4DR7C

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 49
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr7C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr7C02
2VQEC 4JI5C 3IEVA 1IBLC 1WF3A 4YY3C 1EGAA 1XMOC 1HR0C 1HNZC 2KZFA 3GKUA 4LFBC 4DV6C 1N2FA 4DR4C 1KKGA 4DV3C 2E8FA 4DV1C 2HHHC 3R9WA 4YHHC 1I94C 1MKYA 4MH4A 2JMPA 4JI3C 1NYEA 4JI4C 4DCSA 4JYAC 4DCUA 2CY1A 4NXMC 2UXDC 4B3TC 2D7VA 2ATWA 1ZB9A 4X62C 3AF5A 3J80D 1UKKA 1IBMC 2BJOA 4JI7C 2UUCC 3JAMD 4DUYC 1XNRC 4JI0C 3T1HC 3IEUA 3J7AD 4GKJC 1FJGC 4DCTA 4LF7C 4DV4C 1WH9A 2OPLA 2PN2A 1N36C 4DR6C 2OPLB 1L2FA 1HH2P 4DV2C 1VLAA 2HJGA 4MTNA 1K0RA 2ONFA 1XMQC 2E5LC 1LQLA 4XX2A 3CJEA 4NXNC 3EERA 4BSZA 4DR2C 1N32C 4DR5C 4LFCC 4LF9C 1HNWC 2XR1A 2ASBA 5BR8C 2PT7G 5A2QD 4JI6C 4DCVA 4JV5C 4DR1C 4OX9C 4DUZC 1XNQC 1ML8A 4JI1C 4B3RC 4JI2C 1J5EC 1ZB8A 2UUBC 2QL8A 1HNXC 2DYJA 1N34C 1QWIA 1JOSA 5IT9D 2E7GA 2VQFC 4LF4C 5FLXD 4JI8C 3OTOC 3T1YC 4DR3C 2E8EA 3R9XA 2UU9C 1IBKC 4LF5C 4NOZA 3LUSA 4AQYC 4K0KC 2E8CA 2ZM6C 2F4VC 3AF6A 2UXBC 4LF8C 1USPA 1USPB 4LFAC 4KHPC 4GKKC 2YCBA 4DV5C 3I07A 4B3MC 4DR7C 5LMUC 4X65C 5IWAC 2UUAC 2EGTA 4DV0C 1N33C 4DV7C 4B3SC 4X64C 1PA4A 5LMNC 4X66C 3J81D 2UXCC 4LF6C 2CXCA
chains in the Genus database with same CATH superfamily
4JI5C 3GR0A 4G37A 5DV9A 4L2ZA 1WF3A 1XDXA 1EGAA 1XMOC 1V26A 1M6XC 2Y4NA 1N2FA 3C5EA 2E8FA 3R9WA 4I9FA 1MKYA 3I08A 2NCLA 4R1LA 3CW8X 5AE2A 4PZPA 2P02A 4PUIA 3AF5A 1GPMA 2MMAB 4JI7C 4DUYC 1XNRC 4JI0C 1QM4A 4DG8A 2QW0X 2Z51A 4KTTA 5CZVA 4D56A 4GKJC 2D27A 1L2FA 1O9TA 4DV2C 4ISBA 1K0RA 5JRHA 1PG3A 3CJEA 5BSTA 5BUQA 4DR2C 3ETCA 2CU6A 4DR5C 1O90A 2XR1A 2YWBA 5BR8C 4JI6C 4DCVA 4JV5C 2P2FA 3E7XA 4JI1C 3ETOA 1V25A 3O2EA 2QL8A 4BBYA 1P4EA 4PUGA 1HNXC 2DYJA 4I9GA 1JOSA 3H2TA 3UOWA 4JI8C 2P2MA 4JM1A 3L8CA 5A1GA 2E8EA 3R9XA 3DLPX 5E7QA 5KYVA 3PROC 4FUTA 4GKKC 5BSUA 2Y4OA 4OXIA 4RVOA 2QVZX 1N33C 3VNQA 4X64C 1XRCA 2UXCC 3UEBA 2CXCA 2ZTBA 1TH5A 1HR0C 4IZ6A 2KZFA 2P20A 1PG4A 4PHTA 1FLOA 1MDFA 4MH4A 4DCSA 4RLFA 4R0MA 2D7VA 2ATWA 2DPLA 5AE1A 4FUQA 2Y27A 3FM7A 4U5YD 5BURA 3J7AD 3TUFA 4DV4C 1WH9A 1N36C 2OPLB 2VZEA 3LNOA 2MCQA 2HJGA 2D1RA 2E5LC 3R44A 3LAXA 1FUGA 4HPVA 4NDNA 4L7IA 2ZZNA 1N32C 2PG1E 4LFCC 2VSQA 5IFIA 4G36A 4BC9A 2ASBA 5A2QD 3VNRA 4RLQA 4OX9C 4ZLPA 1ML8A 3NPDA 1IB8A 5IT9D 3IMLA 2VQFC 2M5HA 5FLXD 2KDNA 3KXWA 1RG9A 4LF5C 1YJ7A 3GR1A 4PROC 4NOZA 3LUSA 2UXBC 4PUHA 1USPA 3NYRA 3VNSA 2D1TA 3PESA 2V7BA 2YCBA 3I07A 4B3MC 5KYTA 3RG2A 4X65C 3UX2A 3SO4A 1XHJA 4D57A 2P2BA 5LMNC 3IPLA 2D1QA 2OO4A 2D28C 3DHVA 4YY3C 2PROA 1M6XA 3GKUA 4DV6C 3G7SA 4D4IA 1O93A 5GTDA 4G1IA 2OBVA 2ZZMA 4JI4C 5BSMA 4JYAC 2UXDC 4B3TC 1NY8A 1ZB9A 1IBMC 3LNVA 4EATA 3TR3A 3RV2A 2UUCC 1BA3A 5BSRA 3T1HC 4RM3A 3IEUA 1FJGC 3L95X 1YGTA 4DCTA 4LF7C 4DR6C 2PN2A 1AMUA 5ADZA 1XS3A 4K0BA 1HH2P 1P7LA 3E7WA 3PBKA 2D1SA 3LGXA 1UWDA 1XMQC 1LQLA 3CW9A 1RY2A 4RVNA 4NXNC 3TQIA 4GXQA 3UZ0A 3EERA 4ZJZA 4LF9C 4FTFA 1HNWC 5BUSA 3S82A 2PT7G 4B3RC 1P4EC 1J5EC 1MD9A 1MXBA 4RMNA 1N34C 5T8SA 4LF4C 3T1YC 4DR3C 2JNVA 2MM9A 3TDEA 1T5DX 4AQYC 4GS5A 1PU1A 2WP0C 2E8CA 2F4VC 5H9UA 3AF6A 3CQ3A 2M5OA 4LFAC 3K6RA 3AY0A 4BCAA 4DV5C 3DAYA 4DR7C 5LMUC 2QVXX 2P2JA 5IWAC 5K8FA 2EGTA 4DV0C 4B3SC 3GPCA 3B7WA 4DG9A 4X66C 3J81D 5CZXA 5KEIA 4LF6C 1MXCA 2VQEC 2WD9A 3IEVA 3CQ2A 1IBLC 5AE3A 1HNZC 1ULTA 4LFBC 4IR7A 1LCIA 3A4IA 4DR4C 1KKGA 4DV3C 3FCCA 4DV1C 2HHHC 4YHHC 1I94C 2JMPA 4JI3C 2BH1X 1NYEA 4DCUA 2CY1A 4NXMC 4WV3A 1T5HX 2KZ0A 3A9VA 4X62C 3J80D 1UKKA 3A25A 2BJOA 4D4GA 2P2QA 1MDBA 2AYAA 3JAMD 2YX1A 4R1MA 1O92A 2OPLA 4ODJA 1VLAA 5T8TA 1MXAA 4MTNA 2ONFA 4XX2A 3NI2A 5K85A 4BSZA 3N2QA 5BSWA 4L4QA 4OYCA 2YWCA 1XRBA 1WCJA 4DR1C 4DUZC 1XNQC 4RM2A 4LE5A 4JI2C 1ZB8A 2UUBC 3EQ6A 1QWIA 2E0GA 3A9UA 2E7GA 4TPSB 3OTOC 2UU9C 1IBKC 4K0KC 1VEHA 1XRAA 2DHMA 2ZM6C 3FCEA 4GXRA 4LF8C 1USPB 5LCIA 4KHPC 2QVYX 3NYQA 3CQ1A 2UUAC 5A1IA 4KTVA 4DV7C 4WS9A 3UX3A 1PA4A 1V60A 5BSVA 3A26A 3N54B 4BC7A 5A19A
chains in the Genus database with same CATH topology
4JI5C 3GR0A 4G37A 5DV9A 4L2ZA 1WF3A 1EGAA 1XMOC 1V26A 2Y4NA 1N2FA 3C5EA 2E8FA 3R9WA 4I9FA 1MKYA 3I08A 4R1LA 3CW8X 5AE2A 4PZPA 2P02A 3AF5A 1GPMA 4JI7C 4DUYC 1XNRC 4JI0C 1QM4A 4DG8A 2QW0X 4KTTA 5CZVA 4D56A 4GKJC 2D27A 1L2FA 1O9TA 4DV2C 4ISBA 1K0RA 5JRHA 1PG3A 3CJEA 5BSTA 5BUQA 4DR2C 3ETCA 4DR5C 1O90A 2XR1A 2YWBA 5BR8C 4JI6C 4DCVA 4JV5C 2P2FA 3E7XA 4JI1C 3ETOA 1V25A 2QL8A 4BBYA 1HNXC 2DYJA 4I9GA 1JOSA 3H2TA 3UOWA 4JI8C 2P2MA 4JM1A 3L8CA 5A1GA 2E8EA 3R9XA 3DLPX 5E7QA 5KYVA 3PROC 4FUTA 4GKKC 5BSUA 2Y4OA 4OXIA 4RVOA 2QVZX 1N33C 3VNQA 4X64C 1XRCA 2UXCC 2CXCA 1HR0C 4IZ6A 2KZFA 2P20A 1PG4A 4PHTA 1MDFA 4MH4A 4DCSA 4RLFA 4R0MA 2D7VA 2ATWA 2DPLA 5AE1A 4FUQA 2Y27A 4U5YD 5BURA 3J7AD 3TUFA 4DV4C 1WH9A 1N36C 2OPLB 2VZEA 2HJGA 2D1RA 2E5LC 3R44A 3LAXA 1FUGA 4HPVA 4NDNA 4L7IA 1N32C 4LFCC 2VSQA 5IFIA 4G36A 4BC9A 2ASBA 5A2QD 3VNRA 4RLQA 4OX9C 4ZLPA 1ML8A 3NPDA 5IT9D 3IMLA 2VQFC 5FLXD 3KXWA 1RG9A 4LF5C 1YJ7A 3GR1A 4PROC 4NOZA 3LUSA 2UXBC 1USPA 3NYRA 3VNSA 2D1TA 3PESA 2V7BA 2YCBA 3I07A 4B3MC 5KYTA 3RG2A 4X65C 3SO4A 4D57A 2P2BA 5LMNC 3IPLA 2D1QA 2OO4A 2D28C 3DHVA 4YY3C 2PROA 3GKUA 4DV6C 3G7SA 4D4IA 1O93A 5GTDA 4G1IA 2OBVA 4JI4C 5BSMA 4JYAC 2UXDC 4B3TC 1ZB9A 1IBMC 3LNVA 4EATA 2UUCC 3RV2A 1BA3A 5BSRA 3T1HC 4RM3A 3IEUA 1FJGC 3L95X 4DCTA 4LF7C 4DR6C 2PN2A 1AMUA 5ADZA 4K0BA 1HH2P 1P7LA 3E7WA 3PBKA 2D1SA 3LGXA 1XMQC 1LQLA 3CW9A 1RY2A 4RVNA 4NXNC 3TQIA 4GXQA 3UZ0A 3EERA 4ZJZA 4LF9C 4FTFA 1HNWC 5BUSA 3S82A 2PT7G 4B3RC 1J5EC 1MD9A 1MXBA 4RMNA 1N34C 5T8SA 4LF4C 3T1YC 4DR3C 3TDEA 1T5DX 4AQYC 4GS5A 2WP0C 2E8CA 2F4VC 5H9UA 3AF6A 4LFAC 4BCAA 4DV5C 3DAYA 4DR7C 5LMUC 2QVXX 2P2JA 5IWAC 5K8FA 2EGTA 4DV0C 4B3SC 3GPCA 3B7WA 4DG9A 4X66C 3J81D 5CZXA 5KEIA 4LF6C 1MXCA 2VQEC 2WD9A 3IEVA 1IBLC 5AE3A 1HNZC 1ULTA 4LFBC 4IR7A 1LCIA 3A4IA 4DR4C 1KKGA 4DV3C 3FCCA 4DV1C 2HHHC 4YHHC 1I94C 2JMPA 4JI3C 2BH1X 1NYEA 4DCUA 2CY1A 4NXMC 4WV3A 1T5HX 3A9VA 4X62C 3J80D 1UKKA 2BJOA 4D4GA 2P2QA 1MDBA 2AYAA 3JAMD 4R1MA 1O92A 2OPLA 4ODJA 1VLAA 5T8TA 1MXAA 4MTNA 2ONFA 4XX2A 3NI2A 5K85A 4BSZA 3N2QA 5BSWA 4L4QA 4OYCA 2YWCA 1XRBA 4DR1C 4DUZC 1XNQC 4RM2A 4LE5A 4JI2C 1ZB8A 2UUBC 3EQ6A 1QWIA 2E0GA 3A9UA 2E7GA 4TPSB 3OTOC 2UU9C 1IBKC 4K0KC 1XRAA 2ZM6C 3FCEA 4GXRA 4LF8C 1USPB 4KHPC 2QVYX 3NYQA 2UUAC 5A1IA 4KTVA 4DV7C 4WS9A 1PA4A 5BSVA 3N54B 4BC7A 5A19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE C;  4JI5 C;  3IEV A;  1IBL C;  1WF3 A;  4YY3 C;  1EGA A;  1XMO C;  1HR0 C;  1HNZ C;  2KZF A;  3GKU A;  4LFB C;  4DV6 C;  1N2F A;  4DR4 C;  1KKG A;  4DV3 C;  2E8F A;  4DV1 C;  2HHH C;  3R9W A;  4YHH C;  1I94 C;  1MKY A;  4MH4 A;  2JMP A;  4JI3 C;  1NYE A;  4JI4 C;  4DCS A;  4JYA C;  4DCU A;  2CY1 A;  4NXM C;  2UXD C;  4B3T C;  2D7V A;  2ATW A;  1ZB9 A;  4X62 C;  3AF5 A;  3J80 D;  1UKK A;  1IBM C;  2BJO A;  4JI7 C;  2UUC C;  3JAM D;  4DUY C;  1XNR C;  4JI0 C;  3T1H C;  3IEU A;  3J7A D;  4GKJ C;  1FJG C;  4DCT A;  4LF7 C;  4DV4 C;  1WH9 A;  2OPL A;  2PN2 A;  1N36 C;  4DR6 C;  2OPL B;  1L2F A;  1HH2 P;  4DV2 C;  1VLA A;  2HJG A;  4MTN A;  1K0R A;  2ONF A;  1XMQ C;  2E5L C;  1LQL A;  4XX2 A;  3CJE A;  4NXN C;  3EER A;  4BSZ A;  4DR2 C;  1N32 C;  4DR5 C;  4LFC C;  4LF9 C;  1HNW C;  2XR1 A;  2ASB A;  5BR8 C;  2PT7 G;  5A2Q D;  4JI6 C;  4DCV A;  4JV5 C;  4DR1 C;  4OX9 C;  4DUZ C;  1XNQ C;  1ML8 A;  4JI1 C;  4B3R C;  4JI2 C;  1J5E C;  1ZB8 A;  2UUB C;  2QL8 A;  1HNX C;  2DYJ A;  1N34 C;  1QWI A;  1JOS A;  5IT9 D;  2E7G A;  2VQF C;  4LF4 C;  5FLX D;  4JI8 C;  3OTO C;  3T1Y C;  4DR3 C;  2E8E A;  3R9X A;  2UU9 C;  1IBK C;  4LF5 C;  4NOZ A;  3LUS A;  4AQY C;  4K0K C;  2E8C A;  2ZM6 C;  2F4V C;  3AF6 A;  2UXB C;  4LF8 C;  1USP A;  1USP B;  4LFA C;  4KHP C;  4GKK C;  2YCB A;  4DV5 C;  3I07 A;  4B3M C;  4DR7 C;  5LMU C;  4X65 C;  5IWA C;  2UUA C;  2EGT A;  4DV0 C;  1N33 C;  4DV7 C;  4B3S C;  4X64 C;  1PA4 A;  5LMN C;  4X66 C;  3J81 D;  2UXC C;  4LF6 C;  2CXC A; 
#chains in the Genus database with same CATH topology
 4JI5 C;  3GR0 A;  4G37 A;  5DV9 A;  4L2Z A;  1WF3 A;  1XDX A;  1EGA A;  1XMO C;  1V26 A;  1M6X C;  2Y4N A;  1N2F A;  3C5E A;  2E8F A;  3R9W A;  4I9F A;  1MKY A;  3I08 A;  2NCL A;  4R1L A;  3CW8 X;  5AE2 A;  4PZP A;  2P02 A;  4PUI A;  3AF5 A;  1GPM A;  2MMA B;  4JI7 C;  4DUY C;  1XNR C;  4JI0 C;  1QM4 A;  4DG8 A;  2QW0 X;  2Z51 A;  4KTT A;  5CZV A;  4D56 A;  4GKJ C;  2D27 A;  1L2F A;  1O9T A;  4DV2 C;  4ISB A;  1K0R A;  5JRH A;  1PG3 A;  3CJE A;  5BST A;  5BUQ A;  4DR2 C;  3ETC A;  2CU6 A;  4DR5 C;  1O90 A;  2XR1 A;  2YWB A;  5BR8 C;  4JI6 C;  4DCV A;  4JV5 C;  2P2F A;  3E7X A;  4JI1 C;  3ETO A;  1V25 A;  3O2E A;  2QL8 A;  4BBY A;  1P4E A;  4PUG A;  1HNX C;  2DYJ A;  4I9G A;  1JOS A;  3H2T A;  3UOW A;  4JI8 C;  2P2M A;  4JM1 A;  3L8C A;  5A1G A;  2E8E A;  3R9X A;  3DLP X;  5E7Q A;  5KYV A;  3PRO C;  4FUT A;  4GKK C;  5BSU A;  2Y4O A;  4OXI A;  4RVO A;  2QVZ X;  1N33 C;  3VNQ A;  4X64 C;  1XRC A;  2UXC C;  3UEB A;  2CXC A;  2ZTB A;  1TH5 A;  1HR0 C;  4IZ6 A;  2KZF A;  2P20 A;  1PG4 A;  4PHT A;  1FLO A;  1MDF A;  4MH4 A;  4DCS A;  4RLF A;  4R0M A;  2D7V A;  2ATW A;  2DPL A;  5AE1 A;  4FUQ A;  2Y27 A;  3FM7 A;  4U5Y D;  5BUR A;  3J7A D;  3TUF A;  4DV4 C;  1WH9 A;  1N36 C;  2OPL B;  2VZE A;  3LNO A;  2MCQ A;  2HJG A;  2D1R A;  2E5L C;  3R44 A;  3LAX A;  1FUG A;  4HPV A;  4NDN A;  4L7I A;  2ZZN A;  1N32 C;  2PG1 E;  4LFC C;  2VSQ A;  5IFI A;  4G36 A;  4BC9 A;  2ASB A;  5A2Q D;  3VNR A;  4RLQ A;  4OX9 C;  4ZLP A;  1ML8 A;  3NPD A;  1IB8 A;  5IT9 D;  3IML A;  2VQF C;  2M5H A;  5FLX D;  2KDN A;  3KXW A;  1RG9 A;  4LF5 C;  1YJ7 A;  3GR1 A;  4PRO C;  4NOZ A;  3LUS A;  2UXB C;  4PUH A;  1USP A;  3NYR A;  3VNS A;  2D1T A;  3PES A;  2V7B A;  2YCB A;  3I07 A;  4B3M C;  5KYT A;  3RG2 A;  4X65 C;  3UX2 A;  3SO4 A;  1XHJ A;  4D57 A;  2P2B A;  5LMN C;  3IPL A;  2D1Q A;  2OO4 A;  2D28 C;  3DHV A;  4YY3 C;  2PRO A;  1M6X A;  3GKU A;  4DV6 C;  3G7S A;  4D4I A;  1O93 A;  5GTD A;  4G1I A;  2OBV A;  2ZZM A;  4JI4 C;  5BSM A;  4JYA C;  2UXD C;  4B3T C;  1NY8 A;  1ZB9 A;  1IBM C;  3LNV A;  4EAT A;  3TR3 A;  3RV2 A;  2UUC C;  1BA3 A;  5BSR A;  3T1H C;  4RM3 A;  3IEU A;  1FJG C;  3L95 X;  1YGT A;  4DCT A;  4LF7 C;  4DR6 C;  2PN2 A;  1AMU A;  5ADZ A;  1XS3 A;  4K0B A;  1HH2 P;  1P7L A;  3E7W A;  3PBK A;  2D1S A;  3LGX A;  1UWD A;  1XMQ C;  1LQL A;  3CW9 A;  1RY2 A;  4RVN A;  4NXN C;  3TQI A;  4GXQ A;  3UZ0 A;  3EER A;  4ZJZ A;  4LF9 C;  4FTF A;  1HNW C;  5BUS A;  3S82 A;  2PT7 G;  4B3R C;  1P4E C;  1J5E C;  1MD9 A;  1MXB A;  4RMN A;  1N34 C;  5T8S A;  4LF4 C;  3T1Y C;  4DR3 C;  2JNV A;  2MM9 A;  3TDE A;  1T5D X;  4AQY C;  4GS5 A;  1PU1 A;  2WP0 C;  2E8C A;  2F4V C;  5H9U A;  3AF6 A;  3CQ3 A;  2M5O A;  4LFA C;  3K6R A;  3AY0 A;  4BCA A;  4DV5 C;  3DAY A;  4DR7 C;  5LMU C;  2QVX X;  2P2J A;  5IWA C;  5K8F A;  2EGT A;  4DV0 C;  4B3S C;  3GPC A;  3B7W A;  4DG9 A;  4X66 C;  3J81 D;  5CZX A;  5KEI A;  4LF6 C;  1MXC A;  2VQE C;  2WD9 A;  3IEV A;  3CQ2 A;  1IBL C;  5AE3 A;  1HNZ C;  1ULT A;  4LFB C;  4IR7 A;  1LCI A;  3A4I A;  4DR4 C;  1KKG A;  4DV3 C;  3FCC A;  4DV1 C;  2HHH C;  4YHH C;  1I94 C;  2JMP A;  4JI3 C;  2BH1 X;  1NYE A;  4DCU A;  2CY1 A;  4NXM C;  4WV3 A;  1T5H X;  2KZ0 A;  3A9V A;  4X62 C;  3J80 D;  1UKK A;  3A25 A;  2BJO A;  4D4G A;  2P2Q A;  1MDB A;  2AYA A;  3JAM D;  2YX1 A;  4R1M A;  1O92 A;  2OPL A;  4ODJ A;  1VLA A;  5T8T A;  1MXA A;  4MTN A;  2ONF A;  4XX2 A;  3NI2 A;  5K85 A;  4BSZ A;  3N2Q A;  5BSW A;  4L4Q A;  4OYC A;  2YWC A;  1XRB A;  1WCJ A;  4DR1 C;  4DUZ C;  1XNQ C;  4RM2 A;  4LE5 A;  4JI2 C;  1ZB8 A;  2UUB C;  3EQ6 A;  1QWI A;  2E0G A;  3A9U A;  2E7G A;  4TPS B;  3OTO C;  2UU9 C;  1IBK C;  4K0K C;  1VEH A;  1XRA A;  2DHM A;  2ZM6 C;  3FCE A;  4GXR A;  4LF8 C;  1USP B;  5LCI A;  4KHP C;  2QVY X;  3NYQ A;  3CQ1 A;  2UUA C;  5A1I A;  4KTV A;  4DV7 C;  4WS9 A;  3UX3 A;  1PA4 A;  1V60 A;  5BSV A;  3A26 A;  3N54 B;  4BC7 A;  5A19 A; 
#chains in the Genus database with same CATH homology
 4JI5 C;  3GR0 A;  4G37 A;  5DV9 A;  4L2Z A;  1WF3 A;  1EGA A;  1XMO C;  1V26 A;  2Y4N A;  1N2F A;  3C5E A;  2E8F A;  3R9W A;  4I9F A;  1MKY A;  3I08 A;  4R1L A;  3CW8 X;  5AE2 A;  4PZP A;  2P02 A;  3AF5 A;  1GPM A;  4JI7 C;  4DUY C;  1XNR C;  4JI0 C;  1QM4 A;  4DG8 A;  2QW0 X;  4KTT A;  5CZV A;  4D56 A;  4GKJ C;  2D27 A;  1L2F A;  1O9T A;  4DV2 C;  4ISB A;  1K0R A;  5JRH A;  1PG3 A;  3CJE A;  5BST A;  5BUQ A;  4DR2 C;  3ETC A;  4DR5 C;  1O90 A;  2XR1 A;  2YWB A;  5BR8 C;  4JI6 C;  4DCV A;  4JV5 C;  2P2F A;  3E7X A;  4JI1 C;  3ETO A;  1V25 A;  2QL8 A;  4BBY A;  1HNX C;  2DYJ A;  4I9G A;  1JOS A;  3H2T A;  3UOW A;  4JI8 C;  2P2M A;  4JM1 A;  3L8C A;  5A1G A;  2E8E A;  3R9X A;  3DLP X;  5E7Q A;  5KYV A;  3PRO C;  4FUT A;  4GKK C;  5BSU A;  2Y4O A;  4OXI A;  4RVO A;  2QVZ X;  1N33 C;  3VNQ A;  4X64 C;  1XRC A;  2UXC C;  2CXC A;  1HR0 C;  4IZ6 A;  2KZF A;  2P20 A;  1PG4 A;  4PHT A;  1MDF A;  4MH4 A;  4DCS A;  4RLF A;  4R0M A;  2D7V A;  2ATW A;  2DPL A;  5AE1 A;  4FUQ A;  2Y27 A;  4U5Y D;  5BUR A;  3J7A D;  3TUF A;  4DV4 C;  1WH9 A;  1N36 C;  2OPL B;  2VZE A;  2HJG A;  2D1R A;  2E5L C;  3R44 A;  3LAX A;  1FUG A;  4HPV A;  4NDN A;  4L7I A;  1N32 C;  4LFC C;  2VSQ A;  5IFI A;  4G36 A;  4BC9 A;  2ASB A;  5A2Q D;  3VNR A;  4RLQ A;  4OX9 C;  4ZLP A;  1ML8 A;  3NPD A;  5IT9 D;  3IML A;  2VQF C;  5FLX D;  3KXW A;  1RG9 A;  4LF5 C;  1YJ7 A;  3GR1 A;  4PRO C;  4NOZ A;  3LUS A;  2UXB C;  1USP A;  3NYR A;  3VNS A;  2D1T A;  3PES A;  2V7B A;  2YCB A;  3I07 A;  4B3M C;  5KYT A;  3RG2 A;  4X65 C;  3SO4 A;  4D57 A;  2P2B A;  5LMN C;  3IPL A;  2D1Q A;  2OO4 A;  2D28 C;  3DHV A;  4YY3 C;  2PRO A;  3GKU A;  4DV6 C;  3G7S A;  4D4I A;  1O93 A;  5GTD A;  4G1I A;  2OBV A;  4JI4 C;  5BSM A;  4JYA C;  2UXD C;  4B3T C;  1ZB9 A;  1IBM C;  3LNV A;  4EAT A;  2UUC C;  3RV2 A;  1BA3 A;  5BSR A;  3T1H C;  4RM3 A;  3IEU A;  1FJG C;  3L95 X;  4DCT A;  4LF7 C;  4DR6 C;  2PN2 A;  1AMU A;  5ADZ A;  4K0B A;  1HH2 P;  1P7L A;  3E7W A;  3PBK A;  2D1S A;  3LGX A;  1XMQ C;  1LQL A;  3CW9 A;  1RY2 A;  4RVN A;  4NXN C;  3TQI A;  4GXQ A;  3UZ0 A;  3EER A;  4ZJZ A;  4LF9 C;  4FTF A;  1HNW C;  5BUS A;  3S82 A;  2PT7 G;  4B3R C;  1J5E C;  1MD9 A;  1MXB A;  4RMN A;  1N34 C;  5T8S A;  4LF4 C;  3T1Y C;  4DR3 C;  3TDE A;  1T5D X;  4AQY C;  4GS5 A;  2WP0 C;  2E8C A;  2F4V C;  5H9U A;  3AF6 A;  4LFA C;  4BCA A;  4DV5 C;  3DAY A;  4DR7 C;  5LMU C;  2QVX X;  2P2J A;  5IWA C;  5K8F A;  2EGT A;  4DV0 C;  4B3S C;  3GPC A;  3B7W A;  4DG9 A;  4X66 C;  3J81 D;  5CZX A;  5KEI A;  4LF6 C;  1MXC A;  2VQE C;  2WD9 A;  3IEV A;  1IBL C;  5AE3 A;  1HNZ C;  1ULT A;  4LFB C;  4IR7 A;  1LCI A;  3A4I A;  4DR4 C;  1KKG A;  4DV3 C;  3FCC A;  4DV1 C;  2HHH C;  4YHH C;  1I94 C;  2JMP A;  4JI3 C;  2BH1 X;  1NYE A;  4DCU A;  2CY1 A;  4NXM C;  4WV3 A;  1T5H X;  3A9V A;  4X62 C;  3J80 D;  1UKK A;  2BJO A;  4D4G A;  2P2Q A;  1MDB A;  2AYA A;  3JAM D;  4R1M A;  1O92 A;  2OPL A;  4ODJ A;  1VLA A;  5T8T A;  1MXA A;  4MTN A;  2ONF A;  4XX2 A;  3NI2 A;  5K85 A;  4BSZ A;  3N2Q A;  5BSW A;  4L4Q A;  4OYC A;  2YWC A;  1XRB A;  4DR1 C;  4DUZ C;  1XNQ C;  4RM2 A;  4LE5 A;  4JI2 C;  1ZB8 A;  2UUB C;  3EQ6 A;  1QWI A;  2E0G A;  3A9U A;  2E7G A;  4TPS B;  3OTO C;  2UU9 C;  1IBK C;  4K0K C;  1XRA A;  2ZM6 C;  3FCE A;  4GXR A;  4LF8 C;  1USP B;  4KHP C;  2QVY X;  3NYQ A;  2UUA C;  5A1I A;  4KTV A;  4DV7 C;  4WS9 A;  1PA4 A;  5BSV A;  3N54 B;  4BC7 A;  5A19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...