4DR7C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 49
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr7C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr7C02
5BR8C 4DR6C 1MKYA 4DR4C 3T1HC 4JI2C 1N36C 1NYEA 4DR3C 4X65C 3J81D 1N33C 4YHHC 4BSZA 2VQFC 2ASBA 4NOZA 2JMPA 4X66C 4K0KC 2ONFA 2OPLA 3IEVA 3CJEA 3T1YC 2UUBC 1KKGA 3EERA 5LMNC 2ATWA 1HH2P 2KZFA 2UUCC 3J7AD 2CXCA 2E8EA 4JI0C 1J5EC 1HNZC 5FLXD 3LUSA 2YCBA 2OPLB 1USPA 4DV5C 2E8CA 4DV7C 4X64C 1WF3A 1N34C 4DR7C 4DV6C 1XMOC 4DV2C 1USPB 4LF8C 1QWIA 1WH9A 1XNRC 3R9WA 2HHHC 4LFAC 4YY3C 1UKKA 4DV0C 4JV5C 4GKKC 2HJGA 4DV4C 4JI5C 4NXMC 2E7GA 1XMQC 1N2FA 1HR0C 4LFCC 4KHPC 4MH4A 4GKJC 2QL8A 1K0RA 1HNXC 5LMUC 2DYJA 1HNWC 4LF5C 4LF4C 1XNQC 3I07A 2XR1A 4LF7C 2D7VA 4XX2A 3AF6A 1LQLA 4DR2C 4JI8C 4DR1C 4B3SC 2EGTA 4NXNC 4X62C 1I94C 3J80D 1ML8A 3JAMD 2UXDC 1VLAA 1N32C 1EGAA 3IEUA 4DR5C 3AF5A 1IBLC 1JOSA 4DV1C 4LFBC 2E8FA 5A2QD 4JYAC 2VQEC 3R9XA 4B3RC 2PN2A 3GKUA 4OX9C 4DV3C 4DCVA 4DCUA 4JI7C 4DCTA 1L2FA 4JI6C 4JI1C 4DCSA 1PA4A 2PT7G 4B3TC 2UXCC 2BJOA 2UUAC 4JI3C 2E5LC 1ZB8A 4AQYC 4MTNA 4JI4C 4LF6C 2CY1A 1ZB9A 4B3MC 2ZM6C 1IBKC 4DUZC 3OTOC 5IT9D 4LF9C 4DUYC 1FJGC 2UU9C 2F4VC 5IWAC 2UXBC 1IBMC
chains in the Genus database with same CATH superfamily
2AYAA 4JI2C 4L7IA 1N36C 3RG2A 4BSZA 4I9FA 4I9GA 4RVNA 5T8TA 4PUIA 4ISBA 2ZZNA 5CZVA 3IEVA 2E0GA 1KKGA 3EERA 5A1GA 1MXCA 1IB8A 1WCJA 3GR1A 4L2ZA 2KDNA 2CXCA 3CQ2A 3E7XA 5FLXD 3CW8X 4RLQA 1USPA 1M6XA 2P2QA 3IPLA 4RM2A 1T5HX 4DR7C 3B7WA 1XMOC 3UEBA 1YJ7A 4FUTA 4FUQA 3IMLA 2VZEA 2WD9A 3UOWA 2P02A 2P2FA 4GKKC 2BH1X 2P2BA 3LGXA 4KHPC 2YWBA 4BBYA 1XRAA 1MDFA 4RMNA 2DYJA 1HNWC 4G37A 4LF5C 3FCCA 4BCAA 4OYCA 1MXBA 3VNQA 3ETCA 1LQLA 1QM4A 4DR1C 3E7WA 1I94C 4ODJA 3JAMD 2UXDC 1VLAA 1N32C 1EGAA 4DV1C 5BSRA 1FLOA 4LFBC 5ADZA 4PROC 2VQEC 2KZ0A 2PN2A 1NY8A 4DCUA 1V26A 4BC7A 3K6RA 1PG3A 4D4GA 2UXCC 5A19A 4JI4C 1AMUA 2CU6A 1ULTA 1BA3A 1PG4A 3OTOC 1FJGC 2F4VC 4EATA 3A9UA 5BSTA 5BR8C 4D4IA 3T1HC 3PESA 1PU1A 1NYEA 3J81D 3VNSA 4YHHC 3R44A 1RG9A 2JMPA 4K0KC 2ONFA 4U5YD 3N2QA 3CJEA 5BSUA 3UX2A 5AE2A 3T1YC 2WP0C 5LMNC 2ATWA 3GPCA 3TQIA 1HNZC 1TH5A 1XRBA 3LUSA 2OPLB 3CW9A 4R1LA 5BUSA 1M6XC 2E8CA 4RVOA 2ZTBA 5CZXA 2D1RA 2Y27A 4DV7C 1N34C 4DV2C 4LF8C 2P2JA 3R9WA 2MM9A 4GS5A 2M5HA 4PZPA 4DV4C 4NXMC 1XMQC 1HR0C 4LE5A 4D57A 4GKJC 2QVZX 4GXQA 2QL8A 3KXWA 2V7BA 1VEHA 1HNXC 1XHJA 5LMUC 3CQ3A 1XNQC 2Y4OA 4XX2A 3AF6A 5IFIA 4B3SC 3A26A 2QVYX 4DR5C 3NYQA 1O92A 2OBVA 3GKUA 2JNVA 4DCVA 2D27A 4WV3A 4JI7C 4DCTA 1T5DX 2Z51A 3CQ1A 5BSVA 4DCSA 2PT7G 3LNOA 4B3TC 2BJOA 4FTFA 2E5LC 4AQYC 5KYVA 1MDBA 4LF6C 2YX1A 3S82A 2MMAB 4DUZC 4ZJZA 5IT9D 1YGTA 3DAYA 1IBMC 1RY2A 4PUGA 4DR6C 1MKYA 4PUHA 1O90A 4NDNA 2DPLA 4X65C 3LNVA 2ASBA 1FUGA 4IZ6A 4NOZA 4JM1A 5K8FA 2OPLA 2D1TA 2QW0X 3PBKA 1V60A 3LAXA 2DHMA 2KZFA 3UZ0A 5BSWA 1J5EC 3A9VA 3UX3A 3C5EA 4DV5C 1P4EA 1WF3A 2OO4A 4DV6C 2MCQA 1USPB 2M5OA 2D1SA 5KYTA 5H9UA 4YY3C 1UKKA 4DV0C 2PG1E 2PROA 4JV5C 2HJGA 4JI5C 2E7GA 1XS3A 4MH4A 4TPSB 4IR7A 3EQ6A 1K0RA 5AE1A 4RLFA 4BC9A 4R0MA 2XR1A 4LF7C 1XRCA 4JI8C 4OXIA 2EGTA 2P2MA 3L95X 3NI2A 3J80D 5JRHA 3IEUA 5BURA 2ZZMA 1LCIA 3AF5A 1JOSA 1IBLC 1XDXA 3R9XA 4OX9C 4DV3C 1O93A 1MXAA 3RV2A 1GPMA 4JI6C 1PA4A 3L8CA 2UUAC 4JI3C 1MD9A 3GR0A 4KTTA 2CY1A 4B3MC 5BSMA 4DUYC 1UWDA 2Y4NA 2YWCA 3PROC 5AE3A 4DR4C 2D28C 4D56A 4DR3C 3DLPX 1N33C 4DG9A 3AY0A 2VQFC 3DHVA 3A4IA 4X66C 3SO4A 2D1QA 2UUBC 3VNRA 1HH2P 2UUCC 3J7AD 2E8EA 4JI0C 5LCIA 4R1MA 2YCBA 4G36A 4PHTA 1P4EC 3TUFA 4WS9A 5K85A 4X64C 5T8SA 3O2EA 4GXRA 3FM7A 1QWIA 1WH9A 1XNRC 4L4QA 2HHHC 4LFAC 4K0BA 4ZLPA 3TDEA 1N2FA 4LFCC 2QVXX 2VSQA 2P20A 4LF4C 3NYRA 3I07A 5BUQA 5DV9A 5KEIA 2D7VA 4DR2C 4NXNC 4G1IA 4X62C 1ML8A 1P7LA 3H2TA 2E8FA 5A2QD 4JYAC 4B3RC 4DG8A 3I08A 3FCEA 3A25A 4KTVA 3G7SA 1L2FA 5E7QA 2NCLA 4JI1C 1ZB8A 4MTNA 3NPDA 3N54B 1ZB9A 3TR3A 2ZM6C 1IBKC 1O9TA 4RM3A 4LF9C 4HPVA 1V25A 5GTDA 5IWAC 2UU9C 5A1IA 2UXBC 3ETOA
chains in the Genus database with same CATH topology
2AYAA 4JI2C 4L7IA 1N36C 3RG2A 4BSZA 4I9FA 4I9GA 4RVNA 5T8TA 4ISBA 5CZVA 3IEVA 2E0GA 1KKGA 3EERA 5A1GA 1MXCA 3GR1A 4L2ZA 2CXCA 3E7XA 5FLXD 3CW8X 4RLQA 1USPA 2P2QA 3IPLA 4RM2A 1T5HX 4DR7C 3B7WA 1XMOC 1YJ7A 4FUTA 4FUQA 3IMLA 2VZEA 2WD9A 3UOWA 2P02A 2P2FA 4GKKC 2BH1X 2P2BA 3LGXA 4KHPC 2YWBA 4BBYA 1XRAA 1MDFA 4RMNA 2DYJA 1HNWC 4G37A 4LF5C 3FCCA 4BCAA 4OYCA 1MXBA 3VNQA 3ETCA 1LQLA 1QM4A 4DR1C 3E7WA 1I94C 4ODJA 3JAMD 2UXDC 1VLAA 1N32C 1EGAA 4DV1C 5BSRA 4LFBC 5ADZA 4PROC 2VQEC 2PN2A 4DCUA 1V26A 4BC7A 1PG3A 4D4GA 2UXCC 5A19A 4JI4C 1AMUA 1ULTA 1BA3A 1PG4A 3OTOC 1FJGC 2F4VC 4EATA 3A9UA 5BSTA 5BR8C 4D4IA 3T1HC 3PESA 1NYEA 3J81D 3VNSA 4YHHC 3R44A 1RG9A 2JMPA 4K0KC 2ONFA 4U5YD 3N2QA 3CJEA 5BSUA 5AE2A 3T1YC 2WP0C 5LMNC 2ATWA 3GPCA 3TQIA 1HNZC 1XRBA 3LUSA 2OPLB 3CW9A 4R1LA 5BUSA 2E8CA 4RVOA 5CZXA 2D1RA 2Y27A 4DV7C 1N34C 4DV2C 4LF8C 2P2JA 3R9WA 4GS5A 4PZPA 4DV4C 4NXMC 1XMQC 1HR0C 4LE5A 4D57A 4GKJC 2QVZX 4GXQA 2QL8A 3KXWA 2V7BA 1HNXC 5LMUC 1XNQC 2Y4OA 4XX2A 3AF6A 5IFIA 4B3SC 2QVYX 4DR5C 3NYQA 1O92A 2OBVA 3GKUA 4DCVA 2D27A 4WV3A 4JI7C 4DCTA 1T5DX 5BSVA 4DCSA 2PT7G 4B3TC 2BJOA 4FTFA 2E5LC 4AQYC 5KYVA 1MDBA 4LF6C 3S82A 4DUZC 4ZJZA 5IT9D 3DAYA 1IBMC 1RY2A 4DR6C 1MKYA 1O90A 4NDNA 2DPLA 4X65C 3LNVA 2ASBA 1FUGA 4IZ6A 4NOZA 4JM1A 5K8FA 2OPLA 2D1TA 2QW0X 3PBKA 3LAXA 2KZFA 3UZ0A 5BSWA 1J5EC 3A9VA 3C5EA 4DV5C 1WF3A 2OO4A 4DV6C 1USPB 2D1SA 5KYTA 5H9UA 4YY3C 1UKKA 4DV0C 2PROA 4JV5C 2HJGA 4JI5C 2E7GA 4MH4A 4TPSB 4IR7A 3EQ6A 1K0RA 5AE1A 4RLFA 4BC9A 4R0MA 2XR1A 4LF7C 1XRCA 4JI8C 4OXIA 2EGTA 2P2MA 3L95X 3NI2A 3J80D 5JRHA 3IEUA 5BURA 1LCIA 3AF5A 1JOSA 1IBLC 3R9XA 4OX9C 4DV3C 1O93A 1MXAA 3RV2A 1GPMA 4JI6C 1PA4A 3L8CA 2UUAC 4JI3C 1MD9A 3GR0A 4KTTA 2CY1A 4B3MC 5BSMA 4DUYC 2Y4NA 2YWCA 3PROC 5AE3A 4DR4C 2D28C 4D56A 4DR3C 3DLPX 1N33C 4DG9A 2VQFC 3DHVA 3A4IA 4X66C 3SO4A 2D1QA 2UUBC 3VNRA 1HH2P 2UUCC 3J7AD 2E8EA 4JI0C 4R1MA 2YCBA 4G36A 4PHTA 3TUFA 4WS9A 5K85A 4X64C 5T8SA 4GXRA 1QWIA 1WH9A 1XNRC 4L4QA 2HHHC 4LFAC 4K0BA 4ZLPA 3TDEA 1N2FA 4LFCC 2QVXX 2VSQA 2P20A 4LF4C 3NYRA 3I07A 5BUQA 5DV9A 5KEIA 2D7VA 4DR2C 4NXNC 4G1IA 4X62C 1ML8A 1P7LA 3H2TA 2E8FA 5A2QD 4JYAC 4B3RC 4DG8A 3I08A 3FCEA 4KTVA 3G7SA 1L2FA 5E7QA 4JI1C 1ZB8A 4MTNA 3NPDA 3N54B 1ZB9A 2ZM6C 1IBKC 1O9TA 4RM3A 4LF9C 4HPVA 1V25A 5GTDA 5IWAC 2UU9C 5A1IA 2UXBC 3ETOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 C;  4DR6 C;  1MKY A;  4DR4 C;  3T1H C;  4JI2 C;  1N36 C;  1NYE A;  4DR3 C;  4X65 C;  3J81 D;  1N33 C;  4YHH C;  4BSZ A;  2VQF C;  2ASB A;  4NOZ A;  2JMP A;  4X66 C;  4K0K C;  2ONF A;  2OPL A;  3IEV A;  3CJE A;  3T1Y C;  2UUB C;  1KKG A;  3EER A;  5LMN C;  2ATW A;  1HH2 P;  2KZF A;  2UUC C;  3J7A D;  2CXC A;  2E8E A;  4JI0 C;  1J5E C;  1HNZ C;  5FLX D;  3LUS A;  2YCB A;  2OPL B;  1USP A;  4DV5 C;  2E8C A;  4DV7 C;  4X64 C;  1WF3 A;  1N34 C;  4DR7 C;  4DV6 C;  1XMO C;  4DV2 C;  1USP B;  4LF8 C;  1QWI A;  1WH9 A;  1XNR C;  3R9W A;  2HHH C;  4LFA C;  4YY3 C;  1UKK A;  4DV0 C;  4JV5 C;  4GKK C;  2HJG A;  4DV4 C;  4JI5 C;  4NXM C;  2E7G A;  1XMQ C;  1N2F A;  1HR0 C;  4LFC C;  4KHP C;  4MH4 A;  4GKJ C;  2QL8 A;  1K0R A;  1HNX C;  5LMU C;  2DYJ A;  1HNW C;  4LF5 C;  4LF4 C;  1XNQ C;  3I07 A;  2XR1 A;  4LF7 C;  2D7V A;  4XX2 A;  3AF6 A;  1LQL A;  4DR2 C;  4JI8 C;  4DR1 C;  4B3S C;  2EGT A;  4NXN C;  4X62 C;  1I94 C;  3J80 D;  1ML8 A;  3JAM D;  2UXD C;  1VLA A;  1N32 C;  1EGA A;  3IEU A;  4DR5 C;  3AF5 A;  1IBL C;  1JOS A;  4DV1 C;  4LFB C;  2E8F A;  5A2Q D;  4JYA C;  2VQE C;  3R9X A;  4B3R C;  2PN2 A;  3GKU A;  4OX9 C;  4DV3 C;  4DCV A;  4DCU A;  4JI7 C;  4DCT A;  1L2F A;  4JI6 C;  4JI1 C;  4DCS A;  1PA4 A;  2PT7 G;  4B3T C;  2UXC C;  2BJO A;  2UUA C;  4JI3 C;  2E5L C;  1ZB8 A;  4AQY C;  4MTN A;  4JI4 C;  4LF6 C;  2CY1 A;  1ZB9 A;  4B3M C;  2ZM6 C;  1IBK C;  4DUZ C;  3OTO C;  5IT9 D;  4LF9 C;  4DUY C;  1FJG C;  2UU9 C;  2F4V C;  5IWA C;  2UXB C;  1IBM C; 
#chains in the Genus database with same CATH topology
 2AYA A;  4JI2 C;  4L7I A;  1N36 C;  3RG2 A;  4BSZ A;  4I9F A;  4I9G A;  4RVN A;  5T8T A;  4PUI A;  4ISB A;  2ZZN A;  5CZV A;  3IEV A;  2E0G A;  1KKG A;  3EER A;  5A1G A;  1MXC A;  1IB8 A;  1WCJ A;  3GR1 A;  4L2Z A;  2KDN A;  2CXC A;  3CQ2 A;  3E7X A;  5FLX D;  3CW8 X;  4RLQ A;  1USP A;  1M6X A;  2P2Q A;  3IPL A;  4RM2 A;  1T5H X;  4DR7 C;  3B7W A;  1XMO C;  3UEB A;  1YJ7 A;  4FUT A;  4FUQ A;  3IML A;  2VZE A;  2WD9 A;  3UOW A;  2P02 A;  2P2F A;  4GKK C;  2BH1 X;  2P2B A;  3LGX A;  4KHP C;  2YWB A;  4BBY A;  1XRA A;  1MDF A;  4RMN A;  2DYJ A;  1HNW C;  4G37 A;  4LF5 C;  3FCC A;  4BCA A;  4OYC A;  1MXB A;  3VNQ A;  3ETC A;  1LQL A;  1QM4 A;  4DR1 C;  3E7W A;  1I94 C;  4ODJ A;  3JAM D;  2UXD C;  1VLA A;  1N32 C;  1EGA A;  4DV1 C;  5BSR A;  1FLO A;  4LFB C;  5ADZ A;  4PRO C;  2VQE C;  2KZ0 A;  2PN2 A;  1NY8 A;  4DCU A;  1V26 A;  4BC7 A;  3K6R A;  1PG3 A;  4D4G A;  2UXC C;  5A19 A;  4JI4 C;  1AMU A;  2CU6 A;  1ULT A;  1BA3 A;  1PG4 A;  3OTO C;  1FJG C;  2F4V C;  4EAT A;  3A9U A;  5BST A;  5BR8 C;  4D4I A;  3T1H C;  3PES A;  1PU1 A;  1NYE A;  3J81 D;  3VNS A;  4YHH C;  3R44 A;  1RG9 A;  2JMP A;  4K0K C;  2ONF A;  4U5Y D;  3N2Q A;  3CJE A;  5BSU A;  3UX2 A;  5AE2 A;  3T1Y C;  2WP0 C;  5LMN C;  2ATW A;  3GPC A;  3TQI A;  1HNZ C;  1TH5 A;  1XRB A;  3LUS A;  2OPL B;  3CW9 A;  4R1L A;  5BUS A;  1M6X C;  2E8C A;  4RVO A;  2ZTB A;  5CZX A;  2D1R A;  2Y27 A;  4DV7 C;  1N34 C;  4DV2 C;  4LF8 C;  2P2J A;  3R9W A;  2MM9 A;  4GS5 A;  2M5H A;  4PZP A;  4DV4 C;  4NXM C;  1XMQ C;  1HR0 C;  4LE5 A;  4D57 A;  4GKJ C;  2QVZ X;  4GXQ A;  2QL8 A;  3KXW A;  2V7B A;  1VEH A;  1HNX C;  1XHJ A;  5LMU C;  3CQ3 A;  1XNQ C;  2Y4O A;  4XX2 A;  3AF6 A;  5IFI A;  4B3S C;  3A26 A;  2QVY X;  4DR5 C;  3NYQ A;  1O92 A;  2OBV A;  3GKU A;  2JNV A;  4DCV A;  2D27 A;  4WV3 A;  4JI7 C;  4DCT A;  1T5D X;  2Z51 A;  3CQ1 A;  5BSV A;  4DCS A;  2PT7 G;  3LNO A;  4B3T C;  2BJO A;  4FTF A;  2E5L C;  4AQY C;  5KYV A;  1MDB A;  4LF6 C;  2YX1 A;  3S82 A;  2MMA B;  4DUZ C;  4ZJZ A;  5IT9 D;  1YGT A;  3DAY A;  1IBM C;  1RY2 A;  4PUG A;  4DR6 C;  1MKY A;  4PUH A;  1O90 A;  4NDN A;  2DPL A;  4X65 C;  3LNV A;  2ASB A;  1FUG A;  4IZ6 A;  4NOZ A;  4JM1 A;  5K8F A;  2OPL A;  2D1T A;  2QW0 X;  3PBK A;  1V60 A;  3LAX A;  2DHM A;  2KZF A;  3UZ0 A;  5BSW A;  1J5E C;  3A9V A;  3UX3 A;  3C5E A;  4DV5 C;  1P4E A;  1WF3 A;  2OO4 A;  4DV6 C;  2MCQ A;  1USP B;  2M5O A;  2D1S A;  5KYT A;  5H9U A;  4YY3 C;  1UKK A;  4DV0 C;  2PG1 E;  2PRO A;  4JV5 C;  2HJG A;  4JI5 C;  2E7G A;  1XS3 A;  4MH4 A;  4TPS B;  4IR7 A;  3EQ6 A;  1K0R A;  5AE1 A;  4RLF A;  4BC9 A;  4R0M A;  2XR1 A;  4LF7 C;  1XRC A;  4JI8 C;  4OXI A;  2EGT A;  2P2M A;  3L95 X;  3NI2 A;  3J80 D;  5JRH A;  3IEU A;  5BUR A;  2ZZM A;  1LCI A;  3AF5 A;  1JOS A;  1IBL C;  1XDX A;  3R9X A;  4OX9 C;  4DV3 C;  1O93 A;  1MXA A;  3RV2 A;  1GPM A;  4JI6 C;  1PA4 A;  3L8C A;  2UUA C;  4JI3 C;  1MD9 A;  3GR0 A;  4KTT A;  2CY1 A;  4B3M C;  5BSM A;  4DUY C;  1UWD A;  2Y4N A;  2YWC A;  3PRO C;  5AE3 A;  4DR4 C;  2D28 C;  4D56 A;  4DR3 C;  3DLP X;  1N33 C;  4DG9 A;  3AY0 A;  2VQF C;  3DHV A;  3A4I A;  4X66 C;  3SO4 A;  2D1Q A;  2UUB C;  3VNR A;  1HH2 P;  2UUC C;  3J7A D;  2E8E A;  4JI0 C;  5LCI A;  4R1M A;  2YCB A;  4G36 A;  4PHT A;  1P4E C;  3TUF A;  4WS9 A;  5K85 A;  4X64 C;  5T8S A;  3O2E A;  4GXR A;  3FM7 A;  1QWI A;  1WH9 A;  1XNR C;  4L4Q A;  2HHH C;  4LFA C;  4K0B A;  4ZLP A;  3TDE A;  1N2F A;  4LFC C;  2QVX X;  2VSQ A;  2P20 A;  4LF4 C;  3NYR A;  3I07 A;  5BUQ A;  5DV9 A;  5KEI A;  2D7V A;  4DR2 C;  4NXN C;  4G1I A;  4X62 C;  1ML8 A;  1P7L A;  3H2T A;  2E8F A;  5A2Q D;  4JYA C;  4B3R C;  4DG8 A;  3I08 A;  3FCE A;  3A25 A;  4KTV A;  3G7S A;  1L2F A;  5E7Q A;  2NCL A;  4JI1 C;  1ZB8 A;  4MTN A;  3NPD A;  3N54 B;  1ZB9 A;  3TR3 A;  2ZM6 C;  1IBK C;  1O9T A;  4RM3 A;  4LF9 C;  4HPV A;  1V25 A;  5GTD A;  5IWA C;  2UU9 C;  5A1I A;  2UXB C;  3ETO A; 
#chains in the Genus database with same CATH homology
 2AYA A;  4JI2 C;  4L7I A;  1N36 C;  3RG2 A;  4BSZ A;  4I9F A;  4I9G A;  4RVN A;  5T8T A;  4ISB A;  5CZV A;  3IEV A;  2E0G A;  1KKG A;  3EER A;  5A1G A;  1MXC A;  3GR1 A;  4L2Z A;  2CXC A;  3E7X A;  5FLX D;  3CW8 X;  4RLQ A;  1USP A;  2P2Q A;  3IPL A;  4RM2 A;  1T5H X;  4DR7 C;  3B7W A;  1XMO C;  1YJ7 A;  4FUT A;  4FUQ A;  3IML A;  2VZE A;  2WD9 A;  3UOW A;  2P02 A;  2P2F A;  4GKK C;  2BH1 X;  2P2B A;  3LGX A;  4KHP C;  2YWB A;  4BBY A;  1XRA A;  1MDF A;  4RMN A;  2DYJ A;  1HNW C;  4G37 A;  4LF5 C;  3FCC A;  4BCA A;  4OYC A;  1MXB A;  3VNQ A;  3ETC A;  1LQL A;  1QM4 A;  4DR1 C;  3E7W A;  1I94 C;  4ODJ A;  3JAM D;  2UXD C;  1VLA A;  1N32 C;  1EGA A;  4DV1 C;  5BSR A;  4LFB C;  5ADZ A;  4PRO C;  2VQE C;  2PN2 A;  4DCU A;  1V26 A;  4BC7 A;  1PG3 A;  4D4G A;  2UXC C;  5A19 A;  4JI4 C;  1AMU A;  1ULT A;  1BA3 A;  1PG4 A;  3OTO C;  1FJG C;  2F4V C;  4EAT A;  3A9U A;  5BST A;  5BR8 C;  4D4I A;  3T1H C;  3PES A;  1NYE A;  3J81 D;  3VNS A;  4YHH C;  3R44 A;  1RG9 A;  2JMP A;  4K0K C;  2ONF A;  4U5Y D;  3N2Q A;  3CJE A;  5BSU A;  5AE2 A;  3T1Y C;  2WP0 C;  5LMN C;  2ATW A;  3GPC A;  3TQI A;  1HNZ C;  1XRB A;  3LUS A;  2OPL B;  3CW9 A;  4R1L A;  5BUS A;  2E8C A;  4RVO A;  5CZX A;  2D1R A;  2Y27 A;  4DV7 C;  1N34 C;  4DV2 C;  4LF8 C;  2P2J A;  3R9W A;  4GS5 A;  4PZP A;  4DV4 C;  4NXM C;  1XMQ C;  1HR0 C;  4LE5 A;  4D57 A;  4GKJ C;  2QVZ X;  4GXQ A;  2QL8 A;  3KXW A;  2V7B A;  1HNX C;  5LMU C;  1XNQ C;  2Y4O A;  4XX2 A;  3AF6 A;  5IFI A;  4B3S C;  2QVY X;  4DR5 C;  3NYQ A;  1O92 A;  2OBV A;  3GKU A;  4DCV A;  2D27 A;  4WV3 A;  4JI7 C;  4DCT A;  1T5D X;  5BSV A;  4DCS A;  2PT7 G;  4B3T C;  2BJO A;  4FTF A;  2E5L C;  4AQY C;  5KYV A;  1MDB A;  4LF6 C;  3S82 A;  4DUZ C;  4ZJZ A;  5IT9 D;  3DAY A;  1IBM C;  1RY2 A;  4DR6 C;  1MKY A;  1O90 A;  4NDN A;  2DPL A;  4X65 C;  3LNV A;  2ASB A;  1FUG A;  4IZ6 A;  4NOZ A;  4JM1 A;  5K8F A;  2OPL A;  2D1T A;  2QW0 X;  3PBK A;  3LAX A;  2KZF A;  3UZ0 A;  5BSW A;  1J5E C;  3A9V A;  3C5E A;  4DV5 C;  1WF3 A;  2OO4 A;  4DV6 C;  1USP B;  2D1S A;  5KYT A;  5H9U A;  4YY3 C;  1UKK A;  4DV0 C;  2PRO A;  4JV5 C;  2HJG A;  4JI5 C;  2E7G A;  4MH4 A;  4TPS B;  4IR7 A;  3EQ6 A;  1K0R A;  5AE1 A;  4RLF A;  4BC9 A;  4R0M A;  2XR1 A;  4LF7 C;  1XRC A;  4JI8 C;  4OXI A;  2EGT A;  2P2M A;  3L95 X;  3NI2 A;  3J80 D;  5JRH A;  3IEU A;  5BUR A;  1LCI A;  3AF5 A;  1JOS A;  1IBL C;  3R9X A;  4OX9 C;  4DV3 C;  1O93 A;  1MXA A;  3RV2 A;  1GPM A;  4JI6 C;  1PA4 A;  3L8C A;  2UUA C;  4JI3 C;  1MD9 A;  3GR0 A;  4KTT A;  2CY1 A;  4B3M C;  5BSM A;  4DUY C;  2Y4N A;  2YWC A;  3PRO C;  5AE3 A;  4DR4 C;  2D28 C;  4D56 A;  4DR3 C;  3DLP X;  1N33 C;  4DG9 A;  2VQF C;  3DHV A;  3A4I A;  4X66 C;  3SO4 A;  2D1Q A;  2UUB C;  3VNR A;  1HH2 P;  2UUC C;  3J7A D;  2E8E A;  4JI0 C;  4R1M A;  2YCB A;  4G36 A;  4PHT A;  3TUF A;  4WS9 A;  5K85 A;  4X64 C;  5T8S A;  4GXR A;  1QWI A;  1WH9 A;  1XNR C;  4L4Q A;  2HHH C;  4LFA C;  4K0B A;  4ZLP A;  3TDE A;  1N2F A;  4LFC C;  2QVX X;  2VSQ A;  2P20 A;  4LF4 C;  3NYR A;  3I07 A;  5BUQ A;  5DV9 A;  5KEI A;  2D7V A;  4DR2 C;  4NXN C;  4G1I A;  4X62 C;  1ML8 A;  1P7L A;  3H2T A;  2E8F A;  5A2Q D;  4JYA C;  4B3R C;  4DG8 A;  3I08 A;  3FCE A;  4KTV A;  3G7S A;  1L2F A;  5E7Q A;  4JI1 C;  1ZB8 A;  4MTN A;  3NPD A;  3N54 B;  1ZB9 A;  2ZM6 C;  1IBK C;  1O9T A;  4RM3 A;  4LF9 C;  4HPV A;  1V25 A;  5GTD A;  5IWA C;  2UU9 C;  5A1I A;  2UXB C;  3ETO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...