4L2ZA 5JRHA 4AQYC 3CW9A 1YJ7A 2HJGA 1T5DX 4DR6C 2HHHC 3T1YC 4K0KC 4R1LA 2QVXX 1XNQC 3N2QA 2ZTBA 5CZVA 4FUTA 4DR4C 4DR3C 4RLQA 2CXCA 1HNXC 1I94C 3CQ1A 3TR3A 2ZM6C 2P2QA 3DHVA 2UUBC 1PU1A 1QM4A 3RV2A 5ADZA 1MXAA 2M5HA 3UX3A 4PUGA 1KKGA 4OX9C 3EERA 3FM7A 2Y4NA 1XMOC 4L4QA 4IZ6A 3PBKA 4LF7C 2ASBA 4JI4C 3ETCA 2F4VC 4OYCA 5A19A 5BURA 4JI8C 3CQ3A 3TQIA 4DCTA 4DUZC 1N32C 4D57A 3GKUA 4RMNA 1BA3A 1P4EA 2P20A 4JI5C
chains in the Genus database with same CATH topology
3J81D 3PESA 4DV0C 3LNVA 5BUSA 5BSMA 4I9GA 4GKKC 2UXBC 4YHHC 2D1TA 4D56A 1NYEA 4RM3A 2VZEA 3N54B 3FCEA 1LCIA 4DG8A 3OTOC 1N34C 4G1IA 2OPLA 1HR0C 4DV2C 1MXCA 4WS9A 5A1GA 4R0MA 3AF6A 3I08A 2OBVA 2VQFC 4YY3C 4DUYC 4JI1C 1USPB 4L7IA 4ZJZA 5KYVA 4LF9C 2AYAA 3UOWA 2QVYX 5LMUC 4EATA 2E8EA 2D27A 5K85A 3ETOA 3NPDA 2QL8A 2UUAC 3VNSA 4X65C 3AF5A 4PHTA 3J80D 4D4IA 2VSQA 5BUQA 4R1MA 5IT9D 2EGTA 4JI6C 1N2FA 1EGAA 4PZPA 4MH4A 4KTTA 2WP0C 4DV4C 3FCCA 4B3TC 2D7VA 4GS5A 2P2JA 4LE5A 4NOZA 2P2BA 3GR1A 4HPVA 5BSTA 3J7AD 2PROA 1XMQC 1WF3A 2YWBA 4OXIA 4TPSB 5KYTA 5T8TA 2KZFA 1MD9A 2YCBA 4X66C 3A4IA 4JV5C 3RG2A 2QVZX 5DV9A 4BCAA 3S82A 5E7QA 1VLAA 1QWIA 5AE2A 3LGXA 4MTNA 4DR2C 2UUCC 3H2TA 2DYJA 2BH1X 3DLPX 4K0BA 3DAYA 3B7WA 4ISBA 1P7LA 4X64C 5BSVA 3IEUA 2PN2A 4U5YD 4JI3C 4RVNA 3NI2A 5BSWA 1MKYA 1ZB9A 1V25A 1RG9A 1PG4A 4IR7A 4BSZA 3E7WA 4G36A 1MXBA 2E0GA 2QW0X 4I9FA 4DV7C 1O9TA 4WV3A 4NXMC 3GR0A 5AE3A 4LF5C 4G37A 2D1QA 2E7GA 2D1SA 1IBKC 2JMPA 4GXRA 4JYAC 5IWAC 4LF4C 5FLXD 3L8CA 4DR7C 1K0RA 4DCSA 2D1RA 1PA4A 4JM1A 1XNRC 4DCVA 2YWCA 4X62C 1XRCA 3L95X 2Y27A 5BSRA 1HNWC 4FTFA 1USPA 4PROC 4GKJC 2BJOA 1PG3A 1UKKA 4B3SC 1O90A 4BC7A 4RM2A 5KEIA 4LF6C 2P02A 1GPMA 5H9UA 2PT7G 3EQ6A 3PROC 4ODJA 5AE1A 4DV3C 1ML8A 4RVOA 4DV5C 2P2MA 3G7SA 4KHPC 3A9VA 2E8FA 4DV1C 4DR1C 4JI7C 3R9WA 4JI0C 3KXWA 4KTVA 1JOSA 5BSUA 2UXDC 2VQEC 1IBLC 3CW8X 4D4GA 2UU9C 1MDFA 1O93A 2E8CA 1J5EC 4GXQA 4DV6C 2ONFA 2OO4A 5T8SA 5A2QD 3LUSA 3TUFA 1ULTA 3CJEA 5CZXA 1XRAA 5LMNC 4DCUA 3IMLA 3VNQA 4RLFA 4DG9A 2OPLB 5IFIA 1ZB8A 2WD9A 1WH9A 2P2FA 5K8FA 5A1IA 2XR1A 4JI2C 4LF8C 3NYRA 2D28C 4ZLPA 1O92A 3NYQA 3VNRA 1N36C 2E5LC 4B3MC 1L2FA 3E7XA 1IBMC 2V7BA 3IEVA 1AMUA 1HH2P 3I07A 2Y4OA 3C5EA 1MDBA 3GPCA 3T1HC 5BR8C 1T5HX 1N33C 2DPLA 1V26A 2UXCC 1HNZC 4B3RC 1XRBA 2ATWA 1RY2A 3LAXA 4FUQA 4BBYA 3JAMD 2CY1A 3R44A 4XX2A 4LFAC 1LQLA 4LFCC 4BC9A 4DR5C 4LFBC 3TDEA 3UZ0A 1FJGC 1FUGA 3SO4A 3IPLA 4NXNC 3A9UA 4NDNA 5GTDA 3R9XA 4L2ZA 5JRHA 4AQYC 3CW9A 1YJ7A 2HJGA 1T5DX 4DR6C 2HHHC 3T1YC 4K0KC 4R1LA 2QVXX 1XNQC 3N2QA 5CZVA 4FUTA 4DR4C 4DR3C 4RLQA 2CXCA 1HNXC 1I94C 2ZM6C 2P2QA 3DHVA 2UUBC 1QM4A 3RV2A 5ADZA 1MXAA 1KKGA 4OX9C 3EERA 2Y4NA 1XMOC 4L4QA 4IZ6A 3PBKA 4LF7C 2ASBA 4JI4C 3ETCA 2F4VC 4OYCA 5A19A 5BURA 4JI8C 3TQIA 4DCTA 4DUZC 1N32C 4D57A 3GKUA 4RMNA 1BA3A 2P20A 4JI5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 D;  1XNR C;  4DCV A;  1HH2 P;  3I07 A;  4DV0 C;  3J7A D;  4X62 C;  3T1H C;  1XMQ C;  5BR8 C;  1WF3 A;  1HNW C;  1N33 C;  1USP A;  4GKJ C;  2UXC C;  2KZF A;  2BJO A;  4GKK C;  1HNZ C;  4B3R C;  2ATW A;  1UKK A;  3JAM D;  4B3S C;  2UXB C;  2CY1 A;  2YCB A;  4LF6 C;  4X66 C;  4JV5 C;  4YHH C;  4XX2 A;  1NYE A;  2PT7 G;  4LFA C;  1LQL A;  4LFC C;  4DR5 C;  4LFB C;  1VLA A;  3OTO C;  4DV3 C;  1ML8 A;  4NXN C;  1FJG C;  4DV5 C;  1N34 C;  1QWI A;  2OPL A;  3R9X A;  4KHP C;  1HR0 C;  4MTN A;  4DV2 C;  4DR2 C;  2E8F A;  2UUC C;  4DV1 C;  3AF6 A;  4DR1 C;  4AQY C;  2HJG A;  2DYJ A;  4JI7 C;  4DR6 C;  2HHH C;  3R9W A;  4JI0 C;  4YY3 C;  2VQF C;  4DUY C;  1JOS A;  1USP B;  3T1Y C;  4JI1 C;  2VQE C;  4K0K C;  4X64 C;  2UXD C;  1IBL C;  1XNQ C;  4LF9 C;  2UU9 C;  3IEU A;  4DR4 C;  4DR3 C;  2PN2 A;  2CXC A;  1HNX C;  1I94 C;  4JI3 C;  2ZM6 C;  2E8C A;  1J5E C;  5LMU C;  1MKY A;  1ZB9 A;  2UUB C;  2E8E A;  2ONF A;  4DV6 C;  5A2Q D;  3LUS A;  4BSZ A;  3CJE A;  5LMN C;  4DCU A;  2QL8 A;  1KKG A;  4OX9 C;  3EER A;  2UUA C;  2OPL B;  4X65 C;  3AF5 A;  1XMO C;  3J80 D;  1ZB8 A;  4DV7 C;  4NXM C;  4LF7 C;  1WH9 A;  5IT9 D;  2EGT A;  4JI4 C;  4JI6 C;  4LF5 C;  2ASB A;  1N2F A;  1EGA A;  2E7G A;  2JMP A;  2XR1 A;  4MH4 A;  2F4V C;  4JI2 C;  4LF8 C;  4JYA C;  5IWA C;  4DV4 C;  4JI8 C;  4LF4 C;  4DCT A;  5FLX D;  4DR7 C;  1K0R A;  1N36 C;  4DUZ C;  2E5L C;  1N32 C;  4DCS A;  4B3M C;  4B3T C;  2D7V A;  3GKU A;  1L2F A;  4NOZ A;  1IBM C;  1PA4 A;  1IBK C;  4JI5 C;  3IEV A; 
#chains in the Genus database with same CATH topology
 3J81 D;  3PES A;  3UX2 A;  1XS3 A;  4DV0 C;  2JNV A;  3LNV A;  1NY8 A;  5BUS A;  5BSM A;  2KDN A;  4I9G A;  4GKK C;  1P4E C;  2UXB C;  4YHH C;  2D1T A;  4D56 A;  1NYE A;  4RM3 A;  2VZE A;  3N54 B;  3FCE A;  1LCI A;  4DG8 A;  3OTO C;  1N34 C;  4G1I A;  2OPL A;  1HR0 C;  2PG1 E;  4DV2 C;  1MXC A;  4WS9 A;  5A1G A;  4R0M A;  3AF6 A;  3I08 A;  2OBV A;  1UWD A;  2VQF C;  4YY3 C;  4DUY C;  4JI1 C;  1USP B;  4L7I A;  4ZJZ A;  2CU6 A;  2YX1 A;  5KYV A;  4LF9 C;  2AYA A;  3UOW A;  2QVY X;  5LMU C;  4EAT A;  2E8E A;  2D27 A;  5K85 A;  3ETO A;  3NPD A;  2QL8 A;  2UUA C;  1M6X A;  3VNS A;  4X65 C;  3AF5 A;  4PHT A;  3J80 D;  4D4I A;  2VSQ A;  5BUQ A;  4R1M A;  5IT9 D;  2EGT A;  4JI6 C;  1N2F A;  1EGA A;  4PZP A;  4MH4 A;  4KTT A;  2WP0 C;  4DV4 C;  2M5O A;  1M6X C;  3FCC A;  2ZZN A;  4B3T C;  2D7V A;  3CQ2 A;  4GS5 A;  2P2J A;  4LE5 A;  4NOZ A;  4PUH A;  2P2B A;  3A25 A;  3GR1 A;  4HPV A;  5BST A;  3J7A D;  1FLO A;  2PRO A;  1XMQ C;  3K6R A;  1WF3 A;  2YWB A;  4OXI A;  4TPS B;  5KYT A;  5T8T A;  2KZF A;  1MD9 A;  2YCB A;  4X66 C;  3A4I A;  4JV5 C;  3RG2 A;  2QVZ X;  5DV9 A;  4BCA A;  3S82 A;  5E7Q A;  5LCI A;  1VLA A;  3A26 A;  4PUI A;  2MM9 A;  1QWI A;  5AE2 A;  3LGX A;  4MTN A;  4DR2 C;  2UUC C;  3H2T A;  2DYJ A;  2BH1 X;  1YGT A;  3DLP X;  4K0B A;  3DAY A;  3B7W A;  4ISB A;  1P7L A;  4X64 C;  1WCJ A;  5BSV A;  3IEU A;  2PN2 A;  4U5Y D;  4JI3 C;  4RVN A;  3NI2 A;  5BSW A;  1MKY A;  1ZB9 A;  1V25 A;  1RG9 A;  1PG4 A;  4IR7 A;  4BSZ A;  1XHJ A;  3E7W A;  4G36 A;  1MXB A;  2E0G A;  2QW0 X;  4I9F A;  4DV7 C;  3AY0 A;  1O9T A;  4WV3 A;  4NXM C;  3GR0 A;  5AE3 A;  2ZZM A;  4LF5 C;  4G37 A;  2D1Q A;  2E7G A;  2D1S A;  1IBK C;  1IB8 A;  2JMP A;  1XDX A;  4GXR A;  4JYA C;  5IWA C;  4LF4 C;  5FLX D;  3L8C A;  4DR7 C;  1K0R A;  4DCS A;  2D1R A;  1PA4 A;  2KZ0 A;  4JM1 A;  2DHM A;  1XNR C;  4DCV A;  2YWC A;  4X62 C;  1XRC A;  3L95 X;  2Y27 A;  5BSR A;  1HNW C;  4FTF A;  1USP A;  4PRO C;  4GKJ C;  2BJO A;  1PG3 A;  1UKK A;  4B3S C;  1O90 A;  4BC7 A;  4RM2 A;  5KEI A;  4LF6 C;  2P02 A;  1GPM A;  5H9U A;  3O2E A;  2PT7 G;  3EQ6 A;  3PRO C;  4ODJ A;  5AE1 A;  4DV3 C;  1ML8 A;  4RVO A;  4DV5 C;  2P2M A;  3G7S A;  4KHP C;  2Z51 A;  3A9V A;  2E8F A;  4DV1 C;  4DR1 C;  3UEB A;  4JI7 C;  3R9W A;  4JI0 C;  3KXW A;  4KTV A;  1JOS A;  5BSU A;  2UXD C;  2VQE C;  1IBL C;  3CW8 X;  4D4G A;  2UU9 C;  1MDF A;  1O93 A;  2NCL A;  2E8C A;  1J5E C;  4GXQ A;  4DV6 C;  2ONF A;  2OO4 A;  5T8S A;  5A2Q D;  3LUS A;  3TUF A;  1ULT A;  3CJE A;  5CZX A;  1XRA A;  5LMN C;  4DCU A;  3IML A;  3VNQ A;  4RLF A;  4DG9 A;  2OPL B;  5IFI A;  1ZB8 A;  2WD9 A;  1WH9 A;  2P2F A;  5K8F A;  5A1I A;  2XR1 A;  4JI2 C;  4LF8 C;  3NYR A;  2D28 C;  4ZLP A;  1O92 A;  3NYQ A;  3VNR A;  1N36 C;  2E5L C;  4B3M C;  1L2F A;  3E7X A;  1TH5 A;  1IBM C;  2V7B A;  3IEV A;  1AMU A;  1HH2 P;  3I07 A;  2Y4O A;  3C5E A;  1MDB A;  3GPC A;  3T1H C;  1V60 A;  5BR8 C;  2MMA B;  1T5H X;  1N33 C;  2DPL A;  1V26 A;  2UXC C;  1HNZ C;  4B3R C;  1XRB A;  2ATW A;  1RY2 A;  3LAX A;  4FUQ A;  4BBY A;  3JAM D;  2CY1 A;  3R44 A;  4XX2 A;  1VEH A;  4LFA C;  1LQL A;  4LFC C;  4BC9 A;  4DR5 C;  4LFB C;  3TDE A;  3UZ0 A;  1FJG C;  1FUG A;  3SO4 A;  3IPL A;  4NXN C;  3LNO A;  3A9U A;  4NDN A;  5GTD A;  3R9X A;  2MCQ A;  4L2Z A;  5JRH A;  4AQY C;  3CW9 A;  1YJ7 A;  2HJG A;  1T5D X;  4DR6 C;  2HHH C;  3T1Y C;  4K0K C;  4R1L A;  2QVX X;  1XNQ C;  3N2Q A;  2ZTB A;  5CZV A;  4FUT A;  4DR4 C;  4DR3 C;  4RLQ A;  2CXC A;  1HNX C;  1I94 C;  3CQ1 A;  3TR3 A;  2ZM6 C;  2P2Q A;  3DHV A;  2UUB C;  1PU1 A;  1QM4 A;  3RV2 A;  5ADZ A;  1MXA A;  2M5H A;  3UX3 A;  4PUG A;  1KKG A;  4OX9 C;  3EER A;  3FM7 A;  2Y4N A;  1XMO C;  4L4Q A;  4IZ6 A;  3PBK A;  4LF7 C;  2ASB A;  4JI4 C;  3ETC A;  2F4V C;  4OYC A;  5A19 A;  5BUR A;  4JI8 C;  3CQ3 A;  3TQI A;  4DCT A;  4DUZ C;  1N32 C;  4D57 A;  3GKU A;  4RMN A;  1BA3 A;  1P4E A;  2P20 A;  4JI5 C; 
#chains in the Genus database with same CATH homology
 3J81 D;  3PES A;  4DV0 C;  3LNV A;  5BUS A;  5BSM A;  4I9G A;  4GKK C;  2UXB C;  4YHH C;  2D1T A;  4D56 A;  1NYE A;  4RM3 A;  2VZE A;  3N54 B;  3FCE A;  1LCI A;  4DG8 A;  3OTO C;  1N34 C;  4G1I A;  2OPL A;  1HR0 C;  4DV2 C;  1MXC A;  4WS9 A;  5A1G A;  4R0M A;  3AF6 A;  3I08 A;  2OBV A;  2VQF C;  4YY3 C;  4DUY C;  4JI1 C;  1USP B;  4L7I A;  4ZJZ A;  5KYV A;  4LF9 C;  2AYA A;  3UOW A;  2QVY X;  5LMU C;  4EAT A;  2E8E A;  2D27 A;  5K85 A;  3ETO A;  3NPD A;  2QL8 A;  2UUA C;  3VNS A;  4X65 C;  3AF5 A;  4PHT A;  3J80 D;  4D4I A;  2VSQ A;  5BUQ A;  4R1M A;  5IT9 D;  2EGT A;  4JI6 C;  1N2F A;  1EGA A;  4PZP A;  4MH4 A;  4KTT A;  2WP0 C;  4DV4 C;  3FCC A;  4B3T C;  2D7V A;  4GS5 A;  2P2J A;  4LE5 A;  4NOZ A;  2P2B A;  3GR1 A;  4HPV A;  5BST A;  3J7A D;  2PRO A;  1XMQ C;  1WF3 A;  2YWB A;  4OXI A;  4TPS B;  5KYT A;  5T8T A;  2KZF A;  1MD9 A;  2YCB A;  4X66 C;  3A4I A;  4JV5 C;  3RG2 A;  2QVZ X;  5DV9 A;  4BCA A;  3S82 A;  5E7Q A;  1VLA A;  1QWI A;  5AE2 A;  3LGX A;  4MTN A;  4DR2 C;  2UUC C;  3H2T A;  2DYJ A;  2BH1 X;  3DLP X;  4K0B A;  3DAY A;  3B7W A;  4ISB A;  1P7L A;  4X64 C;  5BSV A;  3IEU A;  2PN2 A;  4U5Y D;  4JI3 C;  4RVN A;  3NI2 A;  5BSW A;  1MKY A;  1ZB9 A;  1V25 A;  1RG9 A;  1PG4 A;  4IR7 A;  4BSZ A;  3E7W A;  4G36 A;  1MXB A;  2E0G A;  2QW0 X;  4I9F A;  4DV7 C;  1O9T A;  4WV3 A;  4NXM C;  3GR0 A;  5AE3 A;  4LF5 C;  4G37 A;  2D1Q A;  2E7G A;  2D1S A;  1IBK C;  2JMP A;  4GXR A;  4JYA C;  5IWA C;  4LF4 C;  5FLX D;  3L8C A;  4DR7 C;  1K0R A;  4DCS A;  2D1R A;  1PA4 A;  4JM1 A;  1XNR C;  4DCV A;  2YWC A;  4X62 C;  1XRC A;  3L95 X;  2Y27 A;  5BSR A;  1HNW C;  4FTF A;  1USP A;  4PRO C;  4GKJ C;  2BJO A;  1PG3 A;  1UKK A;  4B3S C;  1O90 A;  4BC7 A;  4RM2 A;  5KEI A;  4LF6 C;  2P02 A;  1GPM A;  5H9U A;  2PT7 G;  3EQ6 A;  3PRO C;  4ODJ A;  5AE1 A;  4DV3 C;  1ML8 A;  4RVO A;  4DV5 C;  2P2M A;  3G7S A;  4KHP C;  3A9V A;  2E8F A;  4DV1 C;  4DR1 C;  4JI7 C;  3R9W A;  4JI0 C;  3KXW A;  4KTV A;  1JOS A;  5BSU A;  2UXD C;  2VQE C;  1IBL C;  3CW8 X;  4D4G A;  2UU9 C;  1MDF A;  1O93 A;  2E8C A;  1J5E C;  4GXQ A;  4DV6 C;  2ONF A;  2OO4 A;  5T8S A;  5A2Q D;  3LUS A;  3TUF A;  1ULT A;  3CJE A;  5CZX A;  1XRA A;  5LMN C;  4DCU A;  3IML A;  3VNQ A;  4RLF A;  4DG9 A;  2OPL B;  5IFI A;  1ZB8 A;  2WD9 A;  1WH9 A;  2P2F A;  5K8F A;  5A1I A;  2XR1 A;  4JI2 C;  4LF8 C;  3NYR A;  2D28 C;  4ZLP A;  1O92 A;  3NYQ A;  3VNR A;  1N36 C;  2E5L C;  4B3M C;  1L2F A;  3E7X A;  1IBM C;  2V7B A;  3IEV A;  1AMU A;  1HH2 P;  3I07 A;  2Y4O A;  3C5E A;  1MDB A;  3GPC A;  3T1H C;  5BR8 C;  1T5H X;  1N33 C;  2DPL A;  1V26 A;  2UXC C;  1HNZ C;  4B3R C;  1XRB A;  2ATW A;  1RY2 A;  3LAX A;  4FUQ A;  4BBY A;  3JAM D;  2CY1 A;  3R44 A;  4XX2 A;  4LFA C;  1LQL A;  4LFC C;  4BC9 A;  4DR5 C;  4LFB C;  3TDE A;  3UZ0 A;  1FJG C;  1FUG A;  3SO4 A;  3IPL A;  4NXN C;  3A9U A;  4NDN A;  5GTD A;  3R9X A;  4L2Z A;  5JRH A;  4AQY C;  3CW9 A;  1YJ7 A;  2HJG A;  1T5D X;  4DR6 C;  2HHH C;  3T1Y C;  4K0K C;  4R1L A;  2QVX X;  1XNQ C;  3N2Q A;  5CZV A;  4FUT A;  4DR4 C;  4DR3 C;  4RLQ A;  2CXC A;  1HNX C;  1I94 C;  2ZM6 C;  2P2Q A;  3DHV A;  2UUB C;  1QM4 A;  3RV2 A;  5ADZ A;  1MXA A;  1KKG A;  4OX9 C;  3EER A;  2Y4N A;  1XMO C;  4L4Q A;  4IZ6 A;  3PBK A;  4LF7 C;  2ASB A;  4JI4 C;  3ETC A;  2F4V C;  4OYC A;  5A19 A;  5BUR A;  4JI8 C;  3TQI A;  4DCT A;  4DUZ C;  1N32 C;  4D57 A;  3GKU A;  4RMN A;  1BA3 A;  2P20 A;  4JI5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...